Folsom Lake College
2011-2012
$3.00 2011-2012 Academic Calendar
Summer 2011 session – June 6, 2011 to August 5, 2011 June 6 Instruction begins -XQH /DVWGD\WRSHWLWLRQIRUJUDGXDWLRQFHUWLÀFDWLRQ -XO\ +ROLGD\,QGHSHQGHQFH'D\ QRFODVVHVRIÀFHVFORVHG August 5 End of session
Fall 2011 semester – August 20, 2011 to December 15, 2011 August 20 Instruction begins - Saturday classes August 22-26 Most Fall classes begin 6HSWHPEHU +ROLGD\/DERU'D\ QRFODVVHVRIÀFHVFORVHG 2FWREHU /DVWGD\WRSHWLWLRQIRUJUDGXDWLRQFHUWLÀFDWLRQ 1RYHPEHU +ROLGD\9HWHUDQV'D\ QRFODVVHVRIÀFHVFORVHG 1RYHPEHU 7KDQNVJLYLQJ5HFHVV QRFODVVHVRIÀFHVFORVHG December 9-15 Final Exams December 15 End of semester 'HFHPEHU-DQXDU\ 6HPHVWHUEUHDN QRFODVVHV
Spring 2012 semester – January 14, 2012 to May 16, 2012 January 14 Instruction begins - Saturday classes -DQXDU\ +ROLGD\0DUWLQ/XWKHU.LQJ-U·V%LUWKGD\ QRFODVVHVRIÀFHVFORVHG January 17-20 Most Spring classes begin )HEUXDU\ +ROLGD\/LQFROQ·V%LUWKGD\ QRFODVVHVRIÀFHVFORVHG )HEUXDU\ +ROLGD\:DVKLQJWRQ·V%LUWKGD\ QRFODVVHVRIÀFHVFORVHG 0DUFK/DVWGD\WRSHWLWLRQIRUJUDGXDWLRQFHUWLÀFDWLRQ $SULO 6SULQJUHFHVV QRFODVVHV May 16 End of semester Important Phone Numbers Main Folsom campus El Dorado Center
$GPLVVLRQV 5HJLVWUDWLRQ $GPLVVLRQV 5HJLVWUDWLRQ $VVHVVPHQW $VVHVVPHQWDQG2ULHQWDWLRQ %XVLQHVV6HUYLFHV &DO:25.V &DO:25.V &RPSXWHU/DE &RXQVHOLQJ &RPSXWHU/DE RU '63 6 &RXQVHOLQJ (QJOLVK&HQWHU '63 6 (23 6&$5( (23 6&$5( )LQDQFLDO$LG )LQDQFLDO$LG /LEUDU\ +HDOWK :HOOQHVV6HUYLFHV /LEUDU\ 2ULHQWDWLRQ Rancho Cordova Center 5HDGLQJ :ULWLQJ&HQWHU 7XWRULQJ 0DLQ2IÀFH Folsom Lake College 2011-2012 1 Folsom Lake College 2011-2012 College Catalog Table of Contents
2011-2012 Academic Calendar, Important Phone Numbers inside front cover (important dates and contact numbers) Courses of Study and Prefixes 2 (list of subjects) A Message from Folsom Lake College President Dr. Thelma Scott-Skillman 3 About Folsom Lake College 4 General Information and Other Resources 6 (educational options) Admission, Matriculation, and Registration 8 (registration information) Fees 13 Student Access Card 15 College and Academic Regulations 16 (definitions and explanations of academic terms) Alternative Credit/Study Options 21 (Advanced Placement tests, credit by examination, online, televised, study abroad, work experience, and more) Graduation Requirements 27 (graduation information) Associates Degree Graduation Requirements 28 (listings of courses required for the Associates Degree) Degrees and Certificates 29 (lists of degrees and certificates available through Folsom Lake College) Transfer Information 30 (information on/about transferring to universities and private colleges) Student Development Programs and Services 34 (programs to assist/support student success) Libraries 40 Financial Aid 42 (programs and information for financial assistance) Policies on the Rights of Individuals 45 (policies and rights regarding diversity, discrimination, and ethics) Student Rights and Responsibilities 49 (academic rights, responsibilities, conduct code, discipline process, and grievance policy) Campus Safety and Security 56 (information on traffic, safety, prevention, and assault) Course Numbering, Prerequisites, & More 61 (description of course numbering, prerequisites, corequisites, and advisories) Course, Degree, & Certificate Offerings 63 (course, degree, and certificate descriptions and requirements) Faculty and Staff 271 (list of administrators, full-time faculty, and classified staff) Catalog Index 278 Campus Maps 283-286 About this Catalog Los Rios Community College District The Los Rios Community College District and Folsom Lake College have made Board of Trustees every effort to determine that everything stated in this catalog is accurate. Ms. Kay Albiani Courses and programs offered, together with other matters contained herein, Mr. Terry Cochran are subject to change without notice by the Administration of the Los Rios Ms. Pamela Haynes Community College District and Folsom Lake College for reasons related to Mr. Dustin Johnson VWXGHQWHQUROOPHQWOHYHORIÀQDQFLDOVXSSRUWRUIRUDQ\RWKHUUHDVRQDWWKH Mr. Robert Jones discretion of the District and the College. The District and the College further Ms. Deborah Ortiz reserve the right to add, amend, or repeal any of their rules, regulations, Ms. Ruth Scribner policies, and procedures. Chancellor 3XEOLVKHGE\WKH)ROVRP/DNH&ROOHJH3XEOLF,QIRUPDWLRQ6HUYLFHV2IÀFH 3,62 Dr. Brice W. Harris March 2011. Cover design by Jane Crandell and Matt Battershell. 2 Folsom Lake College 2011-2012 Courses of Study and Prefixes
$FFRXQWLQJ $&&7 ...... 64 +LVWRU\ +,67 ...... 178 $GPLQLVWUDWLRQRI-XVWLFH $'0- ...... 69 +RUWLFXOWXUH +257 ...... 181 $OOLHG+HDOWK $+ ...... 73 +XPDQ&DUHHU'HYHORSPHQW +&' ...... 182 American Studies (see Interdisciplinary Studies) +XPDQ6HUYLFHV +6(5 ...... 184 $QWKURSRORJ\ $17+ ...... 74 +XPDQLWLHV +80 ...... 190 $UFKLWHFWXUH $5&+ ...... 76 Interdisciplinary Studies ...... 192 $UW $57 ...... 77 -RXUQDOLVP -285 ...... 195 $UW+LVWRU\ $57+ ...... 82 /LEUDU\ /,%5 ...... 196 $VWURQRP\ $675 see Physics) 0DQDJHPHQW 0*07 ...... 197 %LRORJ\ %,2/ ...... 85 0DQDJHPHQW,QIRUPDWLRQ6\VWHPV see CIS) %XVLQHVV %86 ...... 91 0DUNHWLQJ 0.7 ...... 200 %XVLQHVV7HFKQRORJ\ %867(& ...... 98 0DWKHPDWLFV 0$7+ ...... 203 &KHPLVWU\ &+(0 ...... 100 Music ...... 208 &RPPXQLFDWLRQ6WXGLHV &200 ...... 103 +LVWRU\ /LWHUDWXUH 08)+/ ...... 208 &RPPXQLFDWLRQV0HGLD &0(' ...... 108 ,QVWUXPHQWDO9RLFH 08,9, ...... 209 &RPSXWHU,QIRUPDWLRQ6FLHQFH &,6 ...... 110 3HUIRUPDQFH 083 ...... 211 $SSOLFDWLRQV &,6$ ...... 115 6SHFLDOL]DWLRQ 0860 ...... 212 &RUH &,6& ...... 116 1DWXUDO5HVRXUFHV 1$75 ...... 213 3URJUDPPLQJ &,63 ...... 117 1RQ3URÀW0DQDJHPHQW ...... 214 :HE &,6: ...... 120 1XWULWLRQ )RRGV 1875, ...... 215 &RQVWUXFWLRQ0DQDJHPHQW7HFKQRORJ\ &07 ...... 121 3KLORVRSK\ 3+,/ ...... 217 (DUO\&KLOGKRRG(GXFDWLRQ (&( ...... 122 3KRWRJUDSK\ 3+272 ...... 220 (FRQRPLFV (&21 ...... 135 3K\VLFDO(GXFDWLRQ.LQHVLRORJ\ ...... 223 (GXFDWLRQ7HDFKLQJ ...... 136 $GDSWHG3( $'$37 ...... 224 (PHUJHQF\0HGLFDO7HFKQRORJ\ (07 ...... 138 'DQFH '$1&( ...... 224 (QHUJ\ (1(5*< ...... 139 )LWQHVV ),716 ...... 226 (QJLQHHULQJ (1*5 ...... 140 .LQHVLRORJ\ .,1(6 ...... 228 (QJOLVK...... 142 3HUVRQDO$FWLYLWLHV 3$&7 ...... 230 &UHDWLYH:ULWLQJ (1*&: ...... 142 6SRUWV 63257 ...... 231 (GXFDWLRQ (1*(' ...... 143 3K\VLFV 3+<6 ...... 232 /DERUDWRU\ (1*/% ...... 144 Physical Science (see Physics) /LWHUDWXUH (1*/7 ...... 144 3ROLWLFDO6FLHQFH 32/6 ...... 235 5HDGLQJ (1*5' ...... 147 3URMHFW0DQDJHPHQW 35-0*7 ...... 237 :ULWLQJ (1*:5 ...... 147 3V\FKRORJ\ 36<& ...... 240 (QJOLVKDVD6HFRQG/DQJXDJH ...... 151 Public Management ...... 244 *UDPPDU (6/* ...... 151 5HDO(VWDWH 5( ...... 245 /LVWHQLQJ (6// ...... 152 Science (major program) ...... 249 3URQXQFLDWLRQ (6/3 ...... 153 6LJQ/DQJXDJH6WXGLHV 6,/$ ...... 251 5HDGLQJ (6/5 ...... 153 6RFLRORJ\ 62& ...... 253 :ULWLQJ (6/: ...... 154 6SDQLVK 63$1 ...... 254 (QYLURQPHQWDO7HFKQRORJ\ (197 ...... 156 6WDWLVWLFV 67$7 (see Mathematics) )DPLO\DQG&RQVXPHU6FLHQFH )&6 ...... 160 6WXGHQW*RYHUQPHQW 6*97 ...... 257 Film and Media Studies (see Communications Media) 7KHDWUH$UWV 7$ ...... 258 )LUH7HFKQRORJ\ )7 ...... 161 9LWLFXOWXUH 9,7, ...... 261 )UHQFK )5(1 ...... 164 Waste Water Management ...... 263 *HQHUDO(GXFDWLRQ7UDQVIHU ...... 167 Water Management ...... 264 *HRJUDSK\ *(2* ...... 169 Women’s Studies (see Interdisciplinary Studies) *HRORJ\ *(2/ ...... 171 :RUN([SHULHQFH :(;3 ...... 265 *HURQWRORJ\(See Human Services) *UDSKLF&RPPXQLFDWLRQ *&20 ...... 174 +HDOWK(GXFDWLRQ +((' ...... 176 Folsom Lake College 2011-2012 3 A Message from the President
$VWKLVFDWDORJJRHV In addition, the Rancho Cordova Center will begin to print, Folsom Lake College construction of permanent facilities on its new site in late )/& LV DFWLYHO\ PHHWLQJ D 2011. Phase 1 is tentatively scheduled to open for classes variety of challenges caused by in Fall 2013. the ongoing State of California budget crisis. Speaking of this catalog, you hold in your hands a comprehensive guide to help you make informed choices While State budget challenges about your educational options. That information includes: are impacting FLC, they have Steps to take to become a student not diminished our commitment Information on resources to support your academic to serving the educational and success Dr. Thelma Scott-Skillman President, Folsom Lake College cultural needs of our students Detailed listings on the college’s academic programs, and communities. Whatever GHJUHHVDQGFHUWLÀFDWHV your educational goals may be, FLC stands ready to support you. 8VH WKLV FDWDORJ DV D UHVRXUFH 5HVHDUFK WKH GLIIHUHQW SURJUDPVDQGVHUYLFHVZHRIIHU Los Rios Community College District 7ZRFHQWHUV WKH(O'RUDGR&HQWHULQ3ODFHUYLOOHDQG (LRCCD) WKH5DQFKR&RUGRYD&HQWHU 9DULRXVRIIVLWHORFDWLRQVLQFRPPXQLWLHVRIWKHUHJLRQ Folsom Lake College is one of four community colleges within the Los Rios Community College District. The Los Rios District The college’s Master Plan calls for the college gradually was founded in July 1965 when voters in ten separate school JURZLQJWRHYHQWXDOO\DFFRPPRGDWHVWXGHQWV GLVWULFWV FRYHULQJ ÀYH FRXQWLHV RSWHG WR FRQVROLGDWH 7KH election established a regional community college district of 2,400 square miles and brought together, under one ,Q6SULQJ)ROVRP/DNH&ROOHJHHQUROOHGDSSUR[LPDWHO\ JRYHUQLQJERDUGWKHWKHQH[LVWLQJ6DFUDPHQWR&LW\DQG VWXGHQWVFKRRVLQJIURPDPRQJDSSUR[LPDWHO\ American River colleges. Currently the district enrolls nearly different course sections. Those students were served by VWXGHQWV WKURXJKRXW 6DFUDPHQWR DQG (O 'RUDGR IXOOWLPHIDFXOW\SDUWWLPHIDFXOW\FODVVLÀHG FRXQWLHVDQGSDUWVRI Los Rios Community College Folsom Lake College Mission Statement Folsom Lake College provides: District Values Programs Student success Rigorous academic programs for completion and The contributions of all our members transfer; training to enhance employment and Collegiality career skills; preparatory programs for student Diversity success; and opportunities for lifelong learning Informed and decentralized decision making and enrichment. Measured risk taking Support Services %ODPHIUHHFXOWXUH Comprehensive support services to promote the Serving the community success of all students. Financial stability Opportunities Democratic practices Opportunities for leadership; professional Lifelong learning development; and involvement in the college and Academic rigor community. Relationships Environment (FRQRPLFGHYHORSPHQWRIWKHFRPPXQLW\ A collaborative and innovative environment that ([FHOOHQFH promotes personal interaction as the foundation of Access learning; honors diversity; cultivates sustainability; and encourages civic engagement. Folsom Lake College Folsom Lake College is a comprehensive, public community Folsom Lake College Vision Statement college, the 109th community college in the State of )ROVRP /DNH &ROOHJH LQVSLUHV H[FHOOHQFH DQG SURYLGHV California. In January 2004, Folsom Lake College received educational opportunities to enrich and empower students. initial accreditation from the Accrediting Commission for &RPPXQLW\DQG-XQLRU&ROOHJHV $&&-& RIWKH:HVWHUQ $VVRFLDWLRQRI6FKRROVDQG&ROOHJHVRQHRIVL[UHJLRQDO El Dorado Center DFFUHGLWLQJDVVRFLDWLRQVLQWKH86$FFUHGLWDWLRQFHUWLÀHVWR )ROVRP/DNH&ROOHJH·V(O'RUDGR&HQWHUZDVHVWDEOLVKHGLQ students and the community that an educational institution WKHPLG VDVDVWDWHIXQGHGHGXFDWLRQFHQWHUDQGZDV PHHWVRUH[FHHGVVSHFLÀFVWDQGDUGVRITXDOLW\,Q-DQXDU\ ORFDWHGLQVHYHUDOSRUWDEOHEXLOGLQJVRQ(O'RUDGR&RXQW\ WKHFROOHJH·VDFFUHGLWDWLRQZDVUHDIÀUPHGE\WKH ODQGQH[WWRWKHFRXQW\IDLUJURXQGV%HFDXVHRIWKHFRQWLQXHG ACCJC. enrollment growth at the center, and the keen interest and GHVLUHRIWKHFLWL]HQVRIWKH*UHDWHU3ODFHUYLOOHDUHDWR Folsom Lake College serves the community with classes have a permanent community college center in Placerville, offered at: the Los Rios Community College District Board of Trustees 7KHPDLQ)ROVRPFDPSXVDW&ROOHJH3DUNZD\ MXVW DXWKRUL]HG WKH SXUFKDVH RI DSSUR[LPDWHO\ DFUHV RI RII+LJKZD\ ODQGIURPWKH(O'RUDGR&RXQW\%RDUGRI(GXFDWLRQ7KH site was approved by the California Community Colleges Folsom Lake College 2011-2012 5 and the State of California for a permanent site in 1988. &RQVWUXFWLRQRIWKHÀUVWSKDVHRISHUPDQHQWIDFLOLWLHVZDV completed in the spring of 1994 and opened for classes in August 1994. A physical education building was completed and opened for classes in January 1999. An additional parking lot opened in Fall 2003. A second instructional EXLOGLQJWKDWFRPSOHWHGWKHFHQWHU·VEXLOGRXWZDVRSHQHG in Spring 2006. 7KH(O'RUDGR&HQWHUVHUYHVWKHHGXFDWLRQDOQHHGVRIWKRVH ZRUNLQJDQGOLYLQJRQWKHZHVWHUQVORSHRI6LHUUD1HYDGD LQ(O'RUDGRDQGDGMRLQLQJFRXQWLHV$SSUR[LPDWHO\ VWXGHQWV DWWHQG WKH (O 'RUDGR &HQWHU 7KH IDFLOLW\ KDV VWDWHRIWKHDUWVFLHQFHODEVDQGDÀWQHVVFHQWHUDQGKDV been recognized with a statewide architectural award of H[FHOOHQFH7KHFHQWHURIIHUVDIXOOUDQJHRIWUDQVIHUDQG vocational programs as well as student support services. The center is well positioned to meet the educational needs of the area’s growing population. One of the instructional buildings at the Rancho Cordova Center El Dorado Center in Placerville The Rancho Cordova Center, an outreach center operated number of residents in this service area. The center offers by Folsom Lake College, is located just minutes south of DFRPSUHKHQVLYH(QJOLVKDVD6HFRQG/DQJXDJHFXUULFXOXP Highway 50 and 10 miles east of downtown Sacramento. as well as a range of general education, computer science, The center was developed in response to the growing administration of justice, and business courses. Alternative course delivery options, including online and televised courses, are available. The center also provides a variety of support services to assist students in achieving their About FLC Students educational goals. Gender Female 59% Male 41% Age 8QGHU 3% 31% 21% 11% 13% 40+ 22% Race/ethnicity $IULFDQ$PHULFDQ 3% $VLDQ)LOLSLQR3DFLÀF,VODQGHU 12% +LVSDQLF/DWLQR 13% 1DWLYH$PHULFDQ 3% Other 3% The entrance to the Rancho Cordova Center White 66% 6 Folsom Lake College 2011-2012 General Information and Other Resources A Commitment to Student Success technical programs and is committed to offering day, Folsom Lake College is a publicly supported and locally evening, weekend, and summer courses. The policy of this oriented college that offers programs for associate degrees 'LVWULFWLVWKDWXQOHVVVSHFLÀFDOO\H[HPSWHGE\VWDWXWHRU DQG WUDQVIHU WR D IRXU\HDU FROOHJH FDUHHU HGXFDWLRQ regulation, every course, course section, or class reported for programs, remedial or basic skills programs for students state aid, wherever offered and maintained by the District, who lack a strong educational background, and continuing shall be fully open to enrollment and participation by any education for cultural growth, life enrichment, and skills SHUVRQZKRKDVEHHQDGPLWWHGWRWKHFROOHJH V DQGZKR improvement. FLC is committed to providing the highest meets such prerequisites as may be established. quality instructional programs in transfer, vocational, and general education, using the best of current or emerging Student Development Programs instructional methods and technologies. The college and Services SURPRWHVÁH[LEOHWHDFKLQJDQGOHDUQLQJPHWKRGVWRVXSSRUW $VDFRPPXQLW\EDVHGLQVWLWXWLRQWKHFROOHJHVWULYHVWREH the success of its diverse student population in attaining responsive to the educational needs of growing communities educational and career goals. RIWKH*UHDWHU6DFUDPHQWRUHJLRQ7RPHHWWKHFKDOOHQJHV RISRSXODWLRQJURZWKZHH[SORUHQHZGHOLYHU\DSSURDFKHV Accreditation to provide a high level of access to education. We also Folsom Lake College is accredited by the Accrediting provide comprehensive support services to ensure access by Commission for Community and Junior Colleges of the UHGXFLQJRUHOLPLQDWLQJVLJQLÀFDQWEDUULHUVDQGE\SURPRWLQJ Western Association of Schools and Colleges, an institutional diversity. We are committed to ensuring that students from accrediting body recognized by the Council of Higher a wide variety of backgrounds have an equal chance to (GXFDWLRQ $FFUHGLWDWLRQ DQG WKH 86 'HSDUWPHQW RI achieve their educational goals. (GXFDWLRQ7KH(O'RUDGRDQG5DQFKR&RUGRYD&HQWHUVDUH fully accredited under Folsom Lake College. $VVRFLDWH'HJUHHVDQG&HUWLÀFDWHV Folsom Lake College offers training needed to qualify Student Access VWXGHQWV IRU D ZHOOSD\LQJ MRE ZLWK RSSRUWXQLWLHV IRU )ROVRP /DNH &ROOHJH DV D PHPEHU RI WKH PXOWLFROOHJH advancement. Students planning to graduate with an Los Rios Community College District, endorses the open Associate in Arts or Science degree must complete the GRRUSROLF\RIWKHGLVWULFW$VDPXOWLFXOWXUDOLQVWLWXWLRQRXU JHQHUDO HGXFDWLRQ UHTXLUHPHQWV &HUWLÀFDWH SURJUDPV academic programs and services are open to all persons have been developed to assist those already employed in without regard to race, color, marital status, religion, business and industry or those who desire to upgrade their QDWLRQDORULJLQDJHJHQGHUVH[XDORULHQWDWLRQSK\VLFDO skills or acquire special