NLGN4X antibody - N-terminal region (ARP49556_P050) Data Sheet
Product Number ARP49556_P050 Product Name NLGN4X antibody - N-terminal region (ARP49556_P050) Size 50ug Gene Symbol NLGN4X Alias Symbols ASPGX2; AUTSX2; HLNX; HNLX; KIAA1260; MGC22376; NLGN; NLGN4; HNL4X Nucleotide Accession# NM_020742 Protein Size (# AA) 816 amino acids Molecular Weight 92kDa Product Format Lyophilized powder NCBI Gene Id 57502 Host Rabbit Clonality Polyclonal Official Gene Full Name Neuroligin 4, X-linked This is a rabbit polyclonal antibody against NLGN4X. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN Target Reference Wermter,A.K., Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (4), 535-537 NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.Western blots using two different antibodies against two unique regions of this Description of Target protein target confirm the same apparent molecular weight in our tests. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta- neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. Partner Proteins DLG4, DLGAP2, DLG4 Reconstitution and Add 50 ul of distilled water. Final anti-NLGN4X antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-NLGN4X antibody is Catalog # AAP49556 (Previous Catalog # AAPP29409) Immunogen The immunogen for anti-NLGN4X antibody: synthetic peptide directed towards the N terminal of human NLGN4X Swissprot Id Q8NFZ3 Protein Name Neuroligin-4, Y-linked Protein Accession # NP_065793 Purification Affinity Purified Species Reactivity Mouse, Zebrafish, Human, Rat, Dog, Bovine, Pig, Horse, Rabbit, Guinea pig Application WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% Sequence
Human HeLa WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/ml Positive Control: Hela cell lysate
Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.