Aviva Systems Biology ITGA2B antibody - N-terminal region (ARP63955_P050) Product Number ARP63955_P050 Product Page http://www.avivasysbio.com/itga2b-antibody-n-terminal-region-arp63955-p050.html Product Name ITGA2B antibody - N-terminal region (ARP63955_P050) Size 100 ul Gene Symbol ITGA2B Alias Symbols CD41, CD41B, GP2B, GPIIb, GTA, HPA3, GT, BDPLT2 Protein Size (# AA) 1039 amino acids Molecular Weight 16kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 3674 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) Name Description This is a rabbit polyclonal antibody against ITGA2B. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: QGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRR Description of ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane Target proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post- translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. Protein Interactions FBXO6; PRKACA; CAMK2A; ITGA2B; AUP1; CIB1; CLNS1A; VWF; TLN1; F2; CD36; ITGB3; FGA; COL1A2; COL2A1; CALR; GRB2; RNF181; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-ITGA2B (ARP63955_P050) antibody is Catalog # AAP63955 Complete Anti-ITGA2B (ARP63955_P050) computational species homology data 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ITGA2B. Swissprot Id P08514 Protein Name Integrin alpha-IIb Protein Accession NP_000410 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ITGA2B. Nucleotide NM_000419 Accession # Replacement Item This antibody may replace item sc-15328 from Santa Cruz Biotechnology. Conjugation ARP63955_P050-FITC Conjugated Options ARP63955_P050-HRP Conjugated ARP63955_P050-Biotin Conjugated CB Replacement sc-15328; sc-166599; sc-19963; sc-21773; sc-21783; sc-365938; sc-373992; sc-43554; sc-45927; sc-52816; sc-53358; sc-59955; sc-6602; sc-6604; sc-71429; sc-71430; sc-7310 Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast Application WB Predicted Dog: 100%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 92%; Homology Based Rabbit: 85%; Rat: 92%; Yeast: 100% on Immunogen Sequence
Image 1: Human Fetal liver WB Suggested Anti-ITGA2B Antibody Titration: 1.0 ug/ml Positive Control: Fetal Liver
AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2