training. Career technical programs or mental disability, or veteran status. are offered in many areas that employers need. Career WHFKQLFDO YRFDWLRQDO RU RFFXSDWLRQDO HGXFDWLRQ LQFOXGHV Equal Opportunity: FLC is committed to identifying and WHFKQLFDOWUDGHVKHDOWKRFFXSDWLRQVEXVLQHVVDQGÀQDQFH modifying any action that may alienate individuals and computer sciences, law enforcement, and many others. The groups from each other. To do this, the college has: FROOHJHKDVXSWRGDWHHTXLSPHQWIDFLOLWLHVDQGSURIHVVRUV (VWDEOLVKHGYDULHGSURJUDPVDQGVHUYLFHVWKDWHQVXUH ZKRDUHH[SHUWVLQWKHLUÀHOGV HTXDORSSRUWXQLWLHVIRUZRPHQPLQRULW\ORZLQFRPH disabled, and disadvantaged students to succeed in General Education all areas within the college program; *HQHUDOHGXFDWLRQFRXUVHVDUHWKRVHFODVVHVWKDWFRYHUD Assured equal opportunity for ethnic minorities, wide range of disciplines. The college is committed to the disabled persons, and women in the areas of principle of providing a broad general education that employment, promotions, and assignments; and LQFOXGHV 1DWXUDO6FLHQFH6RFLDODQG%HKDYLRUDO6FLHQFHV Implemented programs to increase understanding and Humanities and the Arts, and Language and Critical Thinking. sensitivity among members of the majority group to The college continues to offer other courses that enhance the rising aspirations and occasionally unique needs lifelong learning and prepare students for the needs and of minority groups. demands of everyday life. All of these skills help create a balanced life in a democratic society that is diverse in its Open Courses: Folsom Lake College places an emphasis on social, cultural, and educational backgrounds. providing both general education and high quality career Folsom Lake College 2011-2012 7 Transfer Education Other Resources 7KHFROOHJHRIIHUVFRXUVHVWKDWPHHWORZHUGLYLVLRQ ÀUVWWZR \HDUV UHTXLUHPHQWVRIDIRXU\HDUFROOHJHRUXQLYHUVLW\ Contract Education/Contract Training 7KHFROOHJHVWDIILVFRQWLQXDOO\GHYHORSLQJORZHUGLYLVLRQ Customized training and education for employers and their HGXFDWLRQDOSURJUDPVWKDWSDUDOOHOWKHÀUVWDQGVHFRQG employees in the Sacramento area are offered by FLC in \HDUFRXUVHVRIIRXU\HDUFROOHJHVDQGXQLYHUVLWLHV collaboration with the LRCCD Training Source. Contract courses are scheduled at any time throughout the year Advanced Education for and vary from a single workshop to a series of classes provided over a few weeks or months. The Training Source High School Students DOVRFRQGXFWVRQVLWHFROOHJHFUHGLWDQGGHJUHHSURJUDPV Folsom Lake College provides the opportunity for high customized instruction for an employer’s assessed training VFKRROVWXGHQWVWRHQUROOLQFROOHJHOHYHOFRXUVHV6WXGHQWV requirements, as well as performance consulting. Since who desire to participate in concurrent enrollment must be 1985, the Training Source has provided training to more recommended by their high school principal or counselor WKDQ6DFUDPHQWRDUHDHPSOR\HHVLQFOXGLQJ,QWHO and have written parental permission. There are course %DQNRI$PHULFD$HURMHW*HQHUDO608'DQGPDQ\VWDWH restrictions for high school students. Information on the and local public agencies and school districts. To arrange for $GYDQFHG(GXFDWLRQSURFHVVDQGWKHDSSOLFDWLRQIRUPDUH VSHFLÀFHGXFDWLRQDOWUDLQLQJIRU\RXURUJDQL]DWLRQFRQWDFW DYDLODEOHDWWKHVWXGHQW·VKLJKVFKRRORQOLQHDWZZZÁF WKH7UDLQLQJ6RXUFHDW 7KH7UDLQLQJ6RXUFH ORVULRVHGXRU)/&PDLQFDPSXV('&RU5&& LVORFDWHGDW(WKDQ:D\LQ6DFUDPHQWRE\&DO([SR Basic Skills Education Courses designed to assist students who need to strengthen Greater Sacramento Small Business the basic skills of reading, writing, speaking, and analyzing Development Center (SBDC) DUHRIIHUHGLQVHYHUDOQRQGHJUHHDSSOLFDEOHSURJUDPV 7KH *UHDWHU 6DFUDPHQWR 6PDOO %XVLQHVV 'HYHORSPHQW Center offers personalized business counseling in: Business Community Education Management, Finance Resource, and Marketing Strategy. These programs are designed to respond to community 7RPDNHDFRQÀGHQWLDODSSRLQWPHQWFDOOWKH6%'&DW QHHGVDQGH[SHFWDWLRQVZLWKDX[LOLDU\SURJUDPVVXFKDV HPDLO LQIR#VEGFQHW RU YLVLW ZZZVEGFQHW. FUHGLWDQGQRQFUHGLWFODVVHVZRUNVKRSVOHFWXUHDQGÀOP 7KH6%'&LVORFDWHGDW(WKDQ:D\LQ6DFUDPHQWR VHULHVFRQFHUWVDUWH[KLELWVWHOHYLVLRQFRXUVHVFRQWLQXLQJ between Hallmark and Hurley. education courses, community services classes, and specially funded projects. North/Far North-Regional Environmental Business Resource and Assistance Center Continuing Education (N/FN-REBRAC) In its commitment to lifelong learning, the college offers 7KH 1RUWK)DU 1RUWK5HJLRQDO (QYLURQPHQWDO %XVLQHVV courses that are responsive to the varied needs of 5HVRXUFH DQG $VVLVWDQFH &HQWHU 1)15(%5$& ZDV DQ\RQHLQWHUHVWHGLQSXUVXLQJDFDGHPLFH[SHULHQFHVLQDQ established to provide environmental education and educational setting. assistance to businesses, college faculty, individuals, and public agencies with the goal of decreasing the Innovative Teaching and Learning costs associated with: hazardous material and waste With an Innovation Center dedicated to the development management, controlling air and wastewater emissions, and implementation of innovative teaching and learning maintaining a safe work environment, and the consumption approaches, the college demonstrates its commitment to of water and energy. Services include: client, student, and meeting the various learning needs of its diverse student faculty training, dissemination of technical information, body. Folsom Lake College provides continued professional referrals to service providers, and research into creative GHYHORSPHQWIRUIDFXOW\FODVVLÀHGVWDIIDQGDGPLQLVWUDWLRQ (QYLURQPHQWDO+HDOWKDQG6DIHW\ (+ 6 SURFHGXUHVDQG ÀQDQFLDOVXSSRUWRSWLRQVIRU(+ 6HTXLSPHQWSXUFKDVHV )RUPRUHLQIRUPDWLRQFDOO 8 Folsom Lake College 2011-2012 Admission, Matriculation, and Registration ADMISSION International Student Admissions Eligibility for Admission Folsom Lake College welcomes international students $GPLVVLRQ LV RSHQ WR DQ\ KLJK VFKRRO JUDGXDWH RU IURPDOORYHUWKHZRUOG6WXGHQWVZKRHQWHUWKH86RQD HTXLYDOHQW RUDQ\RQHZKRLVHLJKWHHQ\HDUVRIDJHRU QRQLPPLJUDQW YLVD DUH FRQVLGHUHG LQWHUQDWLRQDO VWXGHQWV older. High school students eligible for advanced education however, there are different attendance requirements for enrollment may enroll in up to two courses for any given each visa type. FLC is approved by the Immigration and semester. 1DWXUDOL]DWLRQ6HUYLFH ,16 WRLVVXHWKH,IRUWKH)YLVD Admission Procedures Application An international student must be enrolled in at least 12 An applicant may apply for admission to the college by XQLWVDQGPXVWPDLQWDLQD& JUDGHSRLQWDYHUDJHDW one of the following methods: DOOWLPHVLQRUGHUWREHFHUWLÀHGDVDIXOOWLPHVWXGHQWZLWK &RPSOHWLQJDQDSSOLFDWLRQRQOLQHDWZZZÁFORVULRVHGX WKH,16)RUIHHLQIRUPDWLRQFRQWDFWWKH$GPLVVLRQV2IÀFH Submitting a completed application to the Admissions 5HTXLUHPHQWVIRU,,VVXDQFH 5HFRUGVRIÀFHRQWKHPDLQFDPSXVLQ)ROVRPWKH(O 1. (YLGHQFHRI(QJOLVK3URÀFLHQF\ Dorado Center or the Rancho Cordova Center; 2IÀFLDO72()/WHVWUHVXOWRIPLQLPXP ZULWWHQ Mailing a completed application to Folsom Lake FRPSXWHU EDVHG RU PLQLPXP ,QWHUQHW College, Admissions & Records, 10 College Parkway, EDVHG 7KH)/&72()/VFKRROFRGHLV8685; Folsom, CA 95630. ,(/76WHVWUHVXOWRIPLQLPXP Residency Requirements for Admission MATRICULATION ,QGHWHUPLQLQJWXLWLRQHQUROOPHQWIHHVVWXGHQWVIDOOXQGHU Students who enroll in credit courses are entitled to services the following two categories: GHVLJQHGWRKHOSWKHPVXFFHHG´0DWULFXODWLRQµLVWKHRIÀFLDO 5(6,'(176 name of the process that brings the college and the student Those who have resided in California for at least one year into an agreement for the purpose of realizing the student’s DQGDGD\SULRUWRWKHÀUVWGD\RIDQHZVHPHVWHU6WDWHODZ educational objectives. requires that students give evidence of both their physical presence in California for one year and their intent to make For the college, the agreement includes providing an California their home state for other than a temporary admission process; orientation to college, student services, SHULRG SXUVXDQWWR(GXFDWLRQ&RGHVHFWLRQ SUHHQUROOPHQWDVVHVVPHQWFRXQVHOLQJDQGDGYLVHPHQWIRU DQG /RV 5LRV %RDUG 3ROLF\ 1RQFLWL]HQV ZKR PHW FRXUVHVHOHFWLRQ DFXUULFXOXPRUSURJUDPRIFRXUVHV IROORZ residency requirements must provide documentation from up on student progress with referral to support services WKH,16 when needed; and a program of institutional research and evaluation. 1215(6,'(176 2872)67$7($1',17(51$7,21$/ 678'(176 )RU WKH VWXGHQW WKH DJUHHPHQW LQFOXGHV LGHQWLÀFDWLRQ RI Those students who do not meet the California residency DQHGXFDWLRQDOLQWHQWDQGZLOOLQJQHVVWRGHFODUHDVSHFLÀF UHTXLUHPHQWV DV RXWOLQHG DERYH DUH FODVVLÀHG DV QRQ educational objective within a reasonable period of UHVLGHQWV DQG UHTXLUHG WR SD\ HLWKHU QRQUHVLGHQW RU HQUROOPHQW,QDGGLWLRQVWXGHQWVZLOOH[HUFLVHGLOLJHQFHLQ international student tuition. Refer to the Fees section of class attendance, completion of assigned course work, and this catalog. maintain progress toward an educational goal according 6WXGHQWVPD\DSSO\IRUUHFODVVLÀFDWLRQWR&DOLIRUQLDUHVLGHQW to standards established by the College and the State of E\FRPSOHWLQJDUHFODVVLÀFDWLRQDSSOLFDWLRQDQGSURYLGLQJ California. Students are encouraged to participate in all VXIÀFLHQW GRFXPHQWDWLRQ WR VXSSRUW &DOLIRUQLD UHVLGHQF\ aspects of the matriculation process although they may be State requirements to become a California resident are H[HPSWRUFKDOOHQJHSDUWRUDOORIWKHSURFHVVZLWKFDXVH GHVFULEHGLQWKH&DOLIRUQLD(GXFDWLRQ&RGHDQG&DOLIRUQLD &RGHRI5HJXODWLRQV 7LWOH How does the Matriculation process work? 8QGHU&DOLIRUQLDODZWREHUHFODVVLÀHGIURPDQRQUHVLGHQW The matriculation process includes the following procedures to a California resident, a student must clearly demonstrate: designed to help students achieve their educational Physical presence in California objectives: Intent to reside in California permanently, and 1. Admission )LQDQFLDOLQGHSHQGHQFHLIWKHVWXGHQWZDVFODVVLÀHGDV Admissions materials are available and must be completed DQRQUHVLGHQWLQDSUHFHGLQJWHUP by all students for enrollment into the college. All new and Please see the Admissions & Records Office for the ÀUVWWLPHVWXGHQWVDUHGLUHFWHGWRPDWULFXODWLRQVHUYLFHVDV UHFODVVLÀFDWLRQDSSOLFDWLRQDQGLQVWUXFWLRQV QHHGHG1HZÀUVWWLPHQRQH[HPSWVWXGHQWVZKRFRPSOHWH the matriculation process are given priority registration $&DOLIRUQLD1RQUHVLGHQW7XLWLRQ([HPSWLRQPD\EHJUDQWHG which allows them to register immediately after continuing WRFHUWDLQQRQUHVLGHQWVWXGHQWVZKRPHHWWKHH[HPSWLRQ students. UHTXLUHPHQWV VHW IRUWK LQ $VVHPEO\ %LOO $% 2. Assessment including undocumented aliens. Contact the Admissions & $OOQHZ WR'LVWULFWFROOHJHDQGRU)/& DQGQRQH[HPSW 5HFRUGVRIÀFHDW IRUIXUWKHULQIRUPDWLRQ students are strongly encouraged to complete the basic skills All questions concerning residence status should be referred DVVHVVPHQWWHVWLQ(QJOLVKRU(6/UHDGLQJDQGPDWKHPDWLFV WRWKH$GPLVVLRQV 5HFRUGVRIÀFH These tests will assist the counselor and the student to Readmission from Dismissed Status determine the appropriate skill level of the student when Students on dismissed status from Folsom Lake College must developing an educational plan. Test dates and times are submit a “Petition for Readmission after Dismissed Status” available online at ZZZÁFORVULRVHGX JRWRWKH$VVHVVPHQW form, which is done with a counselor. In order to enroll in TXLFNOLQN RULQWKH$GPLVVLRQV 5HFRUGVRIÀFH FODVVHVWKH'HDQRI6WXGHQW'HYHORSPHQWDQG(QUROOPHQW 3. Orientation Management must approve readmission after counselor Orientation services are available to all students and highly recommendation. UHFRPPHQGHGIRUÀUVWWLPHVWXGHQWV)XOORULHQWDWLRQVHVVLRQV are provided throughout the fall and spring semesters prior 10 Folsom Lake College 2011-2012 to the beginning of registration. Online orientations are also 7KHFRXUVH V PXVWKDYHEHHQFRPSOHWHGZLWKDJUDGH DYDLODEOHDWZZZÁFORVULRVHGX RI´'µRUKLJKHU$OOWUDQVIHUUHGJUDGHV LQFOXGLQJ´)µV 4. Counseling Services will be used in the calculation of units attempted, units All matriculated students should meet with a counselor for completed, and the grade point average. the purpose of developing a student education plan. Recent )RUGHWHUPLQDWLRQRIFRXUVHDSSOLFDELOLW\HTXLYDOHQF\ high school students are also encouraged to bring a copy student must meet with a counselor. of their high school transcripts and assessment results with Students who have completed college or university level WKHPWRWKHLUÀUVWFRXQVHOLQJVHVVLRQ FRXUVHVRXWVLGHWKH8QLWHG6WDWHVDQGDUHUHTXHVWLQJFUHGLW )ROORZXS must have those transcripts evaluated by a Foreign Credit Students are encouraged to see their counselor regularly (YDOXDWLRQ6HUYLFHV$OLVWRIWKHVH(YDOXDWLRQ6HUYLFHVFDQ and to participate in activities and programs designed to be found at www.naces.org. Once received in the Admissions support student success. 5HFRUGVRIÀFHWKHHYDOXDWLRQEHFRPHVSURSHUW\RIWKH Exemption Criteria FROOHJHDQGLVWUHDWHGLQWKHVDPHPDQQHUDVDQRIÀFLDO 6WXGHQWVFDQHOHFWWRQRWSDUWLFLSDWHRUEHH[HPSWIURP WUDQVFULSW VHHEHORZ most or parts of the matriculation requirements based on the following criteria: $ VWXGHQW·V RIÀFLDO WUDQVFULSW IURP DQRWKHU FROOHJH RU Student has completed an associate degree or higher. university or from a high school becomes the property of 6WXGHQWVDWLVÀHVDWOHDVWWZRRIWKHIROORZLQJ FLC and cannot be distributed to a third party, including the LGHQWLÀHGDJRDORIXSJUDGLQJMREVNLOOV student, without a court order, in accordance with District HQUROOHGIRUIHZHUWKDQXQLWV policy 2215. Students desiring such transcripts must request FRQFXUUHQWO\HQUROOHGLQDQRWKHU them directly from the issuing institution. postsecondary institution GHFODUHGQRGHJUHHRURFFXSDWLRQDOREMHFWLYH REGISTRATION Students who wish to challenge any part or all of the Students may register for classes using the following PDWULFXODWLRQSURFHVV RULHQWDWLRQDVVHVVPHQWRUFRXQVHOLQJ methods: must meet with the matriculation coordinator or designated Online using eServices at ZZZÁFORVULRVHGX; or representative to discuss the reason and rationale for the ,QSHUVRQDWWKH$GPLVVLRQV 5HFRUGVRIÀFHV challenge, or provide information to the matriculation For detailed information on registration procedures refer coordinator supporting the challenge. to the college website at ZZZÁFORVULRVHGX. In addition, students wishing to challenge specific Class Schedule matriculation services will be informed of their rights to Before registration begins for a given semester, the Class SDUWLFLSDWHLQDOORWKHUQRQGLVSXWHGFRPSRQHQWVDQGZLOO Schedule is published online indicating courses to be offered be asked to sign a statement waiving their right to the ²ZLWKGDWHWLPHLQVWUXFWRUDQGURRPDVVLJQPHQWLQIRUPDWLRQ matriculation services, thus providing acknowledgment to Important instructions and information regarding admissions the college of receipt of the information above. and registration are also available online. Transcripts from Other Colleges Registration Policies – Open Enrollment Students enrolled at Folsom Lake College who desire In accordance with District policy, all classes are open to academic credit for courses taken at other regionally enrollment and participation by any person who meets the DFFUHGLWHG FROOHJHVXQLYHUVLWLHV PXVW VXEPLW RIILFLDO academic prerequisites of the class and who is otherwise WUDQVFULSWVRIWKDWZRUNWRWKH$GPLVVLRQV 5HFRUGVRIÀFH eligible for admission to Folsom Lake College. It is the student’s responsibility to initiate a request to each LQVWLWXWLRQDVNLQJWKDWDQRIÀFLDOWUDQVFULSWRIKLVKHUZRUN Enrollment Limits EHVHQWGLUHFWO\WRWKH$GPLVVLRQV 5HFRUGVRIÀFHDW)ROVRP Students are cautioned that some classes and programs may Lake College. Once these records are received the records prove to be so popular or so limited by physical facilities shall be available to all other colleges within the District. DQGRUDYDLODELOLW\RITXDOLÀHGLQVWUXFWRUVWKDWDOOVWXGHQWV who apply cannot be accommodated. To be credited by Folsom Lake College, the course work must meet the following criteria: Withdrawing from Classes 7KH FRXUVH V PXVW KDYH EHHQ WDNHQ DW D UHJLRQDOO\ Students are responsible for officially dropping or DFFUHGLWHGFROOHJHXQLYHUVLW\ withdrawing from classes by the deadline dates listed in 7KHFRXUVH V PXVWEHXQGHUJUDGXDWHOHYHO Folsom Lake College 2011-2012 11 Registration Steps for Students If you are a... then... Continuing Student WKLVPHDQV\RXZHUHUHJLVWHUHG (YHU\ VHPHVWHU FRQWLQXLQJ VWXGHQWV PXVW VXEPLW D at one of the Los Rios Community College District supplemental enrollment form in order to register for campuses during the most recent regular academic classes. This is done online at eServices. VHPHVWHU First-time Student ÀUVWWLPHWRFROOHJHHYHQWKRXJK 7R TXDOLI\ IRU 3ULRULW\ UHJLVWUDWLRQ DOO )LUVWWLPH you may have taken college classes while in high Students must complete the following: VFKRRO D Complete an online application for admission. E 7DNHWKHDSSURSULDWHDVVHVVPHQWWHVW7HVW schedules are available online. F $WWHQG2ULHQWDWLRQ &RXQVHOLQJVHVVLRQ G $IWHU\RXKDYHFRPSOHWHGDEDQGF\RXFDQ register for classes during your registration appointment. New Transfer Student QHYHUDWWHQGHGD/RV5LRV )RU3ULRULW\RURSHQUHJLVWUDWLRQ1HZ7UDQVIHU FROOHJHEHIRUH and Returning Students need to: Returning Student DWWHQGHG D /RV 5LRV FROOHJH D Complete an online application. EHIRUHDQGUHWXUQLQJDIWHUDQDEVHQFH E 6XEPLWRIÀFLDOWUDQVFULSWVRIDOOFROOHJHZRUNWR WKH$GPLVVLRQV 5HFRUGVRIÀFH F $IWHUFRPSOHWLQJDDQGEUHJLVWHUIRUFODVVHV Veteran and/or Dependent All recipients must Two months prior to the term of attendance, complete FRQÀUPWKHLUFODVVHVZLWKWKH$GPLVVLRQV 5HFRUGV an online application and contact the Admissions & RIÀFHDIWHUFRPSOHWLRQRIUHJLVWUDWLRQ$OOPDWHULDO VXEPLWWHG WR WKH 9HWHUDQV $GPLQLVWUDWLRQ WDNHV 5HFRUGVRIÀFH DSSUR[LPDWHO\ WZR PRQWKV IRU SURFHVVLQJ WKURXJK WKH 9HWHUDQV $GPLQLVWUDWLRQ 5HJLRQDO 2IILFH LQ Muskogee, Oklahoma. After enrolling at FLC, a veteran may apply for evaluation of military service H[SHULHQFHIRUFROOHJHFUHGLW$FRS\RIWKHYHWHUDQ·V ''VHSDUDWLRQSDSHU0867EHVXEPLWWHGWRWKH $GPLVVLRQV 5HFRUGVRIÀFH)RUPRUHLQIRUPDWLRQ veterans or dependents should contact the FLC $GPLVVLRQV 5HFRUGVRIÀFHDW International Student 6L[PRQWKVSULRUWRWKHWHUPRIDWWHQGDQFHFRPSOHWH an online application and contact the Admissions & 5HFRUGVRIÀFHFor more details, see the International Student Admissions section. High School Student FRQFXUUHQWO\ HQUROOHG LQ To qualify for Priority 4 or open registration: KLJKVFKRRO 6HH\RXUKLJKVFKRROFRXQVHORUIRUDQ 1. Complete an online application. $GYDQFHG (GXFDWLRQ $SSOLFDWLRQ RU FRQWDFW WKH 2EWDLQDQ$GYDQFHG(GXFDWLRQ$SSOLFDWLRQWKURXJK $GPLVVLRQV 5HFRUGVRIÀFH high school and obtain appropriate approvals. 6XEPLW$GYDQFHG(GXFDWLRQ$SSOLFDWLRQDORQJZLWK copy of most recent high school transcript for college counselor approval. 4. Register for classes in person only. 12 Folsom Lake College 2011-2012 the current academic calendar. There is not an automatic process for either of these transactions. Students may drop a class prior to the established deadline using eServices or in person at any of the Admissions and 5HFRUGVRIÀFHVDW)/&PDLQ('&RU5&&FDPSXVHV$OO drops made by the established deadline will not appear on the student’s academic transcript. Please refer to the online Academic Calendar for information on drop deadlines. ,IDVWXGHQWZLWKGUDZVIURPFODVVDIWHUWKHGURS QRQRWDWLRQ GHDGOLQH DQG EHIRUH WKH ZLWKGUDZDO ´:µ GHDGOLQH D “W” will appear on their transcript. A “W” notation will not affect the student’s grade point average; however, H[FHVVLYH´:µQRWDWLRQVPD\DIIHFW SURJUHVVVWDWXV VWDWXVDVDIXOOWLPHVWXGHQW HOLJLELOLW\IRUÀQDQFLDODLG DQGRWKHUEHQHÀWVRU DWKOHWLFHOLJLELOLW\5HIHUWRWKH online academic calendar for important deadline dates for each term. Prerequisites and Corequisites Many courses have enrollment conditions such as prerequisites and corequisites that must be met prior to enrolling in the course. It is the student’s responsibility to meet any and all enrollment conditions; students have the option of challenging the prerequisite requirement. Students who do not meet these conditions may be dropped by the instructor. Folsom Lake College 2011-2012 13 Fees Schedule of Fees Universal Transit Pass Fee/Student Access Card: Students $W WKH WLPH RI WKLV FDWDORJ·V SXEOLFDWLRQ WKH DSSURYHG D 8QLYHUVDO 7UDQVLW 3DVV IHH ZKLFK DOORZV IROORZLQJIHHVDUHLQHIIHFW all fee amounts are subject to students to use all public transit bus and light rail systems change): LQ6DFUDPHQWR 6800(56(66,21 Payment Methods $XWR 6WXGHQWVKDYHWKHRSWLRQRISD\LQJIHHVE\ FUHGLWFDUG 0RWRUF\FOH DWWKHWLPHRIRQOLQHUHJLVWUDWLRQ PDLOZLWKFKHFNRU 'DLO\SDUNLQJSHUPLW FUHGLWFDUGLQIRUPDWLRQ RU SD\PHQWLQSHUVRQDW)/& The daily parking ticket will be available for automobiles $GPLVVLRQV 5HFRUGVRIÀFHWKH(O'RUDGR&HQWHURUWKH not recommended for motorcycles. Rancho Cordova Center. Students who may be eligible IRUÀQDQFLDODLGDQGRUDQHQUROOPHQWIHHZDLYHUVKRXOG 9HKLFOHVQRWKDYLQJDYDOLGSDUNLQJGHFDORUGDLO\SDUNLQJSHUPLW FRQWDFWWKH)LQDQFLDO$LGRIÀFHRQWKHPDLQFDPSXVSULRU SURSHUO\GLVSOD\HGZLOOEHLVVXHGDSDUNLQJFLWDWLRQ /5&&' to registration. 5 ,IDSDUNLQJGHFDOLVORVWRUVWROHQDQHZGHFDO must be purchased at full price. If a vehicle is sold or Maintenance Allowance GDPDJHG LHZLQGVKLHOGUHSODFHG GXULQJWKHHIIHFWLYH A California resident who resides more than 60 miles from WHUPRIWKHGHFDODUHSODFHPHQWFDQEHLVVXHGIRU WKHQHDUHVWSXEOLFFRPPXQLW\FROOHJHFDPSXVPD\ÀOHDQ if the proof of sale or repair of vehicle and the old decal application for a maintenance allowance in Admissions & GHFDOQXPEHULQWDFW DUHVXEPLWWHGWRWKH$GPLVVLRQV Records. The rate of payment is determined by the State 5HFRUGVRIÀFH &KDQFHOORU·V2IÀFHDQGLVLVVXHGWRWKHSDUHQWRUJXDUGLDQ )RUDGGLWLRQDOSDUNLQJWUDIÀFLQIRUPDWLRQSOHDVHVHHWKH RU PLQRU QRQGLVWULFW VWXGHQWV DQG GLUHFWO\ WR DGXOW QRQ Safety and Security section. district students. Fee Refunds Debts Owed to the College It is the responsibility of the student to apply for a fee Should a student or former student fail to pay a debt owed refund. To be eligible for processing, the student must: to the institution, the institution may withhold permission 'URSFODVV HV XVLQJH6HUYLFHVDWZZZÁFORVULRVHGX to register, to use facilities for which a fee is authorized RULQSHUVRQDW$GPLVVLRQ 5HFRUGV2IÀFHE\WKH to be charged, to receive services, materials, food, or VHFRQG)ULGD\IRU)XOO6HPHVWHUFODVVHVDQGWKHÀUVW merchandise, or any combination of the above from any )ULGD\RIDOOVKRUWWHUPFODVVHVLHZHHNZHHN SHUVRQRZLQJDGHEWXQWLOWKHGHEWLVSDLG VHH6HFWLRQV summer session, etc. Refund eligibility is determined 42380 and 42381 of the Title 5, California Code of E\WKHGDWHWKHFRXUVHLVRIÀFLDOO\GURSSHG 5HJXODWLRQV ,IDVWXGHQWEHOLHYHVKHVKHGRHVQRWRZHDOO Submit a request for refund by the last day of or part of an unpaid obligation, the student should contact instruction in the semester or summer session for which WKH%XVLQHVV6HUYLFHVRIÀFH the fee was paid. If a refund request is not submitted, credit balances will be forfeited and do not carry Federal Education Tax Credits RYHUWRWKHQH[WVHPHVWHURUWHUP Hope Credit and /LIHWLPH/HDUQLQJ&UHGLW Online Fee Refund Application form is available Students or parents of dependent students and independent RQ WKH /RV 5LRV ZHEVLWH ZZZORVULRVHGX )HHV VWXGHQWV PD\ EH DEOH WR REWDLQ IHGHUDO WD[ FUHGLWV IRU 3D\PHQWOLQNRQKRPHSDJH $SSOLFDWLRQVIRUPVDUH enrollment fees if enrolled in at least 6 units during any DOVRDYDLODEOHDWWKH$GPLVVLRQV 5HFRUGVRIÀFH semester or summer session, and meet the other conditions )RU DOO VHPHVWHUOHQJWK FRXUVHV HQUROOPHQW WXLWLRQ DQG prescribed by federal law. The District Office will international capital outlay fees are 100% refundable automatically mail an IRS form 1098 to each student so the WKURXJK WKH VHFRQG )ULGD\ RI WKH VHPHVWHU 6KRUWWHUP VWXGHQWFDQFODLPDQ\FUHGLWVRQWKHLUIHGHUDOWD[UHWXUQ FRXUVHVDUHUHIXQGDEOHWKURXJKWKHÀUVW)ULGD\RI the term. Prorated refunds are not available under current If the 1098 form should be sent to the parent instead, legislative law. Application and installment payment plan SOHDVH FRQWDFW WKH FROOHJH $GPLVVLRQV 5HFRUGV RIÀFH fees are not refundable. for the appropriate forms in which to make this change. If choosing this option, provide the parent’s full name, social Parking Fees are 100% refundable only through the second security number, and mailing address. This change must be )ULGD\RIWKHIDOORUVSULQJVHPHVWHUDQGWKHÀUVW)ULGD\RI PDGHSULRUWR'HFHPEHU7KH'LVWULFW2IÀFHZLOOWKHQ the term for the summer session. To be eligible for a refund, send 1098 forms to the parent for all future years, unless the parking decal must be attached to the refund request directed otherwise by the student no later than December IRUPDQGVXEPLWWHGWRWKH$GPLVVLRQV 5HFRUGVRIÀFHE\ 31 of any given year. More information on the Hope Credit the refund deadlines. or Lifetime Learning Credit is available by obtaining a copy of IRS Publication 970 or the IRS website: www.irs.gov Folsom Lake College 2011-2012 15 Student Access Card The Student Access card is your: GoPrint Card 2IÀFLDO&ROOHJH3KRWR,'&DUG Academic Honors the instructor, to process a class drop either online using The distinction of Honors and Highest Honors is noted on eServices at ZZZÁFORVULRVHGX RU LQ SHUVRQ ([FHVVLYH a student’s transcript for each semester in which a student DEVHQFHLVGHÀQHGDVH[FHHGLQJVL[SHUFHQW RIWKH has enrolled in 12 units or more, and has earned a grade total hours of class time. For attendance purposes, the SRLQW DYHUDJH *3$ RI DW OHDVW +RQRUV RU RU college regards a laboratory session as the equivalent KLJKHU +LJKHVW+RQRUV 6WXGHQWVHDUQLQJ+LJKHVW+RQRUV of one class meeting. Instructors shall state in each course ZLOOEHQRWLÀHGE\PDLORUHPDLORIWKHLUHOLJLELOLW\WRMRLQ V\OODEXVZKDWFRQVWLWXWHVH[FHVVLYHDEVHQFHIRUWKDWFRXUVH the college honor society, Phi Theta Kappa. Los Rios Board policy allows for instructors to drop students Academic Renewal without ZKRIDLOWRDWWHQGWKHÀUVWFODVVVHVVLRQVRIDFRXUVH Course Repetition Students may appeal for reinstatement in a class from which A student may petition to have previous substandard work WKH\KDYHEHHQH[FOXGHGEHFDXVHRIH[FHVVLYHDEVHQFHV '·VDQG)·V HDUQHGDW)ROVRP/DNH&ROOHJHGLVFRXQWHG by contacting their instructor. &RXUVHV DQG JUDGHV ZKLFK QR ORQJHU UHÁHFW D VWXGHQW·V current educational objective and current level of Auditing Courses academic success may upon petition be discounted in the The District and Folsom Lake College do not permit auditing FRPSXWDWLRQRIWKHJUDGHSRLQWDYHUDJH 7LWOHVHFWLRQ RIFODVVHVZKLFKLVGHÀQHGDVDWWHQGLQJDFRXUVHRUFRXUVHV 7KHIROORZLQJFRQGLWLRQVPXVWDSSO\ without having enrolled and without responsibility for A minimum of 12 consecutive months shall have elapsed completing assignments and without receiving a grade or since the end of the semester or summer session credit. in which the work to be alleviated was recorded; Catalog Rights DQG D PLQLPXP RI WZHOYH VHPHVWHU XQLWV RU LWV HTXLYDOHQW ZLWKDJUDGHRI&RU3DVV&UHGLWRUEHWWHU For purposes of graduation from any of the colleges of the shall have been attained. The coursework must have Los Rios district, students who remain in attendance in one been completed at a regionally accredited college. UHJXODUVHVVLRQ TXDUWHUVHPHVWHURUVXPPHUVHVVLRQ DW any California community college, or any combination of Current educational objectives must be discussed with California community colleges, campuses of the California a counselor and the counselor’s recommendation must 6WDWH 8QLYHUVLW\ WKH 8QLYHUVLW\ RI &DOLIRUQLD RU DQ\ be included on the petition. accredited institution of higher education, may elect to meet 1RPRUHWKDQXQLWVRIVXEVWDQGDUGJUDGHVPD\EH the requirements in effect at the Los Rios college from which discounted. the student intends to graduate, in one of three ways: 8QGHUQRFLUFXPVWDQFHVPD\FRXUVHZRUNEHGLVFRXQWHG LILWZDVXVHGWRIXOÀOOUHTXLUHPHQWVIRUDGHJUHHRU 1. Requirements in effect at the time of admission to a FHUWLÀFDWHWKDWKDVEHHQDZDUGHG Los Rios college, or 2. Requirements in effect at the time the student originally All grades remain on the permanent record and enrolled in an accredited college or university, or transcript of grades. However, a proper notation on 3. Requirements in effect at the intended date of WKH WUDQVFULSW ZLOO LQGLFDWH WKH VSHFLÀF JUDGHV WKDW were discounted from the grade point average. graduation from a Los Rios college. Academic Renewal is not intended for courses that are Please note: UHTXLUHGDQGRUZLOOEHUHSHDWHG A college may authorize or request substitution for discontinued courses. Questions regarding this policy should be directed to 6WXGHQWVFKDQJLQJWKHLUPDMRUÀHOGRIVWXG\PD\EH WKH$GPLVVLRQV 5HFRUGVRU&RXQVHOLQJRIÀFHV required to complete those requirements for the major Academic renewal petitions are available through the in effect at the point of change. &RXQVHOLQJ2IÀFH For purposes of this section, “attendance” means taking FODVVHVLQDWOHDVWRQHVHVVLRQ LHTXDUWHUVHPHVWHURU Attendance VXPPHUVHVVLRQ LQHDFKFDOHQGDU\HDU$EVHQFHIRU 6WXGHQWVDUHH[SHFWHGWRDWWHQGDOOVHVVLRQVRIWKHFODVV attendance at another accredited institution shall not in which they are registered. If, however, absence is EHFRQVLGHUHGDQLQWHUUXSWLRQLQDWWHQGDQFH %RDUG H[FHVVLYHVWXGHQWVPD\EHGURSSHGIURPDSDUWLFXODUFODVV 3ROLF\3 It is nevertheless the responsibility of the student, and not Folsom Lake College 2011-2012 17 Change of Address/Name DUHUHSHDWDEOHXSWRDPD[LPXPRIWKUHHWLPHVEH\RQG Students must report a change of address immediately to WKHÀUVWHQUROOPHQWRQWKHEDVLVWKDWWKHFRXUVHFRQWHQW WKH$GPLVVLRQV 5HFRUGVRIÀFHXVLQJD&KDQJHRI6WXGHQW differs each time it is offered. 'DWD IRUP RU VXEPLW WKH FKDQJH RQOLQH YLD H6HUYLFHV 7KH FROOHJH VKDOO LGHQWLI\ DFWLYLW\ FRXUVHV LQFOXGLQJ at www.losrios.edu )ROVRP /DNH &ROOHJH FDQQRW EH but not limited to, physical education and visual or responsible for misdirected mail if the address change is SHUIRUPLQJDUWVFRXUVHVLQPXVLFÀQHDUWVWKHDWHURU not provided by the student. GDQFH WKDWDUHUHSHDWDEOHXSWRDPD[LPXPRIWKUHH WLPHV EH\RQG WKH ÀUVW HQUROOPHQW RQ WKH EDVLV WKDW Requests to have a student’s name changed are submitted WKH VWXGHQW ZKR UHSHDWV LW LV JDLQLQJ DQ H[SDQGHG GLUHFWO\WRWKH$GPLVVLRQV 5HFRUGVRIÀFH,QRUGHUIRUWKLV HGXFDWLRQDOH[SHULHQFHIRURQHRIWKHIROORZLQJUHDVRQV W\SHRIUHTXHVWWREHSURFHVVHGGRFXPHQWDWLRQ VXFKDV 1. 6NLOOVRUSURÀFLHQFLHVDUHHQKDQFHGE\VXSHUYLVHG PDUULDJHOLFHQVHFRXUWGRFXPHQWVRUQDWXUDOL]DWLRQSDSHUV repetition and practice within class periods; or is required in order to verify a legal name change. 2. $FWLYHSDUWLFLSDWRU\H[SHULHQFHLQLQGLYLGXDORU group assignments is the basic means by which Students can submit birth date and social security number learning objectives are obtained. FRUUHFWLRQVWRWKH$GPLVVLRQV 5HFRUGVRIÀFHDORQJZLWK A student may petition to repeat a class in which a standard SURSHU GRFXPHQWDWLRQ RIÀFLDO ELUWK FHUWLÀFDWHV VRFLDO grade has been received based upon the claim that the VHFXULW\YHULÀFDWLRQHWF &RQWDFWWKH$GPLVVLRQV 5HFRUGV student’s previous grade is, at least in part, the result of RIÀFHIRUDGGLWLRQDOLQIRUPDWLRQ H[WHQXDWLQJFLUFXPVWDQFHV([WHQXDWLQJFLUFXPVWDQFHVDUH GHÀQHG DV YHULÀHG FDVHV RI DFFLGHQWV LOOQHVV RU RWKHU Course Repetition circumstances beyond the control of the student. Course repetition occurs when a student who has previously When course repetition occurs, the student’s permanent UHFHLYHGDJUDGHLQDSDUWLFXODUFRXUVHUHHQUROOVLQWKDW academic record shall be annotated in such a manner that course. Repetition of courses taken at accredited colleges all work remains legible, insuring a true and complete ZLOOQRWEHDOORZHGH[FHSWIRUWKHIROORZLQJVSHFLÀHGFDVHV academic history. Repetition of courses where substandard grade has been &RXUVH7LPH&RQÁLFW&RXUVH2YHUODS recorded 7LWOHVHFWLRQ %RDUGUHJXODWLRQ ² Students may not enroll in two classes that meet during part ´6XEVWDQGDUGJUDGHµLVGHÀQHGDV')13RU1&:KHUH RIWKHVDPHKRXUH[FHSWWKURXJKDSHWLWLRQSURFHVV6WXGHQW a student has received a substandard grade, a student may PXVWVWDWHWKHLUMXVWLÀFDWLRQIRUHQUROOLQJLQWKHRYHUODSSLQJ UHSHDWWKDWFRXUVHXSWRDPD[LPXPRIWZRWLPHVLQDQHIIRUW class, and instructors must indicate how the missed time will WRDOOHYLDWHWKHVXEVWDQGDUGJUDGH V 7KHJUDGHRUFUHGLWV EHPDGHXS DVSHU7LWOHVHFWLRQ HDUQHGLQWKHÀQDOHQUROOPHQWVKDOOEHXVHGH[FOXVLYHO\LQ determining the grade points earned for that particular Dismissal course. $FDGHPLF 'LVPLVVDO A student on Academic Dismissal is Repetition absent substandard grades 7LWOH VHFWLRQ subject to dismissal when the student earns a cumulative %RDUGUHJXODWLRQ ² grade point average of less than 2.0 in all units attempted in each of three consecutive semesters. Typically, a student cannot repeat a course in which they UHFHLYHGDVWDQGDUGJUDGH DVGHÀQHGE\$%&&5RU 3URJUHVV'LVPLVVDO A student on Progress Dismissal is subject 3 7KHUHDUHWKHIROORZLQJH[FHSWLRQV to dismissal if one half or more of the units in which the student has been enrolled have recorded entries of “W”, Students may repeat a course where repetition is ´,µ´1&µDQG´13µLQDWOHDVWWKUHHFRQVHFXWLYHVHPHVWHUV required for a student to meet legally mandated training requirements as a condition of continued paid Appeal Option:3HU/RV5LRV%RDUGSROLF\5VWXGHQWV or volunteer employment. These repetitions are not ZKRDUHGLVPLVVHGZLOOEHQRWLÀHGRIWKHLUVWDWXVLQZULWLQJ limited. WKURXJKWUDQVFULSWQRWDWLRQDQGOHWWHU DQGPXVWPHHWZLWK The student may also petition to repeat with a DFRXQVHORUWRSHWLWLRQIRUUHDGPLW LQFOXGLQJGHYHORSPHQW counselor when there is a properly established recency RID6WXGHQW(GXFDWLRQDO3ODQ requirement for a course or program of the college Any changes or updates to Los Rios Board policy can be or another institution of higher education to which the obtained at: ZZZORVULRVHGXOHJDO*&SROUHJKWP student seeks to transfer. The college shall identify courses in their catalog that 18 Folsom Lake College 2011-2012 Final Examinations “P”, with units earned. The equivalent of “D” or “F” will be 7KHFROOHJHUHTXLUHVÀQDOH[DPLQDWLRQVLQDOOFRXUVHV7KH UHFRUGHGDV´13µZLWKQRXQLWVHDUQHG8QLWVDWWHPSWHG FROOHJH SXEOLVKHV D WLPH VFKHGXOH IRU ÀQDO H[DPLQDWLRQV IRU3DVV1R3DVVJUDGHVDUHQRWFRPSXWHGLQWKHJUDGH HDUO\ LQ HDFK VHPHVWHU VR VWXGHQWV PD\ EH QRWLÀHG LQ point average, but are used for determining progress VXIÀFLHQWWLPHUHJDUGLQJWKHH[DPLQDWLRQVFKHGXOH SUREDWLRQ DQG SURJUHVV GLVPLVVDO VHH 3UREDWLRQ DQG 'LVPLVVDOLQIRUPDWLRQ Good Standing $PD[LPXPRIFUHGLWXQLWVPD\EHDSSOLHGWRZDUGWKH Both quality of performance and progress toward Associate in Arts or Science degree. completion of objectives are considered in determining a 1RWH 3OHDVHFKHFNZLWK\RXUWUDQVIHULQVWLWXWLRQWRHQVXUH student’s eligibility to attain or remain in good standing and WKDWWKH\DFFHSWFRXUVHVZLWKD´3DVVµYHUVXVDOHWWHU $ attendance at a Los Rios college. A student merits good %& JUDGH standing only by completing 12 or more semester units with D*3$RQDSRLQWJUDGLQJVFDOHDQGE\FRPSOHWLQJ 2QFHHOHFWHGWKH3DVV1R3DVVJUDGHPD\QRWEHFKDQJHG 50% or more of all enrolled units. WRDOHWWHUJUDGH ´$µ´%µ´&µ´'µ´)µ DVVLJQHGE\WKH instructor. Grades and Grade Point Averages At the end of each semester or summer session, a report Incomplete Grading (I) of academic performance is made for every course An incomplete grade, “I”, may be assigned by the instructor undertaken. The grading standards, with their grade point when, in the judgment of that instructor, the student is unable equivalents, are as follows: to complete the course requirements before the end of the VHPHVWHUGXHWRXQIRUHVHHDEOHHPHUJHQF\DQGMXVWLÀDEOH $ ²([FHOOHQW JUDGHSRLQWVSHUXQLW circumstances. To receive credit for the course, the incomplete ZRUNPXVWEHÀQLVKHGQRODWHUWKDQRQH\HDUIURPWKHHQG % ²*RRG JUDGHSRLQWVSHUXQLW RIWKHVHPHVWHULQZKLFKLWZDVDVVLJQHG$ÀQDOJUDGHZLOO C – Satisfactory 2 grade points per unit EHDVVLJQHGZKHQWKHLQFRPSOHWHZRUNKDVEHHQÀQLVKHG D – Passing, less than satisfactory 1 grade point per unit and evaluated, or when the time limit for completing the work has elapsed. A student receiving an incomplete may F – Failing 0 grade points, no 127UHHQUROOLQWKHFRXUVH$VWXGHQWPD\SHWLWLRQIRUD units earned WLPHH[WHQVLRQGXHWRH[WHQXDWLQJFLUFXPVWDQFHV P – Pass 1RWFRPSXWHGLQ*3$EXW &RUEHWWHU DIIHFWVSURJUHVV Withdrawal from Class or the College (W) probation and dismissal $VWXGHQWPD\ZLWKGUDZIURPIXOOVHPHVWHUFODVVHVZLWKRXW 13²1R3DVV a notation being placed on the permanent academic record 1RWFRPSXWHGLQ*3$EXW OHVVWKDQ& DIIHFWVSURJUHVV if the class is dropped by the student prior to the end of probation and dismissal the fourth week of classes or 30% of a course, whichever timeframe is shorter. Withdrawals will be noted on the I – Incomplete permanent academic record as “W” between the beginning 1RW FRPSXWHG LQ *3$EXW DIIHFWV SURJUHVV SUREDWLRQ RI WKH ÀIWK ZHHN RU DIWHU RI D FRXUVH ZKLFKHYHU and dismissal timeframe is shorter, and the last 25% of semester courses. W – Withdrawal 1RZLWKGUDZDOVDUHSHUPLWWHGGXULQJWKHODVWRID 1RW FRPSXWHG LQ *3$EXW DIIHFWV SURJUHVV SUREDWLRQ FRXUVH SHU/RV5LRV%RDUGSROLF\5 and dismissal 8QGHUH[WHQXDWLQJFLUFXPVWDQFHV YHULÀHGFDVHVRIDFFLGHQW MW – Military Withdrawal illness, or other circumstances beyond the control of the 1RW FRPSXWHG LQ *3$EXW DIIHFWV SURJUHVV SUREDWLRQ VWXGHQW DVWXGHQWPD\SHWLWLRQIRUZLWKGUDZDOGXULQJWKH and dismissal last 25% of a semester course. After consultation with the instructor and with administrative approval, such withdrawal Pass-No Pass Grading (P/NP) may be recorded as a “W”. Withdrawal deadlines for A student may elect one course per semester to be graded FRXUVHVRIOHVVWKDQDVHPHVWHULQOHQJWK ZHHN ZHHN RQD3DVVRUD1R3DVVEDVLV7KH3DVV1R3DVVSHWLWLRQPXVW HWF DUHVKRZQLQWKHDFDGHPLFFDOHQGDU EHÀOHGZLWKWKH$GPLVVLRQV 5HFRUGVRIÀFHIRUWKLVRSWLRQ prior to the 30% mark of the class. The equivalent of an “A”, “B” or “C” received for the course will be recorded as Folsom Lake College 2011-2012 19 A “W” is not used in calculating grade point averages, but Progress Probation: A student who has enrolled in a minimum is used for determining progress probation and progress of 12 semester units is placed on Progress Probation when dismissal. See this catalog for the progress probation and ´:µ´,µDQG´13µJUDGHVDUHUHFRUGHGLQRQHKDOIRUPRUH dismissal procedures. of all units in which a student has enrolled. Students may withdraw from classes in two different ways: Removal from Probation: A student on Academic Probation RQOLQHXVLQJH6HUYLFHVRULQSHUVRQ ZLWKVXEPLVVLRQRI$GG is removed from probation and achieves good standing 'URS5HTXHVWIRUP when the student’s cumulative grade point average is 2.0 or higher. Limitation on Withdrawals for Same Course 7KHPD[LPXPQXPEHURIWLPHVDVWXGHQWPD\ZLWKGUDZIURP A student on Progress Probation is removed from probation WKHVDPHFRXUVHDQGUHFHLYHD´:µLVIRXU $IWHUWKH DQGSODFHGLQJRRGVWDQGLQJZKHQWKH´:µ´,µDQG´1&µ fourth “W”, the student will be assigned a grade unless the units drop below one half. class is dropped before the “no notation” deadline date in WKHDFDGHPLFFDOHQGDU SHU/RV5LRV%RDUGSROLF\5 Any changes or updates to Los Rios Board policy can be obtained at: ZZZORVULRVHGXOHJDO*&SROUHJKWP Military Withdrawal: Military withdrawal occurs when a VWXGHQWZKRLVDPHPEHURIDQDFWLYHRUUHVHUYH86PLOLWDU\ Computations: service receives orders compelling withdrawal from courses. 8SRQYHULÀFDWLRQRIVXFKRUGHUVDZLWKGUDZDOV\PEROPD\ *UDGH3RLQW= 7RWDO*UDGH3RLQWV(DUQHG GLYLGHGE\ be assigned at any time during the semester. Contact the $YHUDJH 7RWDO8QLWV$WWHPSWHGZLWKOHWWHUJUDGH $GPLVVLRQV 5HFRUGVRIÀFHIRUPRUHLQIRUPDWLRQ Progress = 7RWDO8QLWVZLWK´:µ´,µDQG´1&µ GLYLGHGE\ Leave of Absence: Students may petition for a leave of 3HUFHQWDJH 7RWDO8QLWV(QUROOHG absence from the college in order to maintain catalog ULJKWVWRDVSHFLÀHGGHJUHHUHTXLUHPHQWRSWLRQ$OHDYHRI Transcripts DEVHQFHPD\EHJUDQWHGIRUDYHULÀHGPHGLFDORUPLOLWDU\ Students who desire transcripts of their academic record situation that prevents the student from attending classes in must submit a written request to the Admissions & Records any college session in a calendar year. A leave of absence RIÀFHLQGLFDWLQJWKHVWXGHQW·VQDPHXVHGZKLOHDWWHQGLQJ shall be limited to two successive calendar years. 661RU6WXGHQW,'QXPEHUDQGWKHQXPEHURIWUDQVFULSWV requested, and name and address of the designated recipient. Transcripts are provided only in response to a Honors at Graduation ZULWWHQUHTXHVWIURPWKHVWXGHQW2IÀFLDOWUDQVFULSWVZLOOEH Students who maintain a high scholarship average are mailed directly to the designated recipient. Request forms eligible for honors at graduation. Students who maintain FDQEHIRXQGRQOLQHRULQWKH$GPLVVLRQV 5HFRUGVRIÀFH a scholarship average of 3.5 or better are eligible for graduation with highest honors, and students who maintain Any coursework completed prior to Summer 2003 will be a scholarship average of 3.0 or better are eligible for UHÁHFWHGRQD&RVXPQHV5LYHU&ROOHJHRIÀFLDOWUDQVFULSW graduation with honors. All college coursework that a student Coursework completed at FLC beginning Summer 2003 will has completed is used to calculate honors at graduation. EHUHÁHFWHGRQDQ)/&RIÀFLDOWUDQVFULSW The published lists of students are compiled from the data available at the time of publication and may be subject to 7KH$GPLVVLRQV 5HFRUGVRIÀFHZLOOVHQGWKHÀUVWWZRRIÀFLDO subsequent revision. copies of a student’s Folsom Lake College transcript to any college or university without charge. Additional copies may EHREWDLQHGIRUHDFK7KHUHLVDIHHIRUDKRXU Probation UXVKUHTXHVWIRUDQRIÀFLDOWUDQVFULSW8QRIÀFLDOWUDQVFULSWV There are two types of probation: academic and progress. can be viewed and printed by accessing Los Rios eServices. Academic Probation: A student who has attempted at least 12 units is placed on Academic Probation if the student has earned a grade point average below 2.0. 20 Folsom Lake College 2011-2012 Unit Limitation Valedictorians (LJKWHHQ XQLWVSHUVHPHVWHULVDPD[LPXPORDG$Q\ It is the intention of this college to honor those students units taken within a semester at Los Rios Community College with the highest scholastic standing, and from those will be 'LVWULFWFROOHJHVZLOOEHFRXQWHGWRZDUGWKHXQLWPD[LPXP selected an individual to deliver a speech known as the ORDG$SHWLWLRQWRH[FHHGWKHPD[LPXPORDGVKRXOGEH YDOHGLFWRU\DGGUHVVWRKLVKHUIHOORZFODVVPDWHVRQEHKDOI VXEPLWWHG LQ ZULWLQJ WR WKH $GPLVVLRQV 5HFRUGV RIÀFH of them. It shall be the policy of this college to select a prior to registration. Students planning to carry more than YDOHGLFWRULDQ IRU HDFK FRPPHQFHPHQW H[HUFLVH 7REH 18 units must confer with their counselor. eligible for valedictorian, the following criteria must be met: A student is: if enrolled in: 9DOHGLFWRULDQVZLOOEHWKHVWXGHQWVZLWKWKHKLJKHVWJUDGH Freshman fewer than 30 units point average by the end of the previous fall semester. Sophomore 30 or more units *UDGHSRLQWDYHUDJH *3$ ZLOOEHFRPSXWHGE\GLYLGLQJ requirements for an Associate degree or a the total number of grade points by the units attempted Graduate higher degree by a regionally accredited within Los Rios Community College District and transferable institution have been met courses taken outside of Los Rios. The candidates must be in good standing. A student is: if enrolled in: 1RWLÀFDWLRQRIWKHYDOHGLFWRULDQ V LVPDGHE\WKHFROOHJH 3DUWWLPH IHZHUWKDQXQLWV )XOOWLPH RUPRUHXQLWV in early to mid April. All valedictorians will be noted in the Commencement program and one of the valedictorians will be selected to deliver the valedictory address through a Note: During the summer session, a student carrying six (6) SURFHVVJRYHUQHGE\WKH$VVRFLDWHG6WXGHQW*RYHUQPHQW units is considered full-time. the Commencement Committee, and upon approval of the College President or his or her designee. Unit of Credit 8QLWV RI FUHGLW DUH DVVLJQHG WR FRXUVHV EDVHG RQ WKH “Carnegie unit,’’ which assigns one unit of credit for three KRXUVRIZRUNE\WKHVWXGHQWSHUZHHN8VXDOO\WKLVPHDQV one hour of lecture or discussion led by the instructor and two hours of outside preparation by the student. In laboratory courses, three hours of work in the laboratory are normally assigned one unit of credit which may include some additional SUHSDUDWLRQ RXWVLGH RI FODVV WLPH 6WXGHQWV FDQ ÀQG WKH number of units of credit with each course description. Folsom Lake College 2011-2012 21 Alternative Credit/Study Options In addition to regularly scheduled credit classes, students &RPSDUHSDVVHGZLWKDRUKLJKHUVL[XQLWVRIFUHGLWZLOO may receive college credit for participation in the following be awarded. See the charts on the next two pages for more alternative credit and study options: information. Advanced Placement Tests College-Level Examination Program (CLEP) Folsom Lake College grants credit towards its degrees for General Examination H[DPLQDWLRQVVXFFHVVIXOO\FRPSOHWHGWKURXJKWKH&ROOHJH After completing 12 units at Folsom Lake College or its %RDUG$GYDQFHG3ODFHPHQW $3 SURJUDP$VWXGHQWZKR centers, a student in good standing may submit scores on meets the following requirements may receive credit for *HQHUDO([DPLQDWLRQVIURPWKH&ROOHJH/HYHO([DPLQDWLRQ H[DPVVXFFHVVIXOO\SDVVHG 3URJUDP &/(3 WR WKH $GPLVVLRQV 5HFRUGV RIÀFH IRU FROOHJHFUHGLWHYDOXDWLRQ$PD[LPXPRIXQLWVRIFUHGLW Be currently enrolled in a course other than the one may be granted toward completion of the general education in which the student is petitioning for Advance Credit. UHTXLUHPHQWVZLWKWKHH[FHSWLRQRIWKH(QJOLVKUHTXLUHPHQW1R %H LQ JRRG VWDQGLQJ ZKLFK LV GHÀQHG DV KDYLQJ FUHGLWLVJUDQWHGIRU&/(36XEMHFW([DPLQDWLRQV6FRUHVPXVW completed at least 12 units of credit classes and be at least in the 50th percentile. Students should be aware KDYLQJD*3$ WKDWVRPHWZR\HDUDQGIRXU\HDUFROOHJHVKDYHWKHULJKWWR These requirements may be waived by petition under special DFFHSWPRGLI\RUUHMHFWWKH&/(3XQLWV6WXGHQWVVKRXOGPHHW FLUFXPVWDQFHV$PD[LPXPRIXQLWVPD\EHHDUQHGE\ ZLWKDFRXQVHORUIRUPRUHLQIRUPDWLRQRQWKH&/(3 H[DPLQDWLRQ$3VFRUHVPD\EHUHTXHVWHGIURP(GXFDWLRQDO 7HVWLQJ6HUYLFH (76 DQG PXVW EH VHQW WR )ROVRP /DNH Cooperative Work Experience &ROOHJHWRUHFHLYHFUHGLW([DPVSDVVHGZLWKDQDFFHSWDEOH Cooperative Work Experience Education (WEXP) is an VFRUHZLOOUHFHLYHWKUHH VHPHVWHUXQLWVRIFUHGLWH[FHSW academic program in which students apply what they have where otherwise noted. The student should be aware that learned in the classroom to their job or internship site, and there is no guarantee that an individual transfer institution work toward earning college credits. There are two types will accept these scores. Students should see their counselor of programs: vocational and general. for further information on particular transfer institutions’ SROLFLHV7RUHTXHVWVFRUHVZULWH $3([DPV32%R[ Vocational Work Experience provides students with 3ULQFHWRQ1-RUFDOO opportunities to develop or add marketable skills related to their vocational study programs. &UHGLWXQLWVZLOOEHXVHGZKHQHYDOXDWLQJDQ$$RU$6 degree, but grades are not awarded. Credit may not be Eligible students must: posted to the FLC transcript for courses that duplicate WKH FUHGLW DOUHDG\ DOORZHG IRU $3 H[DPV Students %HZRUNLQJLQDSDLGRUQRQSDLGMRERULQWHUQVKLS are encouraged to meet with a counselor for more Students who do not have a job or internship and information. would like assistance should contact the Cooperative :RUN ([SHULHQFH (GXFDWLRQ 2IÀFH 6WXGHQWV PXVW &UHGLWPD\YDU\IURP\HDUWR\HDUDVUHTXLUHPHQWVDQG have a cooperating employer by the end of the third $3H[DPVFKDQJH6FRUHVRIRUOHVVDUHQRWJUDQWHGXQLWV week of the semester to remain in the program. in any of the areas. Be enrolled in a minimum of 7 units during the semester PD\LQFOXGH&223XQLWV RUTXDOLI\IRUWKH´5HWXUQLQJ 7KH IROORZLQJ (QJOLVK FUHGLW JXLGHOLQHV LQGLFDWH WKH Student” status. credit likely to be given and are subject to change: For :LWKHPSOR\HU·VDVVLVWDQFHHVWDEOLVKQHZRQWKHMRE (QJOLVKSDVVLQJWKH$GYDQFHG3ODFHPHQW/DQJXDJHDQG skills that will be documented. Composition test with a score of 4 or higher will earn the $WWHQG D RQHKRXU ZHHNO\ ZRUNIRUFH GHYHORSPHQW VWXGHQWFUHGLWIRU(QJOLVK:ULWLQJ3DVVLQJWKH/LWHUDWXUH class or qualify for the “Returning Student” status. and Composition test with a score of 4 or higher will earn the However, attendance is required for everyone for the VWXGHQWFUHGLWIRU(QJOLVK:ULWLQJZLWKWKHSURYLVRWKDW ÀUVWWKUHHRULHQWDWLRQVHVVLRQV if only the Literature and Composition is passed, credit will Register for 1, 2, 3, or 4 units. One unit of credit may QRWEHH[WHQGHGXQWLOWKHUHTXLUHPHQWVIRU(QJOLVK:ULWLQJ EHHDUQHGIRUHDFKKRXUVRISDLGZRUNH[SHULHQFH KDYHEHHQPHW,IERWKWKH/LW&RPSDQGWKH/DQJ 22 Folsom Lake College 2011-2012 Folsom Lake College 2011-2012 23 24 Folsom Lake College 2011-2012 RUIRUKRXUVRIQRQSD\H[SHULHQFH$WRWDORI +RZHYHU\RXPXVWHVWDEOLVKQHZRQWKHMREVNLOOV XQLWVPD\EHHDUQHGLQ9RFDWLRQDO:RUN([SHULHQFH with your employer and complete the necessary Students working in their college majors and taking, forms. or have taken, a course in that area should enroll in ' CO-OP has two different ways to qualify for the program: Credit by Examination New (First-time) Students: A student who meets the following requirements may take DQH[DPLQDWLRQWRHVWDEOLVKFUHGLW $ 7KHXQLWVJUDQWHGPD\QRWEHXVHGWRVDWLVI\WKHXQLW 127( 8QLWV WDNHQ LQ ,QGHSHQGHQW 6WXG\ PD\ QRW EH residency requirement for an associate degree. Any student transferable; the student should consult a counselor ZLVKLQJWRTXDOLI\IRU&UHGLWE\([DPLQDWLRQPXVWLQLWLDWHD UHJDUGLQJDVSHFLÀFFROOHJHRUXQLYHUVLW\·VDFFHSWDQFHRI request for such credit with the appropriate instructor. This WKHVHXQLWV must be done prior to the 9th week of the semester. If a &UHGLWE\([DPLQDWLRQLVDSSURYHGWKHH[DPLQLQJLQVWUXFWRU $SSOLFDWLRQ 7RDSSO\IRU,QGHSHQGHQW6WXG\DTXDOLÀHG will determine the scope and form of the test to be taken VWXGHQWÀUVWGLVFXVVHVWKHSURSRVHGVWXG\ZLWKWKHLQVWUXFWRU by the student. who will supervise the study and with the appropriate instructional dean prior to the 9th week of the semester. If &UHGLWE\([DPLQDWLRQLVQRWDWHGDVVXFKRQWKHWUDQVFULSW the instructor agrees to supervise the project, the student DQG LV JUDGHG 3DVV1R 3DVV 6WXGHQWV ZLOO EH FKDUJHG then completes a petition and course proposal form the appropriate per unit fee for units granted through the DYDLODEOHLQ$GPLVVLRQV 5HFRUGV ZLWKWKHDVVLVWDQFHRI FUHGLWE\H[DPLQDWLRQSURFHVV)HHVDUHZDLYHGIRUVWXGHQWV the supervising instructor, who will process the petition. If covered under formal articulation agreements. WKHSHWLWLRQUHFHLYHVÀQDODSSURYDOWKHVWXGHQWLVUHJLVWHUHG in the course and receives a grade as in any regularly $SSURSULDWH &UHGLW E\ ([DPLQDWLRQ IHHV PXVW EH SDLG scheduled course. ZKHQWKHSHWLWLRQIRU&UHGLWE\([DPLQDWLRQLVVXEPLWWHG For California residents, this is equivalent to the general Military Service - Credit HQUROOPHQW IHH 1RQUHVLGHQW DQG LQWHUQDWLRQDO VWXGHQWV Credit for military service is granted upon presentation must also pay the appropriate nonresident or international of papers showing honorable discharge from and active student tuition. GXW\ RI RQH \HDU RU PRUH LQ WKH 8QLWHG 6WDWHV DUPHG IRUFHV$YHWHUDQPD\UHFHLYHWKUHH XQLWVRIOLYLQJVNLOOV The college does not include this pass grade in computing JUDGXDWLRQUHTXLUHPHQWVDQGRQH XQLWRIHOHFWLYHFUHGLW the student’s grade point average. if applicable, by submitting a copy of the DD214 separation SDSHUV8QGHUUDUHFLUFXPVWDQFHVYHWHUDQVPD\DOVRUHFHLYH Please note that some 4-year colleges and universities do credit for satisfactory training completed in service school. NOT accept units granted through Credit by Examination. Students are encouraged to meet with a counselor for After enrolling at FLC, a veteran may apply for evaluation more information. RIPLOLWDU\VHUYLFHH[SHULHQFHIRUFROOHJHFUHGLW$FRS\RI WKHYHWHUDQ·V''VHSDUDWLRQSDSHU0867EHVXEPLWWHG Independent Studies DWWKH$GPLVVLRQV 5HFRUGVRIÀFHDIWHUWKHÀUVWVHPHVWHURI An Independent Study course involves an individual student attendance. Credit granted for military service is based on A or small group of students in study, research, or activities Guide to the Evaluation of Educational Experiences in the Armed beyond the scope of regularly offered courses, pursuant Services, SXEOLVKHGE\WKH$PHULFDQ&RXQFLORQ(GXFDWLRQ to an agreement among the college, faculty member, and VWXGHQW V ,QGHSHQGHQW6WXGLHVUHTXLUHUHJXODUPHHWLQJV 6WXGHQWVLQWKHVL[PRQWKUHVHUYHWUDLQLQJSURJUDPDUHQRW between student and instructor; additionally, the instructor eligible for military credit. This is in accordance with the PD\UHTXLUHH[DPLQDWLRQVRURWKHUPHDVXUHVRIHYDOXDWLRQ UHFRPPHQGDWLRQRIWKH$PHULFDQ&RXQFLORQ(GXFDWLRQ ÀHOGWULSVWHUPSDSHUVDQGRWKHUDVVLJQPHQWV Distance Education Students who are enrolled in regular catalog courses at Folsom Lake College and are in good standing may petition Online Education to enroll in an independent studies offering. Students may Folsom Lake College offers some instruction via the Internet, SHWLWLRQWRHQUROOLQRQH WRWKUHH XQLWVLQDVLQJOH including online course sections where almost all work is GHSDUWPHQWSHUVHPHVWHUZLWKDPD[LPXPRIVL[ XQLWVRI FDUULHGRXWRQOLQH ZLWKWKHSRVVLEOHH[FHSWLRQRIRQJURXQG ,QGHSHQGHQW6WXGLHVDOORZHGSHUVHPHVWHU$PD[LPXPRI RULHQWDWLRQVDQGH[DPV DQGK\EULGFRXUVHVHFWLRQVZKHUH WZHOYH XQLWVRI,QGHSHQGHQW6WXGLHVLVDOORZHGWRZDUG LQVWUXFWLRQLVGLYLGHGEHWZHHQRQOLQHDQGRQJURXQGFODVV JUDGXDWLRQUHTXLUHPHQWV6WXGHQWVFDQQRUPDOO\H[SHFWWR VHVVLRQV )DFXOW\ WHDFKLQJ RQOLQH K\EULG DQG VRPH RQ successfully accomplish only one such project per semester, JURXQGFRXUVHVRIWHQXVHZHEEDVHGOHDUQLQJPDWHULDOV DVRQH XQLWRIFUHGLWUHSUHVHQWVDSSUR[LPDWHO\KRXUV resources, assignments, and even some quizzes and tests, of work. and regularly contact students through email or other electronic means. Students enrolled in any of these courses 26 Folsom Lake College 2011-2012 can complete some or all of their online assignments in the Study Abroad Programs )/&PDLQFDPSXV3HUVRQDO/HDUQLQJ(QYLURQPHQW 3/( RU Study abroad can be an enlightening, maturing, and LQRSHQODEVDWHLWKHUWKH(O'RUDGR&HQWHU ('& RUWKH OLIHFKDQJLQJH[SHULHQFH6WXGHQWVDUHFKDOOHQJHGWRUH 5DQFKR&RUGRYD&HQWHU 5&& GXULQJUHJXODUO\VFKHGXOHG H[DPLQHWKHPVHOYHVWKHLUDWWLWXGHVDQGWKHLUVWXGLHVDVWKH\ KRXUVDVZHOODVIURPKRPHRURWKHURIIFDPSXVORFDWLRQV learn to understand new and different cultures. Full course descriptions can be found in the college catalog In cooperation with the American Institute for Foreign Study, XQGHUWKHKHDGLQJIRUWKHVSHFLÀFFRXUVHGLVFLSOLQH&ODVV the Los Rios Community College District offers unique study schedules will indicate whether a course is online or hybrid opportunities in citieV VXFK DV /RQGRQ (QJODQG 0DGULG DQGLIRQJURXQGRULHQWDWLRQVRUH[DPVDUHUHTXLUHG)RU Spain; Paris, France; and Florence, Italy. PRUH LQIRUPDWLRQ SOHDVH FKHFN WKH VSHFLÀF FODVV OLVWLQJ LQWKHRQOLQHVFKHGXOH(DFKRQOLQHRUK\EULGFODVVVHFWLRQ For more information on how to apply for Study Abroad will contain a class note with a link to the appropriate SURJUDPVFDOOWKH6WXG\$EURDG2IÀFHDW information site. Registration and rules for these courses are WKHVDPHDVWKRVHJRYHUQLQJWUDGLWLRQDORQJURXQGFRXUVHV In order to be successful in online courses, students need WREHVHOIGLUHFWHGPRWLYDWHGDQGDEOHWRLQGHSHQGHQWO\ complete and electronically submit assignments on schedule. Students will also need basic Internet skills and consistent access to a computer. Televised Instruction Folsom Lake College offers some live interactive television L79 FRXUVHVZKLFKLQFOXGHLQVWUXFWRUEURDGFDVWVIURPWKH )/&PDLQFDPSXV6WXGHQWVPD\SDUWLFLSDWHIURPFODVVURRPV DW )/&PDLQ WKH (O 'RUDGR &HQWHU ('& WKH 5DQFKR &RUGRYD &HQWHU 5&& RU DW KRPH E\ YLHZLQJ D FDEOH FKDQQHO ZKHQ DYDLODEOH LQ 6DFUDPHQWR DQG (O 'RUDGR counties. Cable students interact with the instructor during the lecture by phone, and must be on the line for the entire class meeting. The center classrooms are equipped for GLUHFWFRQWDFWZLWKWKHLQVWUXFWRU,QPRVWFDVHVH[DPVZLOO EHRIIHUHGDW)/&PDLQ('&RU5&&DOWKRXJKVRPHDUH available online. )RUPRUHLQIRUPDWLRQYLVLW ZZZÁFORVULRVHGXaLWY $OOL79FRXUVHVDUHKHOGWRWKHVDPHDFDGHPLFVWDQGDUGV that apply to traditional courses. Students must attend the ÀUVW FODVV PHHWLQJ LQSHUVRQ WR UHPDLQ UHJLVWHUHG LQ WKH FODVVDQGWRUHFHLYHWKHSKRQHORJLQQXPEHUDQGFRGH7KH ÀUVWFODVVPHHWLQJLVDOVRZKHQVWXGHQWVDUHRULHQWHGWRWKH course and receive the course syllabus and initial handouts. Full course descriptions can be found in the college catalog XQGHUWKHKHDGLQJIRUWKHVSHFLÀFFRXUVHGLVFLSOLQH Folsom Lake College 2011-2012 27 Graduation Requirements 'HJUHHDQG&HUWLÀFDWH3URJUDPV FKHFNWKHLUSURJUHVVLQIXOÀOOLQJWKHJUDGXDWLRQUHTXLUHPHQWV )ROVRP/DNH&ROOHJHRIIHUVFHUWLÀFDWHDQGGHJUHHFDUHHU They should then meet with a counselor in order to submit a curricula to students planning to enter occupations directly GHJUHHRUFHUWLÀFDWHSHWLWLRQSULRUWRWKHSRVWHGGHDGOLQH upon completing their work at a community college. The IRU WKH VHPHVWHU LQ ZKLFK WKH\ ZLVK WR JUDGXDWH VHH FROOHJHDOVRRIIHUVWZR\HDUJHQHUDOHGXFDWLRQFXUULFXODIRU FDOHQGDUDWIURQWRIWKLVFDWDORJ VWXGHQWVZKRGRQRWVHHNLQWHQVLYHWUDLQLQJIRUVSHFLÀFMREV $OORIÀFLDOWUDQVFULSWVIURPRWKHUFROOHJHVPXVWEHVXEPLWWHG but rather desire to broaden their cultural backgrounds or WRWKH$GPLVVLRQV 5HFRUGVRIÀFHEHIRUHDGHJUHHSHWLWLRQ EHFRPHPRUHHIIHFWLYHFLWL]HQVDQGRUSDUHQWV0DQ\IRXU LV VXEPLWWHG )/& ZLOO SULQW 21( GLSORPD SHU VWXGHQW year institutions will give partial or full credit for courses in VWXGHQWVZLOOVHOHFWZKLFKGHJUHHDWWLPHRISHWLWLRQ )RU these areas completed with acceptable grades; however, multiple degree earners, ALL degrees earned will be posted WKHVH FRXUVHV DUH QRW VSHFLÀFDOO\ GHVLJQHG IRU VWXGHQWV to the FLC transcript. SODQQLQJWRWUDQVIHUWRIRXU\HDULQVWLWXWLRQV Commencement Exercises 'HJUHH3URJUDPV Students planning to graduate with the $OOVWXGHQWVH[SHFWLQJWRJUDGXDWHRUWUDQVIHUWRDIRXU\HDU Associate in Arts or Science degree must comply with the FROOHJHXQLYHUVLW\ZLWKDQDVVRFLDWH·VGHJUHHPXVWPHHWZLWK JUDGXDWLRQUHTXLUHPHQWVOLVWHGLQWKLVFDWDORJ VHHWKHQH[W D&RXQVHORUDQGFRPSOHWHD3HWLWLRQIRU*UDGXDWLRQIRUP SDJH &DQGLGDWHVIRUJUDGXDWLRQPXVWÀOHDSHWLWLRQIRU by the date set forth in the academic calendar. graduation. Students may graduate at the end of the fall semester, Check the academic calendar in this catalog and online for end of the spring semester, or end of the summer session. A WKHODVWGDWHWRÀOHIRUJUDGXDWLRQ commencement ceremony is held once a year in May. Those who complete their Associate in Arts or Associate in Science &HUWLÀFDWH3URJUDPV Folsom Lake College can help students degree in summer, fall, or spring terms are encouraged to JHWWKHWUDLQLQJQHHGHGWRTXDOLI\IRUDZHOOSD\LQJMRE attend the May ceremony. with room for advancement. Career education vocational programs are offered in areas that employers need. &HUWLÀFDWHSURJUDPVKDYHEHHQGHYHORSHGWRDVVLVWWKRVH Numbering for Associates Degree already employed in business and industry or those who General Education Patterns desire to upgrade their skills or acquire specialized training. %HJLQQLQJZLWKWKH FDWDORJDOODVVRFLDWHVGHJUHH $UHDV RI YRFDWLRQDO RFFXSDWLRQDO HGXFDWLRQ LQFOXGH general education patterns within the Los Rios Community technical and industrial trades, health occupations, business College District aligned to a new numbering system. As DQGÀQDQFHHOHFWURQLFVDQGFRPSXWHUVFLHQFHVSROLFHDQG a result, the format of the general education pattern has ÀUHVFLHQFHDQGPDQ\RWKHUV)/&KDVXSWRGDWHHTXLSPHQW changed. Please use the chart below as a reference for the DQGIDFLOLWLHVDQGYRFDWLRQDOLQVWUXFWRUVZKRDUHH[SHUWVLQ pattern. If you have questions, please consult a counselor. WKHLUÀHOGV'HSHQGLQJRQWKHRFFXSDWLRQVHOHFWHGWUDLQLQJ PD\WDNHIURPVL[PRQWKVWRWZR\HDUV6WXGHQWVPD\IXUWKHU Courses in Categories for GE New categories beginning WKHLUHGXFDWLRQE\SXUVXLQJDQ$VVRFLDWHGHJUHHRUIXOÀOOLQJ Requirements before 2008-09 2008-09 XQLYHUVLW\WUDQVIHUUHTXLUHPHQWV8SRQIXOÀOOPHQWRIUHTXLUHG 1. Natural Sciences IV. Natural Sciences V.b. Social and Behavioral Sciences — courses, students can meet with a counselor to prepare a 2. Social and Behavioral Sciences 3HWLWLRQIRU&HUWLÀFDWLRQIRUP Other V.a. Social and Behavioral Sciences — 3. American Institutions Although some equivalent course work at other accredited American Institutions 4. Humanities I. Humanities LQVWLWXWLRQVPLJKWDSSO\WRZDUGD&HUWLÀFDWHRI&RPSOHWLRQ 5. a. Languages and Rationality — II.a. Languages and Rationality — a grade of “C” is required in each course leading to a English Composition English Composition FHUWLÀFDWH$PLQLPXPRIWZHOYH XQLWVPXVWEHFRPSOHWHG 5.b. Languages and Rationality — II.b. Languages and Rationality — DW)ROVRP/DNH&ROOHJHRULWVFHQWHUV&HUWLÀFDWHSURJUDPV Communications & Analytical Thinking Communications & Analytical Thinking which are scheduled for fewerWKDQWZHOYH XQLWVPD\EH 6.a. Living Skills — Physical Education III.a. Living Skills — Physical Education FRPSOHWHGE\VDWLVI\LQJWKHFHUWLÀFDWHSURJUDPUHTXLUHPHQWV 6.b. Living Skills — Other III.b. Living Skills — Other Application for Graduation 7. Ethnic/Multicultural Studies VI. Ethnic/Multicultural Studies At least one semester before the planned graduation, Requirement Requirement students should schedule an appointment with a counselor to 28 Folsom Lake College 2011-2012 Associates Degree Graduation Requirements 2011 - 2012 Folsom Lake College Associates Degree Graduation Requirements Student Name ______Student ID# ______Requirements for the Associates Degree are outlined as follows. Minimum Graduation Requirements: A. Satisfactory completion of 60 units of collegiate work with a “C” (2.0) grade point average in a curriculum that the district accepts toward the degree. At least 12 units must be earned at Folsom Lake College. B. MAJOR – Complete one of the degree programs listed in the Catalog with a minimum “C” grade in each course used for the major. C. GENERAL EDUCATION - Complete a minimum of 21 units of coursework from the pattern below. I. HUMANITIES (3 units minimum) selected from: C=completed, IP=in progress, N=needed CIPN Architecture 310; Art History 300, 303, 304, 306, 307, 309, 311, 312, 313, 314, 318, 324, 326, 328, 332, 330, 333; Art 300, 304, 307, 320, 322, 323, 330, 361, 370, 372, 390, 430; Communications Media 305*; Comm. Studies 305; Dance 380; Early Childhood Education 361; English Writing 301; English Literature 303, 310, 311, 319, 320, 321, 339, 340, 341, 345, 360, 370, 402; Film and Media Studies 320*, French 101, 102, 401, 402, 411; Humanities 300, 310, 320, 325, 332, 334, 340; Music Fund. History and Lit. 300, 310, 311, 330, 400, 401; Music Specializations 370; Philosophy 304, 310, 330, 331, 338, 350, 352, 356, 358, 360; Photography 301, 302, 425*; Sign Language 305, 306, 315; Spanish 101, 102, 401, 402, 411, 412; Theater Arts 300, 302, 303, 304, 310, 320*, 350 Course from other college: ______College Name: ______II. LANGUAGES AND RATIONALITY (6 units minimum) Select at least 3 units from (a) and at least 3 units from (b): (a) English Composition selected from: Business 310; English Writing 300; English Education 305 Course from other college: ______College Name: ______(b) Communication and Analytical Thinking selected from: Accounting 101, 301; Comm. Studies 301, 311, 315, 331, 361, 363; Computer Information Science - Core 310; Computer Information Science---Programming 350, 360, 400; English Reading 310; English Writing 302; English Creative Writing 400, 410, 420, 430; Geography 330; Journalism 300; Management 360; Mathematics 110, or higher level mathematics course; Philosophy 300, 320, 325, 328; Psychology 330, 335; Statistics 300 Course from other college: ______College Name: ______III. LIVING SKILLS (3 units minimum) selected from: (a) Any physical education activity course with a Dance, Fitness, Individual Activities, or Team Activities designation, totaling at least one unit. Students with medical excuses on file may enroll in Adapted Physical Education, or be exempt from the physical education activity course requirement. Students receiving an exemption for any reason must complete a minimum of 3 units under (b) of this section AND (b) Completion of a minimum of two units selected from the following: Business Technology 307.1; Computer Information Science – Core 300, 310; Comm. Studies 321; Early Childhood Ed. 312*, 314, 350, 415; English Education 320; Family and Consumer Science 322, 324*; Gerontology 300; Health Education 300, 320, 350; Human/Career Development 310, 318, 330, 335; Human Services 302; Library 318; Nutrition and Foods 300, 308, 320; Kinesiology 410; Psychology 354, 356, 360, 370*, 372*, 358, 368; Sociology 310, 335; Work Exp.198, 298, 498 OR (c) Military Service Credit (Honorable discharge) with minimum of one (1) year active duty service. Course(s) from other college(s): ______, ______College Name: ______IV. NATURAL SCIENCES (3 units minimum) selected from: Anthropology 300; Astronomy 300; Biology 300, 307, 310, 323, 332, 350*, 400, 410, 420, 430, 440, 470; Chemistry 305, 306, 400, 410, 420, 421; Env. Technology 304*; Geography 300; Geology 300, 305, 310, 330, 342, 345, 351; Hort. 300, 302; Natural Resources 302, 304, 320; Physical Science 302; Physics 310, 311, 350, 411; Psychology 312 Course from another college: ______College Name: ______V.(a) AMERICAN INSTITUTIONS (3 units minimum) selected from: History 312, 313, 314, 331; Political Science 301 Course from another college: ______College Name: ______ V.(b) SOCIAL AND BEHAVIORAL SCIENCES (3 units minimum) selected from: Administration of Justice 302; Anthropology 310, 319, 320, 330; Business 320, 330, 345; Comm. Studies 325, 341; Communications Media 300; Early Childhood Ed. 312*; Economics 302, 304, 320; Family and Consumer Science 324*, Geography 310; Gerontology 300; History 307, 308, 344; Journalism 310; Philosophy 360; Political Science 302, 310; Psychology 300, 320, 340, 351, 368, 370*, 372*; Sociology 300, 301, 321, 335 Course from another college: ______College Name: ______ VI. ETHNIC/MULTICULTURAL STUDIES REQUIREMENT – Students must fulfill a 3-units Ethnic/Multicultural Studies course requirement. (Most of these courses may also be used to meet General Education requirements.) Courses which satisfy this requirement are: Administration of Justice 302; Anthropology 310, 330; Art History 312, 324, 328, 330, 332, 333; Biology 323; Business 330; Comm. Studies 325; Dance 380; Early Childhood Ed. 430; English Literature 340, 345, 360; Geography 310; History 308, 344; Humanities 320, 325, 332; Music Fund. History and Lit. 330; Nutrition 310; Philosophy 304, 352, 358; Psychology 356, 368; Sociology 321. Course from other college: ______College Name: ______D. GRADUATION COMPETENCY REQUIREMENTS – Demonstrate college-level competence in reading, in written expression, and in mathematics. Competency in Basic Skills is satisfied by completing the following: 1. READING COMPETENCY – Satisfactorily passing a college level reading examination, or passing English Reading 310 with a “C” grade or better. Students who possess an A. A. degree or higher shall be deemed competent in reading. 2. WRITTEN EXPRESSION COMPETENCY – Completion, with a grade of “C” or better, English Writing 300; Business 310, or an equivalent course from another accredited college. Course(s) from other college(s): ______College Name: ______3. MATHEMATICS COMPETENCY -- Completion, with a grade of “C” or better, Mathematics 110 or a higher level mathematics course; Psychology 330; Statistics 300 OR Obtaining a satisfactory score on a mathematics assessment. Course(s) from other college(s): ______College Name: ______ Courses listed in more than one area may only be used to satisfy the requirements in a single area (Exception: Ethnic/Multicultural Studies). Courses marked with a single “*” have credit limitations. Please consult a counselor for details. 2011-2012 AA degree requirements Version 1.0 February 2011 Folsom Lake College 2011-2012 29 DEGREES AND CERTIFICATES Associate Degrees Accounting (AA) Early Childhood Education (AA) Administration of Justice (AA) ECE Site Supervisor (AA) Art English (AA) Studio Art (AA) Fire Technology (AS) Design (AA) Geology (AS) Art History (AA) Human Services Biology General (AA) Biological Sciences (AS) Gerontology (AA) Biology Option Interdisciplinary Studies Health Science, Areas of Emphasis (AA) Pre-Professional Option American Studies (AA) Pre-Nursing Option Humanities (AA) Business Women’s Studies (AA) Administrative Assistant (AA) Liberal Studies for Elementary Education (AA) Business: General (AA) Management (AA) Business: General, Transfer (AA) Marketing (AA) Small Business Management/Entrepreneurship (AA) Mathematics (AS) Communication Studies Psychology (AA) Organizational Communication (AA) Real Estate (AA) Computer Information Science Computer Science (AS) &HUWLÀFDWHVRI$FKLHYHPHQW $ 5HFRJQLWLRQ 5 Folsom Lake College offers a Accounting Fire Technology (A) YDULHW\RIGHJUHHDQGFHUWLÀFDWH Accounting (A) General Education Transfer Accounting - Advanced (A) CSU General Education (A) options. Requirements are Accounting Clerk (A) IGETC (A) LGHQWLÀHGIRUHDFKYRFDWLRQDO Accounting - Computer Applications (A) Graphic Communication and general education program. Business :HE*UDSKLFV3URGXFWLRQ 5 2IÀFH$VVLVWDQW 5 Group Fitness Instructor (A) The courses required in a 2IÀFH7HFKQLFLDQ $ Human Services program must all be completed 6PDOO%XVLQHVV0DQDJHPHQW(QWUHSUHQHXUVKLS 5 General (A) Communication Studies Gerontology (A) WRHDUQWKHGHJUHHRUFHUWLÀFDWH $SSOLHG&RPPXQLFDWLRQ6NLOOV 5 +RPH&DUHJLYHU 5 regardless of the order in Computer Information Science Management Information Systems which they are completed. Due Computer Programmer SQL (A) $SSOLFDWLRQ'DWD(QWU\ 5 'DWDEDVH$QDO\VW64/ 5 Application Technician (A) to a recent change in state Programming (A) Information Processing (A) UHJXODWLRQVVRPHFHUWLÀFDWHV 5HODWLRQDO'DWDEDVH$GPLQLVWUDWLRQ $ 1RQ3URÀW0DQDJHPHQW $ of less than 18 units can no Early Childhood Education Personal Trainer (A) $VVLVWDQW7HDFKHU 5 Project Management (A) longer be posted on your FLC $VVRFLDWH7HDFKHU 5 Public Management (A) transcript. Visit with a Counselor Early Childhood Education Teacher (A) Real Estate to make your plan! )DPLO\&KLOG&DUH 5 Broker (A) Infant Specialist (A) 6DOHV 5 Master Teacher (A) Waste Water Management (A) Find out more at: Site Supervisor (A) Water Management (A) www.flc.losrios.edu School Age Specialist (A) Revised 3/17/11 30 Folsom Lake College 2011-2012 Transfer Information Make a plan for your transfer success Community College Transfer: Students who were not eligible Students planning to transfer to a California university should IRUDGPLVVLRQWRD&68ZKHQWKH\JUDGXDWHGIURPKLJK plan a program to meet the admissions and graduation school may be eligible once they have completed a minimum UHTXLUHPHQWVRIWKHVSHFLÀFLQVWLWXWLRQWKH\SODQWRDWWHQG of 60 transferable units with a 2.0 grade point average or Transfer admission eligibility is based on transferable college EHWWHU IRULQWHUQDWLRQDORUQRQUHVLGHQWVWXGHQWV DQG XQLWV DQGRU KLJK VFKRRO UHFRUG V DQG WHVW VFRUHV (DFK the following additional requirements: institution has its own requirements for admission and junior &RPSOHWH$UHD$VHFWLRQVDQG ´&µJUDGHRU standing. To prepare for transfer, students must decide which EHWWHUIRUHDFKFRXUVH VFKRROWKH\ZLOODWWHQGDQGFRQVXOWDFRXQVHORUIRUWKHVSHFLÀF $UHD%VHFWLRQ ´&µJUDGHRUEHWWHU requirements for that particular institution and to create a A minimum of 30 semester units of general education written educational plan. with a 2.0 grade point average. This includes items A and B listed above. The college has a variety of support services available to assist students with career decision-making, problem *3$UHTXLUHPHQWVDUHKLJKHUIRUPRUHFRPSHWLWLYHFDPSXVHV resolution, and goal achievement. RUPDMRUV6WXGHQWVDUHKLJKO\HQFRXUDJHGWRFRPSOHWHORZHU Guaranteed Admission with Four-Year Colleges: Folsom Lake division preparatory courses for their major as required by College enjoys guaranteed admission with 10 colleges and WKH&68RIWKHLUFKRLFHLQDGGLWLRQWRJHQHUDOHGXFDWLRQ universities. Participating institutions include: EUHDGWKUHTXLUHPHQWVDQGJUDGXDWLRQUHTXLUHPHQWV/RZHU division major requirements can be obtained from ASSIST *ROGHQ*DWH8QLYHUVLW\ ZZZDVVLVWRUJ WKHRIÀFLDOVWDWHZLGHUHSRVLWRU\IRUWUDQVIHU 6DLQW0DU\·V8QLYHUVLW\ and course articulation information. 8&'DYLV 8&0HUFHG 7KH&68ZLOODFFHSWDPD[LPXPRIWUDQVIHUDEOHVHPHVWHU 8&,UYLQH units completed in the community colleges. FLC students 8&5LYHUVLGH should meet with a counselor to plan appropriate course 8&6DQ'LHJR selection in preparation for transfer. 8&6DQWD&UX] 8&6DQWD%DUEDUD 8QLYHUVLW\RIWKH3DFLÀF Transfer to University of California University of California System - Eligible for UC Admission after 6WXGHQWVPD\ÀOHDWUDQVIHUDGPLVVLRQJXDUDQWHH NQRZQDVD High School: Students who were eligible for admission to the 7$* DIWHUFRPSOHWLQJDVSHFLÀHGQXPEHURIWUDQVIHUDEOHXQLWV XQLYHUVLW\ZKHQWKH\JUDGXDWHGIURPKLJKVFKRRO PHDQLQJ ZLWKDPLQLPXP*3$ W\SLFDOO\DRUKLJKHU DVGHWHUPLQHG WKH\ VDWLVÀHG WKH 6XEMHFW 6FKRODUVKLS DQG ([DPLQDWLRQ E\WKHWUDQVIHULQVWLWXWLRQ3OHDVHVHHDFRXQVHORUIRU7$*GHWDLOV 5HTXLUHPHQWV DUHHOLJLEOHWRWUDQVIHULIWKH\KDYHD´&µ including application deadlines. DYHUDJHLQWUDQVIHUDEOHFRXUVHZRUN Transfer to California State University Community College Transfer: Students who met the California State University System – Eligible for CSU Admissions Scholarship Requirement, but not the Subject Requirement after High School: Students who were eligible for admission to must take transferable college courses in the missing subjects D&68ZKHQWKH\JUDGXDWHGIURPKLJKVFKRROEXWGHFLGHG earning a “C” or better in each required course, and have to attend a community college, can transfer to some&68V an overall “C” average in all transferable coursework to at any time as long as a 2.0 grade point average or better be eligible to transfer. for all transferable coursework completed at the community college is maintained. High school eligibility is based on test Students who met the Scholarship Requirement, but not VFRUHVJUDGHSRLQWDYHUDJHVDQGFRPSOHWLRQRIVSHFLÀF WKH([DPLQDWLRQ5HTXLUHPHQWPXVWFRPSOHWHDPLQLPXP subject area requirements. of 12 semester units of transferable work and earn an RYHUDOO ´&µ DYHUDJH LQ DOO WUDQVIHUDEOH FROOHJH coursework completed. Folsom Lake College 2011-2012 31 Students who did not meet the Scholarship Requirement must: a newly established variation of the associate degrees traditionally offered at a California community college. D &RPSOHWHVHPHVWHUXQLWVRItransferable college 7KH$VVRFLDWHLQ$UWVIRU7UDQVIHU $$7 RUWKH$VVRFLDWH credit with a grade point average of at least 2.4 LQ6FLHQFHIRU7UDQVIHU $67 LVLQWHQGHGIRUVWXGHQWVZKR IRU&DOLIRUQLDUHVLGHQWVIRUQRQUHVLGHQWV and; plan to complete a bachelor’s degree in a similar major at E &RPSOHWHWKHIROORZLQJFRXUVHSDWWHUQearning a D&68FDPSXV6WXGHQWVFRPSOHWLQJWKHVHGHJUHHV $$7 grade of “C” or better in each course: RU$67 DUHJXDUDQWHHGDGPLVVLRQWRWKH&68V\VWHPEXW WZRWUDQVIHUDEOHFROOHJHFRXUVHV VHPHVWHU not to a particular campus or major. In order to earn one XQLWVHDFK LQ(QJOLVKFRPSRVLWLRQ and of these degrees, students must complete a minimum of 60 RQH WUDQVIHUDEOH FROOHJH FRXUVH VHPHVWHU UHTXLUHG VHPHVWHU XQLWV RI &68WUDQVIHUDEOH FRXUVHZRUN XQLWV LQPDWKHPDWLFDOFRQFHSWVDQGTXDQWLWDWLYH ZLWKDPLQLPXP*3$RI6WXGHQWVWUDQVIHUULQJWRD&68 reasoning; and FDPSXVWKDWGRHVDFFHSWWKH$$7RU$67ZLOOEHUHTXLUHG to complete no more than 60 units after transfer to earn a IRXUWUDQVIHUDEOHFROOHJHFRXUVHV VHPHVWHU EDFKHORU·VGHJUHH XQOHVVWKHPDMRULVDGHVLJQDWHG´KLJK XQLWV HDFK FKRVHQ IURP DW OHDVW WZR RI WKH XQLWµPDMRU 7KLVGHJUHHPD\QRWEHWKHEHVWRSWLRQIRU following subject areas: the arts and humanities, VWXGHQWVLQWHQGLQJWRWUDQVIHUWRDSDUWLFXODU&68FDPSXVRU the social and behavioral sciences, the physical WRDXQLYHUVLW\RUFROOHJHWKDWLVQRWSDUWRIWKH&68V\VWHP and biological sciences. Students should consult with a counselor when planning to 6WXGHQWVZKRVDWLVI\WKH,QWHUVHJPHQWDO*HQHUDO complete the degree for more information on university (GXFDWLRQ7UDQVIHU&XUULFXOXPSULRUWRWUDQVIHUULQJ admission and transfer requirements. WR8&ZLOOVDWLVI\2SWLRQEDERYH At the time of catalog publication, no FLC majors for the Transfer to Private Colleges $$7 RU $67 KDYH EHHQ DSSURYHG 0DMRUV DUH XQGHU Independent California College and Universities: California’s development. For more information, please see a counselor fully accredited independent colleges and universities DQGZZZÁFORVULRVHGXIRUPRUHLQIRUPDWLRQ provide a host of options at undergraduate, graduate, and professional levels for students planning to continue their Requirements education beyond community college. 7KHIROORZLQJLVUHTXLUHGIRUDOO$$7RU$67GHJUHHV Students who transfer to independent colleges or universities 1. 0LQLPXPRI&68WUDQVIHUDEOHVHPHVWHUXQLWV will be given academic credit for most, if not all, of their FRPPXQLW\FROOHJHVWXGLHV9LUWXDOO\DOOLQVWLWXWLRQVJLYHIXOO 2. 0LQLPXPJUDGHSRLQWDYHUDJH *3$ RIDWOHDVWLQ credit for general education courses and usually for other DOO&68WUDQVIHUDEOHFRXUVHZRUN:KLOHDPLQLPXPRI courses designated for transfer by the community college. 2.0 is required for admission, some majors may require DKLJKHU*3$3OHDVHFRQVXOWZLWKDFRXQVHORUIRUPRUH Some colleges and universities stipulate a certain number information. of completed units before considering students eligible 3. Completion of a minimum of 18 semester units in an for transfer. Others do not and will accept students at ´$$7µRU´$67µPDMRUZLOOEHGHWDLOHGLQWKH&RXUVHV any time. The requirements are outlined in the respective 'HJUHH DQG &HUWLÀFDWHV VHFWLRQ RI WKH FDWDORJ $OO college catalogs, available upon request from the College’s courses in the major must be completed with a grade of Transition Center. Students are urged to contact their &RUEHWWHURUD´3µLIWKHFRXUVHLVWDNHQRQD´SDVVQR counselors for additional information. SDVVµEDVLV WLWOH 4. &HUWLÀHGFRPSOHWLRQRIWKH&DOLIRUQLD6WDWH8QLYHUVLW\ Requirements for the Associate in Arts for *HQHUDO (GXFDWLRQ%UHDGWK SDWWHUQ &68 *( transfer (AA-T) or Associate in Science for %UHDGWK VHHSDJHIRUPRUHLQIRUPDWLRQ 25WKH transfer (AS-T) ,QWHUVHJPHQWDO*HQHUDO(GXFDWLRQ7UDQVIHU&XUULFXOXP ,*(7& SDWWHUQ VHHSDJHIRUPRUHLQIRUPDWLRQ 7KH6WXGHQW7UDQVIHU$FKLHYHPHQW5HIRUP$FW 6HQDWH%LOO QRZFRGLÀHGLQ&DOLIRUQLD(GXFDWLRQ&RGHVHFWLRQV JXDUDQWHHV DGPLVVLRQ WR D &DOLIRUQLD 6WDWH8QLYHUVLW\ &68 FDPSXVIRUDQ\FRPPXQLW\FROOHJH student who completes an “associate degree for transfer”, 32 Folsom Lake College 2011-2012 CSU General Education Requirements **Information is current as of the 2010-11 academic year. Students need to meet with a counselor for updated requirements.** 2010 -- 2011 Folsom Lake College CSU – General Education/Breadth Requirements A total of 39 units of lower division general education may be certified by Folsom Lake College (note GE represents part of the 60 units required to transfer as an upper division transfer student). IT IS IMPORTANT THAT THE STUDENT SEEK THE AID OF A COUNSELOR WHEN SELECTING COURSES, SINCE MANY VARIABLES, LIKE CHOICE OF MAJOR, AFFECT APPROPRIATE COURSE SELECTION. Students completing 39 units, as specified in the General Education pattern below, may request “Certification” of completion at the time of transfer to any of the campuses of The California State University. Courses that are listed in more than one area may only be used to satisfy the requirements in a single area. Some campuses/majors limit the use of “double-counting” of courses for fulfillment of General Education/Breadth and Major requirements. See a Counselor for more information regarding limitations. AREA A – ORAL and WRITTEN COMMUNICATION, and CRITICAL THINKING (“C” grade or better required) COMP IN PROG NEED 9 units, with one course from each group: Oral Communication: A1 Communications Studies 301, 311, 331, 361 Course from another college: ______College Name: ______Written Communication: English-Writing 300 A2 Course from another college: ______College Name: ______Critical Thinking: A3 Communications Studies 311, 315; English-Writing 301, 302; Philosophy 300, 320, 325, 328 Course from another college: ______College Name: ______AREA B – PHYSICAL UNIVERSE and ITS LIFE FORMS – 9 to 12 Units total, with at least 3 units from each group. At least one course from the Physical Sciences or Life Forms must include a Laboratory (A single * indicates a lab-only course, which must be completed with the associated lecture course; a double ** indicates courses with combined lecture and lab). Physical Sciences: B1 Astronomy 300, 400*; Chemistry 305**, 306**, 321, 322*, 400**, 401**, 410**; 420**, 421**; Geography 300, 301*, 306; Geology 300, 301*, 305, 306*, 310, 311*, 330, 342, 345, 351**; Physical Science 302**; Physics 310, 311, 350**, 360**, 411**, 421**, 431** Course(s) from other college(s): ______College Name: ______Life Forms: B2 Anthropology 300, 301*; Biology 300, 307**, 310**, 323**, 350, 400**, 410**, 420**, 430**, 431**, 440**, 470; Environmental Technology 304, Natural Resources 320**; Psychology 312** Course(s) from other college(s): ______College Name: ______Mathematics/Quantitative Reasoning (“C” grade or better required): B4 Mathematics 310, 335, 343, 350, 351, 370, 400, 401, 402, 410, 420; Psychology 330; Statistics 300 Course(s) from other college(s): ______College Name: ______ AREA C – ARTS, FOREIGN LANGUAGES, LITERATURE and PHILOSOPHY – 9 units minimum, with AT LEAST one course from Arts, and one from Humanities Arts: C1 Architecture 310; Art-History 300, 303, 304, 306, 307, 309, 311, 312, 313, 314, 318, 324, 326, 328, 330, 332, 333; Art 300, 302, 304, 305, 312, 320, 323, 327, 328, 370, 372, 430; Communication Studies 305; Communications Media 305; Film & Media Studies 300; Dance 308; Music Fundamentals, History & Literature 300, 310, 311, 321, 330, 400, 401, 410; Music Instrumental/Voice Instruction 310, 311, 370, 371, 495; Music Performance 350, 357; Photography 300, 425; Theatre Arts 300, 302, 303, 304, 310 Course(s) from other college(s): ______College Name: ______Humanities: English-Creative Writing 400, 410; English-Literature 303, 310, 311, 320, 321, 339, 340, 341, 345, 360, 370, 402; English-Writing 301; French 311, 312, 401, 402, 411, 412; History 307, 308; Humanities 300, 310, 320, 332, 334, 340; C2 Philosophy 304, 310, 330, 331, 338, 350, 352, 356, 358, 360; Sign Language Studies 315, 316; Spanish 401, 402, 411, 412, 425 Course(s) from other college(s): ______College Name: ______AREA D (D0-D9) – SOCIAL and BEHAVIORAL SCIENCES – 9 units minimum (An ^^denotes courses that satisfy CSUS’ Race and Ethnicity Grad Requirement) TWO COURSES COURSES TWO American History and Institutions: can be met by one of the following combinations: 6 semester units, choose one two-course combination from Group 1 or Group 2 Group 1: One course from History 312, 313, or 331 paired with Political Science 301 OR; Group 2: History 312 paired with one course from History 313 or 314 Course(s) from other college(s): ______College Name: ______ ONE COURSE ONE 3 units, selected from the following: Anthropology 310, 319, 320, 330; Business 330, 345; Communications Studies 325^^, 341, 363; Communications Media 300; Economics 302, 304; Early Childhood Education 312*, 314;* Family & Consumer Science 324*; Geography 310; Gerontology 300; History 307, 308, 344; Journalism 310; Philosophy 360; Political Science 302, 310; Psychology 300, 312, 320, 335, 340, 351, 368^^, 370* 372; Social Sciences 338, 360; Sociology 300, 301, 321^^, 335 Course(s) from other college(s): ______College Name: ______ AREA E – LIFELONG UNDERSTANDING and DEVELOPMENT – 3 units minimum Communications Studies 321; Early Childhood Education 314*; English Education 320; Family & Consumer Sciences 322, 324*; Gerontology 300; Health Education 300, 350; Human & Career Development 310; Human Services 302; Nutrition and Foods 300; Physical Education Activity (not more than one unit of PE activity may count in Area E); Physical Education- Theory 301; Psychology 340, 354, 356, 358, 360, 370*; Sociology 310, 335 Course from other college: ______College Name: ______Military Service Credit Clears Area E: Requires copy of DD-214 ______ Folsom Lake College CSU-GE Certification Information Sheet 2010-2011 Version 1.0 10/11 NOTE: Courses marked with a single “*” have credit limitations – see a Counselor for more information Folsom Lake College 2011-2012 33 Intersegmental General Education Transfer Curriculum (IGETC) **Information is current as of the 2010-11 academic year. Students need to meet with a counselor for updated requirements.** 2010 – 2011 Folsom Lake College Intersegmental General Education Transfer Curriculum Completion of the Intersegmental General Education Transfer Curriculum (IGETC) will permit a student to transfer from a California Community College to a campus in either the California State University or the University of California without the need, after transfer, to take additional lower division general education courses to satisfy campus general education requirements. All courses must be completed with a grade of “C” or better (Grades of “C-“will not fulfill this requirement). Courses that are listed in more than one area may only be used to satisfy the requirements in a single area. NOTE: IGETC is NOT appropriate for certain majors and/or campuses. Consult a counselor BEFORE choosing IGETC to fulfill General Education/Breadth requirements to make sure that it is an appropriate choice. AREA 1 – ENGLISH COMMUNICATION CSU – 3 courses required, one from Group A, one from Group B, and one from Group C UC – 2 courses required, one from Group A and one from Group B COMP IN PROG NEED Group A: English Composition, 1 course, 3 semester/4-5 quarter units English Writing 300 Course from another college: ______Advanced Placement Score: ______Group B: Critical Thinking – English Composition, 1 course, 3 semester/4-5 quarter units Communication Studies 315, English Writing 301, 302; Philosophy 328 Course from another college: ______(No AP scores accepted for this area) Group C: Oral Communications (CSU requirement only), 1 course, 3 semester/4-5 quarter units Communication Studies 301, 311, 331, 361 Course from another college: ______(No AP scores accepted for this area) AREA 2 MATHEMATICAL CONCEPTS and QUANTITATIVE REASONING 1 course, minimum 3 semester/4-5 quarter units Math 350*, 351*, 370*, 400*, 401*, 402*; Psychology 330*; Statistics 300* Course(s) from other college(s): ______Advanced Placement Score: ______AREA 3 – (A) ARTS and (B) HUMANITIES 3 Courses, with at least one course from the Arts and one course from the Humanities, 9 semester/12-15 quarter units (A) ARTS: Art History 300, 303, 304, 306, 307, 309, 311, 312, 313, 314, 318, 324, 326, 328, 330, 332, 333; Communication Studies 305; Communications Media 305*; Film & Media Studies 300; Music Fundamentals, History & Literature 300*, 310, 311, 321*, 330, 400, 401, 410; Photography 425*; Theatre Arts 300, 302, 303, 304 Course(s) from other college(s): ______Advanced Placement Score: ______(B) HUMANITIES: English Literature 303, 310, 311, 320, 321, 339, 340, 341, 345, 360, 402; French 411, 412; History 307, 308; Humanities 300, 310, 320, 332, 334, 340; Philosophy 300, 304, 310, 330, 331, 338, 350, 352, 356, 358, 360; Sign Language Studies 316; Spanish 411, 412, 425 Course(s) from other college(s): ______Advanced Placement Score: ______ Additional ARTS OR HUMANITIES AREA 4 (4A - 4J) – SOCIAL and BEHAVIORAL SCIENCES 3 courses from at least 2 disciplines or an interdisciplinary sequence, 9 semester/12-15 quarter units Anthropology 310, 320, 330; Business 345*; Communications Studies 325^^; Communications Media 300*; Economics 302, 304; Early Childhood Education 312*; Family & Consumer Science 324*; Geography 310; History 307, 308, 312, 313, 314, 319, 331, 344; Journalism 310*; Philosophy 360; Political Science 301, 302, 310; Psychology 300, 320, 340, 351, 356, 360, 368^^, 370* 372*; Social Science 338, 360; Sociology 300, 301, 321^^ Course(s) from other college(s): ______Advanced Placement Score: ______^^Indicates courses that satisfy CSUS’ Race and Ethnicity Graduation Requirement AREA 5 (A/B) – PHYSICAL and BIOLOGICAL SCIENCES At least 2 courses, one Physical Science course and one Biological Science course; at least one course must include a laboratory (Lab indicated by “ ** ”), 7-9 semester/9-11 quarter units (A) PHYSICAL SCIENCES: Astronomy 300, 400**; Chemistry 305**, 306**, 321, 322**, 400**, 401**, 420**, 421**; Geography 300, 301**, 306; Geology 300, 301**, 305, 306**, 310, 311**, 330, 345; Physical Science 302**; Physics 310, 311, 350**, 360**, 411**, 421**, 431** Course(s) from other college(s): ______Advanced Placement Score: ______(B) BIOLOGICAL/LIFE SCIENCES: Anthropology 300, 301**; Biology 300, 307**, 310**, 323**, 400**, 410**, 420**, 430**, 431**, 440**, 470; Natural Resources 320**; Psychology 312** Course(s) from other college(s): ______Advanced Placement Score: ______AREA 6(A) – LANGUAGE OTHER THAN ENGLISH (UC requirement only) Proficiency equivalent to two years of High School study in the SAME language. Grades of “C” or better required. Complete either: French 401, Sign Language Studies 305, Spanish 401 OR earn a score of 3 or higher on the foreign language Advanced Placement Test OR 550 on the College Board Achievement Test in Foreign Language Course from another college: ______Completed in High School (H.S. Transcript required): ______Other (specify Advanced Placement or other exam): ______CSU GRADUATION REQUIREMENT IN U.S. HISTORY, CONSTITUTION, and AMERICAN IDEALS (Not part of IGETC; may be completed prior to transfer). 6 semester units, choose from one group below. Group 1: Political Science 301 plus one course from History 312, 313, 331 Group 2: History 312 paired with one course from History 313 or 314 Course(s) from other college(s): ______Advanced Placement Score: ______ IGETC Planning/Information Form 2010-2011 Version 1.0 10/11 NOTE: Courses marked with a single “*” have credit limitations – see a Counselor for more information 34 Folsom Lake College 2011-2012 Student Development Programs and Services Assessment Services Other services:$6*LVZLOOLQJWRSURYLGHDVVLVWDQFHDQG )/& ('& information to campus clubs and groups on event planning, 5&& SXEOLFLW\DQGIXQGUDLVLQJ$6*DOVRSURYLGHVLQIRUPDWLRQWR FLC provides a variety of testing services to assist students VWXGHQWVZKRDUHLQWHUHVWHGLQLQLWLDWLQJFKDQJHVWRH[LVWLQJ in determining appropriate course placement. Free course policies or creating new policies at the college, district, and SODFHPHQWDVVHVVPHQWVDUHDYDLODEOH\HDUURXQGIRU(QJOLVK governmental levels. UHDGLQJ PDWKHPDWLFV DQG (QJOLVKDVD6HFRQG/DQJXDJH (6/ $YDLODELOLW\ LV RQ D ILUVWFRPH ILUVWVHUYHG EDVLV For more information, call the numbers above or go to the &RPSHWHQF\H[DPVWRPHHWUHDGLQJFRPSHWHQF\UHTXLUHPHQWV FROOHJH·V KRPHSDJH DW ZZZÁFORVULRVHGX DQG FKRRVH are also available during regularly scheduled assessment ´6WXGHQW*RYHUQPHQWµIURPWKH4XLFN/LQNVPHQX VHVVLRQV &RPSHWHQF\ H[DPV WR PHHW PDWK FRPSHWHQF\ requirements can be arranged by appointment. Ability to Bookstore %HQHÀW $7% WHVWVIRUÀQDQFLDODLGHOLJLELOLW\FDQEHDUUDQJHG )/& ('& by appointment. A monthly testing schedule is available online 5&& at ZZZÁFORVULRVHGX or in the Student Services lobby. Students ,Q DGGLWLRQ WR UHTXLUHG DQG RSWLRQDO WH[WERRNV WKH with special testing needs should call Assessment prior to the ERRNVWRUHVVHOODYDULHW\RIVFKRRODQGRIÀFHVXSSOLHVVWXG\ testing date to arrange for accommodations. aids, computer software, clothing, snacks, and souvenirs. The stores offer day and evening hours. For inquiries about Associated Student Government VSHFLÀF PHUFKDQGLVH SD\PHQW RSWLRQV DQG DFFHSWDQFH )/& ('& policies, hours, and directions, please call the bookstore. $VVRFLDWHG6WXGHQW*RYHUQPHQW $6* LVWKHRIÀFLDOVWXGHQW Students should bring a copy of their class schedule when association on campus. This organization, recognized as the SXUFKDVLQJ WH[WERRNV DQG VKRXOG KDYH WKHLU VWXGHQW ,' YRLFHRIWKHVWXGHQWVRSHUDWHVXQGHUWKHGLUHFWLRQRIRIÀFHUV number available for purchases as well as returns. ZKRDUHHOHFWHGDWODUJH Textbook Refund Policy: A receipt from the current semester The purpose of the Student Senate is to provide leadership must accompany all returns. Refund dates are listed on and support for the student body, encourage student the refund slip attached to the receipt. Books purchased participation in college governance matters, establish QHZ0867EHIUHHIURPZULWLQJPDUNVEHQWFRUQHUVDQG open communication among the students, faculty, staff, and completely intact. If not, the used purchase price will be administrators of the sites, and facilitate scholastic, cultural, refunded. Picture I.D. is required for all returns. Charge VRFLDO DQG UHFUHDWLRQDO DFWLYLWLHV RQFDPSXV DQG LQ WKH card purchases will be credited to the correct credit card. community. Representatives who serve on college committees DUHDSSRLQWHGE\WKHHOHFWHG$6*SUHVLGHQWDQGPDQ\ Textbook Buyback Policy: Picture I.D. is required for all DOVRVHUYHRQGLVWULFWZLGHFRPPLWWHHV returns. Books may be purchased from students during PRVWRIWKH\HDUDWPDUNHWYDOXH'XULQJÀQDOVWH[WERRNV %HLQJDQ$6*UHSUHVHQWDWLYHDOVRPHDQVEHLQJUHFRJQL]HG ordered by faculty for the upcoming semester may be sold by prospective colleges and employers as having an edge at a higher value. Contact the bookstore for details and over other applicants for leadership abilities, community dates. The bookstore cannot guarantee the buyback of any DZDUHQHVVDQGVXSSRUW$OOVWXGHQWVHQUROOHGLQVL[ XQLWV book at any time. RUPRUHZLWKDFXPXODWLYH*3$RIDWOHDVWDUHHOLJLEOH to become student government representatives. CalWORKs )/&('& 5&& Clubs and Organizations: 7KHVHDFWLYLWLHVRIIHUGLYHUVLÀHG ÁFFDOZRUNV#ÁFORVULRVHGX VRFLDODQGHGXFDWLRQDORSSRUWXQLWLHV(DFKFOXEPXVWKDYH CalWORKs supports and guides students who are currently a faculty advisor and be approved by the Student Life receiving cash aid from the county through college and Coordinator. Anyone interested in forming a club or student county requirements. We have many services to offer organization should contact the Student Life Coordinator. TXDOLÀHGVWXGHQWV Folsom Lake College 2011-2012 35 Advising, Advocacy, and Referral Services Counseling Connections to Counseling )/& ('& (GXFDWLRQDO3ODQ'HYHORSPHQW 5&& 7H[WERRNDQG(QUROOPHQW9HULÀFDWLRQ$VVLVWDQFH Counselors are available throughout the year on an -RE3ODFHPHQW'HYHORSPHQW6XSSRUW DSSRLQWPHQWRUZDONLQEDVLV7KHSURIHVVLRQDOFRXQVHOLQJ 2Q2II&DPSXV:RUN6WXG\3ODFHPHQWV staff provides: Schools Supplies & Child Care Referrals Academic counseling to assist students in assessing, SODQQLQJ DQG LPSOHPHQWLQJ LPPHGLDWH DQG ORQJ CARE (Cooperative Agencies UDQJHHGXFDWLRQDODQGRUWUDQVIHUJRDOV Resources for Education) Career counseling to assist students in assessing and )/& ('& researching aptitudes, abilities, interests, and current 5&& and future employment trends. 7KH &$5( 3URJUDP LV D VWDWHIXQGHG SURJUDP SURYLGLQJ Personal counseling to assist students with personal, academic, career, and personal counseling; campus and family, or other social concerns, when that assistance is FRPPXQLW\ UHIHUUDOV FKLOG FDUH WUDQVSRUWDWLRQ ÀQDQFLDO related to the student’s education. assistance; supply voucher; priority registration; transfer Crisis counseling to assist students with immediate assistance; and support workshops to eligible students. intervention or appropriate referral to other resources on campus or in the community. To be eligible, a student must be: Multicultural counseling ensuring that students are counseled with a respect for their origins and at least 18 years of age cultural values. HOLJLEOHIRUWKH([WHQGHG2SSRUWXQLW\3URJUDPVDQG Instruction in Human Career Development courses, 6HUYLFHV (23 6 SURJUDP &ROOHJH6XFFHVV6WXG\6NLOOVDQG&DUHHU([SORUDWLRQ FXUUHQWO\UHFHLYLQJFDVKDLGIRUVHOIDQGRUFKLOG UHQ Consultation to the college governance process under the age of 14 and liaison to the college community to make the a single head of household HQYLURQPHQWDVEHQHÀFLDOWRWKHLQWHOOHFWXDOHPRWLRQDO a California resident and physical development of students as possible. College Police DSP&S - 7KHSROLFHGHSDUWPHQWLVD3267FHUWLÀHGDJHQF\DQG Disabled Student Programs & Services provides both law enforcement and security services to )/& ('& students. In addition to assisting and handling cases of 'LVDEOHG6WXGHQW3URJUDPV 6HUYLFHV '63 6 SURYLGHV emergencies, they handle all parking enforcement, lost and equal educational opportunity for students with physical, found, vehicle jumpstarts and lockouts, and escorts. The FLC psychological, and learning disabilities. Students with &DPSXV3ROLFH2IÀFHLVORFDWHGLQ3RUWDEOH%XLOGLQJ)/3 disabilities are encouraged to lead active and independent GXULQJWKH)DOFRQ·V5RRVWFRQVWUXFWLRQ 7KH('&&DPSXV lives by participating in all college programs. Counseling, 3ROLFH2IÀFHLVLQ%XLOGLQJURRP%. support services, and academic accommodations are provided to students who are eligible for the program. Computer Labs Physical and Psychological Disabilities: Students with )/& ('& the following disabilities are eligible to receive support 5&& VHUYLFHVDQGDFDGHPLFDFFRPPRGDWLRQV DWWHQWLRQGHÀFLW The Computer Labs are open to all registered students. GLVRUGHU $''$'+' EOLQGDQGYLVXDOO\LPSDLUHG GHDI These facilities are available to meet your computer DQG KHDULQJLPSDLUHG PRELOLW\LPSDLUHG SV\FKRORJLFDO QHHGVZKLOHRQFDPSXV(DFKODEKDVNQRZOHGJHDEOHVWDII and mental health issues, and other medical and health available for assistance. To sign up for computer access, problems that would require special assistance. students need their current class registration and photo ID. Hours of service vary at each site. Please call or check the SRVWHGVFKHGXOHVWRFRQÀUPZKHQHDFKORFDWLRQLVRSHQ Also, wireless access is available to students at the main )ROVRPFDPSXVDQG(O'RUDGR&HQWHU 36 Folsom Lake College 2011-2012 Learning Disabilities: Students of average or above EOP&S - Extended Opportunity DYHUDJH OHDUQLQJ DSWLWXGH PD\ KDYH D VSHFLÀF OHDUQLQJ Programs and Services disability that significantly impacts their educational )/& ('& progress. The program provides support services and 5&& accommodations to students who have documentation of (23 6SURYLGHVVXSSRUWWRHGXFDWLRQDOO\DQGHFRQRPLFDOO\ D VSHFLÀF OHDUQLQJ GLVDELOLW\ IURP DQRWKHU VFKRRO RU DQ disadvantaged students in pursuit of their academic and appropriate professional. In addition, testing and assessment career goals. To this end, we offer a number of services to services are available at FLC. encourage personal and professional growth, enrollment Academic Accommodations: Accommodations are DQGUHWHQWLRQDQGWUDQVIHUWRIRXU\HDUXQLYHUVLWLHV7KH individually determined for students with disabilities, following comprehensive support services are provided to according to the functional limitations of the disability. eligible students at each site: Accommodations may include: (DUO\UHJLVWUDWLRQHDFKVHPHVWHU 7HVWLQJ DFFRPPRGDWLRQV LQFOXGLQJ DQ H[WHQVLRQ RI Book service program WLPH GLVWUDFWLRQUHGXFHG URRP XVH RI FDOFXODWRU Connections to academic, career, and personal counseling spelling checker, computer, alternative method of &DUHHUPDMRUH[SORUDWLRQ WHVWLQJRUPRGLÀFDWLRQRIWKHWHVWUHVSRQVHIRUPDW &$5(SURJUDP The use of equipment and materials such as a tape 9LVLWVWR\HDUFROOHJHVDQGXQLYHUVLWLHV UHFRUGHUFDOFXODWRUFRPSXWHUWDSHGRUHOHFWURQLFWH[W $SSOLFDWLRQIHHZDLYHUV &688& or spelling checker in the classroom and in meeting Workshops class assignments. &DS *RZQSDLG 7KHXVHRISHUVRQQHOVXFKDVLQWHUSUHWHUVQRWHWDNHUV Phi Theta Kappa membership paid ZKLOHDWWHQGLQJFODVVHV UHDGHUVDQGVFULEHV $QQXDO6FKRODUV1LJKW&HOHEUDWLRQ Alternate Formats: These alternate formats, including 0XOWLOLQJXDO6HUYLFHV HOHFWURQLFWH[WERRNVRQWDSHODUJHSULQWDQG%UDLOOH KHOSDFFRPPRGDWHVSHFLÀFSURFHVVLQJQHHGV6WXGHQWV To be eligible, a student must: ZLWKYHULÀHGGLVDELOLWLHVZKRUHTXLUHDOWHUQDWHIRUPDWV of college publications and resources should check %HD&DOLIRUQLDUHVLGHQW KDYHOLYHGLQWKHVWDWHRQH with Disabled Students Programs and Services. These \HDUDQGRQHGD\EHIRUHVFKRROVWDUWV are obtained in the timeliest manner possible. %HHQUROOHGLQXQLWV VRPHVWXGHQWVZLWKH[FHSWLRQDO FRQGLWLRQVPD\EHDFFHSWHGDWDUHGXFHGORDG If an academic accommodation is requested that is not 4XDOLI\ WR UHFHLYH WKH %RDUG RI *RYHUQRUV :DLYHU listed, the request will be forwarded by the DSP&S Staff to %2*:PHWKRG$RU% WKH9LFH3UHVLGHQWRI6WXGHQW'HYHORSPHQWDQG(QUROOPHQW 1RW KDYH FRPSOHWHG PRUH WKDQ XQLWV RI GHJUHH Management for consideration. The student has a right to applicable units. appeal any decision regarding academic accommodations. 6XEPLWDQDSSOLFDWLRQWRWKH(23 6SURJUDP &RQWDFWWKH'63 62IÀFHIRUPRUHLQIRUPDWLRQ 0HHW VSHFLÀF LQFRPH DQG HGXFDWLRQDO FULWHULD DV HVWDEOLVKHGE\(23 6 Employment Opportunities Students may work on or off campus at any of the three sites Applications may be picked up at any campus and WKURXJKDYDULHW\RISURJUDPV2QFDPSXVHPSOR\PHQWLV DSSRLQWPHQWVPD\EHVFKHGXOHGE\YLVLWLQJRUFDOOLQJ(23 6 OLPLWHGWRDPD[LPXPRIKRXUVSHUZHHN DOOSURJUDP VRXUFHV 6WXGHQWVPD\DOVREHHPSOR\HGDVSDUWRIWKHLU Financial Aid Services ÀQDQFLDODLGSDFNDJHDQGVKRXOGFRQVXOWWKH)LQDQFLDO$LG )/& ('& 2IÀFH $ MRE ERDUG SURYLGHV UHVRXUFHV WR HPSOR\PHQW 5&& RIIFDPSXV Financial aid is available for students who need help in meeting their educational costs. Information and applications Students can also take advantage of the Los Rios Internships FDQEHREWDLQHGIURPWKH)LQDQFLDO$LG2IÀFH)LQDQFLDO &DUHHU6HUYLFHV /,1&6 SURJUDP IRUPRUHLQIRUPDWLRQ assistance for students may include: grants, federal JRWRZZZORVULRVHGXOUFOLQFVSKS ZRUNVWXG\ RQFDPSXVHPSOR\PHQW YDULRXV)/&)RXQGDWLRQ scholarships as well as privately supported scholarships for VWXGHQWVLQSDUWLFXODUÀHOGVDQGORDQV,QDGGLWLRQWRWKH Folsom Lake College 2011-2012 37 JHQHUDOÀQDQFLDODLGSURJUDPVWKH%RDUGRI*RYHUQRUV Wellness Services Information )HH :DLYHU LV DYDLODEOH RQOLQH DW ZZZORVULRVHGXOUF Folsom Lake College Wellness Services offers several events, bog_steps.php. This application pays the community college workshops, or presentations each semester. Please check the enrollment fee for eligible state resident students. If your online calendar or with Wellness Services for information LQFRPHH[FHHGVWKHLQFRPHVWDQGDUGV\RXPLJKWVWLOOTXDOLI\ and dates. If you would like to suggest a workshop or health E\FRPSOHWLQJWKH)UHH$SSOLFDWLRQIRU)HGHUDO HGXFDWLRQWRSLFSOHDVHIHHOIUHHWRFDOO 6WXGHQW$LG )$)6$ DSSOLFDWLRQDWZZZIDIVDHGJRY7KH Wellness Services are offered at all Folsom Lake College )$)6$DOORZVIRUKLJKHULQFRPHVWDQGDUGV7KHÀQDQFLDO campuses – please check the Wellness Services website DLGVWDIILVDYDLODEOHE\DSSRLQWPHQWRUGURSLQEDVLVWR IRUVSHFLÀFGDWHVDQGWLPHV:HOOQHVV6HUYLFHVKDVOLPLWHG assist students and their parents. For additional information, services between terms. please refer to the “Financial Aid” section of this catalog. &RQÀGHQWLDOLW\ FLC Reading and Writing Center $OOVHUYLFHVDW:HOOQHVV6HUYLFHVDUHNHSWVWULFWO\FRQÀGHQWLDO and EDC English Center according to State and Federal regulations and HIPAA )/& ('& +HDOWK,QIRUPDWLRQ3RUWDELOLW\DQG$FFRXQWDELOLW\$FW 7KH)/&5HDGLQJDQG:ULWLQJ&HQWHU )/ DQGWKH ('&(QJOLVK&HQWHU & DUHVXSSRUWLYHDQGSHUVRQDOL]HG Wellness Services: learning environments. By enrolling in one or more of the )LUVW$LG)RUDFFLGHQWVDQGVXGGHQLOOQHVVRQFDPSXV classes the centers have to offer, students receive innovative, (YDOXDWLRQRI0HGLFDO3UREOHPV²KHOSZLWKGHYHORSLQJ individualized, and quality instruction in reading, writing, a management plan for chronic conditions, instructions DQG(QJOLVKODQJXDJHVNLOOV,QDGGLWLRQVWXGHQWVFDQUHFHLYH IRUVHOIFDUHDQGUHIHUUDOVWRDSSURSULDWHFRPPXQLW\ assistance with their reading and writing assignments across resources as needed. WKHGLVFLSOLQHV7KH)/&2QOLQH0DWK2IÀFHLVDOVRORFDWHG &RQÀGHQWLDO+HDOWK$GYLVLQJ 6XSSRUW LQWKH5:&(DFKFHQWHUKDVDVSDFLRXVURRPZLWKWDEOHV +HDOWK 6FUHHQLQJ ² 9LVLRQ VFUHHQLQJ EORRG SUHVVXUH and chairs for individual work; breakout rooms for group screening, weight and body fat measurement. work; a computer lab for internet access, word processing, Tuberculin Skin Testing. and electronic library research; bibliographic and speed +HDOWK ,QVXUDQFH ,QIRUPDWLRQ 6WXGHQW DFFLGHQW DQG reading software. illness insurance and community resources. Health and Wellness Information. Health & Wellness Services Drug and Alcohol Abuse Information and Referrals. Smoking Cessation Information. 2XWUHDFK DQG 3UHYHQWLRQ 6HUYLFHV +HDOWK:HOOQHVV 7KH:HOOQHVV6HUYLFHV&HQWHU )/ LVORFDWHGLQ events, workshops, & presentations. WKH6WXGHQW6HUYLFHV&HQWHURQWKH)ROVRPFDPSXV $VSHQ +DOO 6HUYLFHVDUHSURYLGHGE\&ROOHJH1XUVH0DU\+DQVHQ 0RVWVHUYLFHVDQGZRUNVKRSVDUHIUHH7KHUHLVD 513+1061 IHHIRU7%WHVWLQJ²SOHDVHSD\ÀUVWDW%XVLQHVV6HUYLFHV $GPLQ%OGJ %XVLQHVV6HUYLFHVKRXUVDUH0RQ7KXU$0 Mission – 5:30 PM, Fri 8 AM to 5 PM. TB testing is done all days Folsom Lake College Wellness Services aim to align with EXW7KXUVGD\ UHVXOWV0867EHFKHFNHGWRKRXUVODWHU the mission of the College by: Scheduled hours may change without notice. Call for Offering accessible, innovative preventative care and XSGDWHV wellness services that empower students and assist them in successfully reaching their educational goals. Introducing students to fundamental health and wellness Publications/Website concepts that will help them create a lifelong foundation. )/& Developing and maintaining collaborations and This college catalog is an important resource for student SDUWQHUVKLSV RQ WKH FDPSXV DQG LQ WKH FRPPXQLW\ success, including current information on available services, WKDW DUH UHVSRQVLYH WR WKH GLYHUVH EDFNJURXQGV FRXUVHSURJUDP VHOHFWLRQ DQG JUDGXDWLRQ DQG WUDQVIHU perspectives, abilities, and needs of those who seek requirements. Students should consider using the catalog services. as a resource throughout the year. 38 Folsom Lake College 2011-2012 $ WDEORLGVW\OH SXEOLFDWLRQ ZLWK D YDULHW\ RI FROOHJH ASSIST is an online student information system that provides LQIRUPDWLRQ LV PDLOHG WZLFH D \HDU VSULQJ DQG IDOO WR WKH PRVW DFFXUDWH DQG XSWRGDWH LQIRUPDWLRQ DERXW DSSUR[LPDWHO\KRPHVLQWKHUHJLRQ student transfer in California. Please visit www.assist.org for more information. The college website at ZZZÁFORVULRVHGXprovides a wide variety of student information, including the latest campus Tutorial Services news and class schedules. The Tutorial Services Program offers students free tutoring Transition Center/Services DVVLVWDQFHIRUWKHLUFROOHJHFRXUVHVZLWKWKHH[FHSWLRQRI )/& ('& (QJOLVKRUUHODWHGUHDGLQJZULWLQJVNLOOVDOORIZKLFKDUH There are two major areas of information offered through provided at the Folsom campus by the Reading and Writing the Transition Center: &HQWHU DQG DW ('& E\ WKH (QJOLVK &HQWHU 7KH 7XWRULDO 8QLYHUVLW\7UDQVIHU Program offers individualized and small group tutoring &DUHHU([SORUDWLRQ in various subjects, dependent upon the availability of TXDOLÀHGSHHUWXWRUV7XWRULDO6HUYLFHVDUHDYDLODEOHRQD Our students are in continuous “transition” from one stage of GURSLQEDVLVGXULQJWKHSRVWHGWXWRULQJKRXUV*LYHQWKH life to another. Whatever transition our students make, the availability of student tutors, tutoring hours may change over Transition Center is a great resource to gather information the course of the semester, so students should regularly check and make future plans. It is located in the Student Services the current tutoring schedule. For more information, go to: area at Folsom Lake College. ZZZÁFORVULRVHGX6WXGHQWB6HUYLFHV6WXGHQWB6XFFHVV Tutoring.htm. Transfer/Career-related activities and resources are available to help meet individual student needs. Activities 9HWHUDQV(GXFDWLRQDO%HQHÀWV include: (GXFDWLRQDO%HQHÀWV Annual Transfer Fair – university representatives visit Folsom Lake College is approved to offer instruction to RQFDPSXV WR SURYLGH DGPLVVLRQV ÀQDQFLDO DLG DQG service persons, reservists, and other eligible persons under program information to students. 7LWOH86&RGHDQG'HSDUWPHQWRI9HWHUDQV$IIDLUV 8QLYHUVLW\9LVLWDWLRQV²FROOHJHUHSUHVHQWDWLYHVIURPD 9$ UHJXODWLRQV(OLJLELOLW\IRUEHQHÀWVXQGHUDQ\RIWKHVH variety of college and universities visit campus monthly programs is determined by the appropriate federal or state WRPHHWZLWKVWXGHQWVYLDDSSRLQWPHQWRURQDGURSLQ agency, and not by the college. basis. &RPSXWHUV,QWHUQHW²VHOIDVVHVVPHQWDQGUHVHDUFKLQJ 'HSHQGHQWVRI9HWHUDQV)HH:DLYHU FDUHHUUHODWHGWRSLFV $VWXGHQWZKRLVDGHSHQGHQWRIDYHWHUDQZLWKDVHUYLFH Reference materials – books, handouts, college FRQQHFWHGGLVDELOLW\RUZKRGLHGRIDVHUYLFHFRQQHFWHG applications, college event information. cause may be eligible to receive a waiver of enrollment Workshops – we offer workshops and seminars to assist IHHVWKURXJKWKH&DOLIRUQLD'HSHQGHQWVRI9HWHUDQV&ROOHJH students with the college application process, admissions Fee Waiver Program. Application forms and additional essay, and understanding the university transfer process. information may be obtained by contacting your local county 3OHDVHYLVLWWKH)/&ZHEVLWH 7UDQVIHU6HUYLFHVSDJH IRU YHWHUDQV VHUYLFH RIÀFH OLVWHG LQ WKH WHOHSKRQH GLUHFWRU\ events and representative schedules. Appointments can be XQGHUFRXQW\JRYHUQPHQW$SSURYHG9$DXWKRUL]DWLRQOHWWHUV PDGHE\FDOOLQJ )/& RU PXVWEHVXEPLWWHGGLUHFWO\WRWKH)LQDQFLDO$LG2IÀFHIRU ('& a fee waiver. &HUWLÀFDWLRQ3URFHVV Guaranteed Admission with Four-Year Colleges: Folsom Lake 1HZVWXGHQWVVKRXOGÀUVWHQUROOLQWKH&ROOHJHDQGUHJLVWHU College enjoys guaranteed admission with 10 colleges and into courses, following the regular matriculation process for XQLYHUVLWLHV 3DUWLFLSDWLQJ LQVWLWXWLRQV LQFOXGH *ROGHQ *DWH DOOVWXGHQWV2QFHHQUROOHGVWXGHQWVPD\DSSO\IRU9$ 8QLYHUVLW\6DLQW0DU\·V8QLYHUVLW\8&'DYLV8&,UYLQH8& EHQHÀWVE\FRPSOHWLQJD9$$SSOLFDWLRQIRU(GXFDWLRQDO 0HUFHG8&5LYHUVLGH8&6DQ'LHJR8&6DQWD&UX]8& %HQHÀWVZKLFKLVDYDLODEOHIURPWKH$GPLVVLRQV 5HFRUGV 6DQWD%DUEDUDDQG8QLYHUVLW\RIWKH3DFLÀF RIÀFH RU RQOLQH DW WKH 9$ ZHEVLWH ZZZJLELOOYDJRY 6WXGHQWVVKRXOGDOVRVXEPLWDGGLWLRQDOUHTXLUHG)/&9$ GRFXPHQWVDVZHOO DVD'' PHPEHUFRS\ LI WKH Folsom Lake College 2011-2012 39 veteran served on active duty. Students must request Work Experience Education (WEXP) HQUROOPHQWFHUWLÀFDWLRQHDFKVHPHVWHU6WXGHQWVPXVWQRWLI\ WKH FROOHJH 9$FHUWLI\LQJ RIILFLDO LI WKHLU HQUROOPHQW :RUN([SHULHQFH is an academic program in which students major, or address changes. The certifying officer will apply what they have learned in the classroom to their PDNHQHFHVVDU\FHUWLÀFDWLRQVRIHQUROOPHQWRUFKDQJHVLQ job or internship site and work toward earning college enrollment and progress. FUHGLWV6WXGHQWVZLOOGHYHORSQHZVNLOOVRQWKHMRERULQD Evaluation of Prior Education and Training skilled professional level assignment on campus or in the All students with prior college credit receiving veterans FRPPXQLW\2QHPLQXWHZHHNO\FODVVLVDOVRDWWHQGHG HGXFDWLRQDOEHQHÀWVDUHUHTXLUHGWR KDYHVXEPLWWHGWR which focuses on workforce and career transition. Internship WKH$GPLVVLRQV 5HFRUGVRIÀFHRIÀFLDODFDGHPLFWUDQVFULSWV and job assistance is available. Internships may be paid IURPHDFKVFKRROSUHYLRXVO\DWWHQGHG KDYHVXEPLWWHG RUQRQSDLGDQGZLOOSURYLGHSUHSDUDWLRQIRUDFDUHHU D''LIWKH\ZHUHRQDFWLYLW\GXW\DQG FRPSOHWH by providing professional skill development, employment D9$(GXFDWLRQ3ODQZLWKDFRXQVHORUZKLFKHVWDEOLVKHV FRQWDFWVFRQÀGHQFHEXLOGLQJDQGPRUH a personalized education plan based on prior education and training and the student’s current academic objective. &RXUVH5HVWULFWLRQVIRU&HUWLÀFDWLRQ &RXUVHVZLOO127EHFHUWLÀHGIRUEHQHÀWVDIWHUWKHÀUVW VHPHVWHUXQWLOWKH(GXFDWLRQ3ODQLVFRPSOHWH2QO\FRXUVHV that meet requirements or their prerequisites for the major and degree objective as indicated on the education plan ZLOOEHFHUWLÀHGIRUSD\PHQW,IWKHDFDGHPLFREMHFWLYHLV changed, the student must complete a new education plan DFFRUGLQJO\7KHFROOHJHFDQRQO\FHUWLI\IRUFHUWLÀFDWH$$ or AS majors listed in the FLC catalog, or for transfer majors IRUZKLFKRIÀFLDODUWLFXODWLRQKDVEHHQFRPSOHWHGEHWZHHQ FLC and the intended transfer college and program. For more information, contact the Folsom Lake College $GPLVVLRQV 5HFRUGV RIÀFH DW RU WKH 9HWHUDQV$GPLQLVWUDWLRQ5HJLRQDO2IÀFHDW or www.gibill.va.gov 40 Folsom Lake College 2011-2012 Libraries Folsom Lake College Library (FLC) Library Card 7KHOLEUDULHVDWERWK)/&DQG('&DUHDJUHDWSODFHWRÀQG Library Catalog reliable information or for a quiet location to study. They The online library catalog, Los Rios Online Information DUHHTXLSSHGZLWKFRPSXWHUVDQGIHHEDVHGSKRWRFRSLHUV 6\VWHP /2,6 LGHQWLÀHV ERRNV H%RRNV SHULRGLFDOV and printers. Study rooms are available in the libraries for PHGLDDQGUHVHUYHPDWHULDOVDYDLODEOHDW)/&('&DQG group study or individual study. the other Los Rios Community College District Libraries. Additional services such as renewing books online, viewing Librarians your library account, and requesting books from other Los Rios College Libraries are accessed through the online /LEUDULDQV DW WKH )/& DQG ('& /LEUDULHV DUH DYDLODEOH catalog. Ask a librarian if you need assistance using the to provide instruction on various library resources and catalog. The library catalog is accessible through the services. For research assistance, students at FLC can come library homepages. WRWKHOLEUDU\5HIHUHQFH'HVNRUDWWHQGRQHRIWKHGURS LQ OLEUDU\ LQVWUXFWLRQV 7KH GURSLQ VFKHGXOH LV DYDLODEOH RQ WKH )/& OLEUDU\ KRPHSDJH ('& VWXGHQWV FDQ PDNH Online Research Databases appointments with the librarian for research help in the In addition to the print and media collections, the libraries ('&OLEUDU\ provide online access to a variety of databases that FRQWDLQ IXOOWH[W MRXUQDOV PDJD]LQHV DQG QHZVSDSHUV In addition, Librarians help students identify reliable as well as encyclopedias, reference works, literary ZHEVLWHVDQGRWKHURQOLQHLQIRUPDWLRQLQRUGHUWRH[SDQG criticism, biography, international affairs, and current WKHLUUHVHDUFKRQWKH,QWHUQHW7KH('&/LEUDULDQ·V,QWHUQHW events. Library research databases are available to Los Subject Directories contain carefully selected links to Rios Community College students, faculty, and staff. The various scholarly directories pointing users to many databases are accessible through the library homepages. ZHEVLWHV E\ VXEMHFW 7KLV JXLGH LV DYDLODEOH DW ZZZÁF When off campus, you will need your Los Rios Student ID ORVULRVHGXaMLPHQHU WKLVOLQNLVDOVRDYDLODEOHRQWKH)/& QXPEHU H[DPSOH ZZLWKWKHZ DQG/RV5LRV DQG('&OLEUDU\ZHEVLWHV SDVVZRUG WKHVDPHSDVVZRUGXVHGE\H6HUYLFHVL0DLO DQG'HVLJQ/HDUQ $VNDOLEUDULDQLI\RXQHHGDVVLVWDQFH ,QVWUXFWRUV PD\ DOVR EULQJ FODVVHV LQ IRU FRXUVHUHODWHG using the databases. OLEUDU\ LQVWUXFWLRQ 7R GHYHORS LQGHSWK UHVHDUFK VNLOOV WKH OLEUDU\ RIIHUV FUHGLW FRXUVHV VHH WKH /LEUDU\ OLVWLQJ Reserve Materials LQ &RXUVH 'HJUHH &HUWLÀFDWH 2IIHULQJV VHFWLRQ RI These items are supplementary resources, including WKLV FDWDORJ 7KHVH FRXUVHV DUH GHVLJQHG WR PDNH \RXU WH[WERRNV PDGH DYDLODEOH E\ LQVWUXFWRUV DQG FLUFXODWHG academic research easier and more rewarding. for short loan periods. Reserve materials can be found by searching in the Library Catalog. Folsom Lake College 2011-2012 41 Loan Periods *HQHUDOFLUFXODWLQJERRNVFKHFNRXWIRUGD\VDQGPD\ EHUHQHZHGRQFHXQOHVVWKHUHLVDKROGRQWKHLWHP V Item type Loan period General Circulating Books 21 days General Circulating Media 7 days 2 hours, 1 day, 3 days, Reserve Materials or 7 days Reference Books & Periodicals Library Use Only Overdue Fines Fines also accrue during the hours and days the library is closed. Fines can be paid at the Circulation Counter. Fine rates Per item 'ĞŶĞƌĂůŝƌĐƵůĂƚŝŶŐŽŽŬƐ ΨϬ͘ϱϬƉĞƌĚĂLJ ϭͲĚĂLJ͕ϯͲĚĂLJ͕ϳͲĚĂLJDĂƚĞƌŝĂůƐ Ψϭ͘ϬϬƉĞƌĚĂLJ ϮͲŚƌZĞƐĞƌǀĞDĂƚĞƌŝĂůƐ ΨϬ͘ϱϬƉĞƌŚŽƵƌ Lost and Damaged Materials Library materials that are lost or damaged will have a FXUUHQWUHSODFHPHQWFRVWSOXVDQRQUHIXQGDEOH SURFHVVLQJIHH2XWRISULQWPDWHULDOVZLOOEHUHYLHZHGE\ library faculty and staff to assess current replacement cost DQGDOVRLQFXUWKHQRQUHIXQGDEOHSURFHVVLQJIHH 42 Folsom Lake College 2011-2012 Financial Aid 7KH)LQDQFLDO$LG2IÀFHSURYLGHVDZLGHUDQJHRIÀQDQFLDO of the Congressional Medal of Honor; a dependent of DVVLVWDQFHWRVWXGHQWVLQWKHIRUPRIJUDQWVSDUWWLPHRQ a victim of the September 11, 2001 terrorist attack; campus employment, scholarships, and loans. All awards or a dependent of a deceased law enforcement DUHFRQWLQJHQWXSRQÀQDQFLDOQHHGFRVWRIDWWHQGDQFHDQG ÀUH VXSSUHVVLRQ SHUVRQQHO NLOOHG LQ WKH OLQH RI GXW\ HQUROOPHQWVWDWXV IXOOWLPHRUSDUWWLPH Recipients must bring documentation in order to qualify. Documents submitted will be accepted only if 7KHEDVLFSUHPLVHIRUDOOQHHGEDVHGÀQDQFLDODLGSURJUDPV they are dated within the last 30 days. LVWKDWWKHSULPDU\UHVSRQVLELOLW\IRUÀQDQFLQJDVWXGHQW·V 0HWKRG $ 7$1)&DO:25.V 66,663 RU *HQHUDO SRVWVHFRQGDU\HGXFDWLRQUHVWVZLWKWKHVWXGHQWDQGKLVKHU $VVLVWDQFH UHFLSLHQWV PXVW EULQJ GRFXPHQWDWLRQ DLG IDPLO\6WXGHQWÀQDQFLDODLGLVLQWHQGHGWRDVVLVWZLWKWKRVH YHULÀFDWLRQVXPPDU\ODVWYRXFKHURUFKHFN LQRUGHU educational costs that remain after the student’s resources to qualify. Documents submitted will be accepted only DQGDQH[SHFWHGFRQWULEXWLRQIURPWKHIDPLO\KDYHEHHQ if they are dated within the last 30 days. WDNHQ LQWR DFFRXQW 7REH FRQVLGHUHG IRU ÀQDQFLDO DLG 0HWKRG% ,I\RXPHHWKRXVHKROG ORZ LQFRPHVWDQGDUGV a student must complete a Free Application for Federal VHHFKDUW 'HSHQGHQWVWXGHQWVPXVWXVHWKHSDUHQW·V 6WXGHQW$LG )$)6$ HDFKDFDGHPLF\HDUDQGSUHIHUDEO\ LQFRPH GRQRWLQFOXGHWKHVWXGHQW·VLQFRPH ,QFRPH E\0DUFKQGWREHHOLJLEOHIRUPD[LPXPDLG)RUPVDUH includes adjusted gross income, wages not reported on DYDLODEOHDWWKH)LQDQFLDO$LG2IÀFHRURQWKHZHEDW ZZZ DWD[UHWXUQDOOXQWD[HGLQFRPHDQGFDVKUHFHLYHGRU fafsa.ed.gov. The Title IV federal school code for Folsom Lake any money paid on your behalf. College is: 038713. 1RWH $SSOLFDQWV PXVW TXDOLI\ IRU 0HWKRG $ RU % LQ order to receive a reduced parking fee. Once the FAFSA is submitted online, a Student Aid Report Method C: If you have completed a Free Application 6$5 ZLOOEHHPDLOHGRUPDLOHGGLUHFWO\WRWKHVWXGHQWDQG IRU )HGHUDO 6WXGHQW $LG )$)6$ DQG KDYH EHHQ a duplicate version will be transmitted electronically to the GHWHUPLQHGWRKDYHMXVWRI´ÀQDQFLDOQHHGµEDVHG GHVLJQDWHGVFKRRO6WXGHQWVZLOOEHQRWLÀHGE\WKH)ROVRP on Federal calculation. /DNH&ROOHJH)LQDQFLDO$LG2IÀFHUHJDUGLQJDQ\DGGLWLRQDO GRFXPHQWVQHHGHGLQRUGHUWRFRPSOHWHWKHLUÀOHXSRQUHFHLSW %2*):,QFRPH6WDQGDUGV RI WKHLU 6$5 7KH ÀOH UHYLHZ SURFHVV FDQ WDNH XS WR ZHHNV,IVHOHFWHGIRUYHULÀFDWLRQDVWXGHQWPXVWFRPSOHWHDOO Family Size 2010 Income YHULÀFDWLRQGRFXPHQWDWLRQDVUHTXLUHGE\IHGHUDOJXLGHOLQHV Folsom Lake College participates in the following programs: (DFK$GGLWLRQDO)DPLO\0HPEHU Board of Governors Fee Waiver (BOGFW) This program waives your enrollment fees for the academic Federal and State Grants \HDU VXPPHUVHVVLRQDQGIDOOVSULQJVHPHVWHU DQGGRHV (do not require repayment) not require repayment. Only one application per year is Federal Pell Grant necessary and you must reapply each year. The deadline This program aids students who have not yet received a to apply is the last day of the Spring 2012 semester. EDFKHORU·VGHJUHHIURPDQ\LQVWLWXWLRQ7KH3HOO*UDQWLV Applications are available online starting April 11, 2011, LQWHQGHG WR EH WKH ´IRXQGDWLRQµ RI D VWXGHQW·V ÀQDQFLDO for the Summer 2011, Fall 2011, and Spring 2012 aid package with other sources of aid to supplement it. VHPHVWHUVDW ZZZORVULRVHGXOUFERJBVWHSVSKSDVZHOO (OLJLELOLW\ ZLOO YDU\ DFFRUGLQJ WR HQUROOPHQW VWDWXV DQG DVDWWKH)LQDQFLDO$LGRIÀFH IHGHUDOO\GHWHUPLQHG([SHFWHG)DPLO\&RQWULEXWLRQ ()& (OLJLELOLW\ Federal Supplemental Educational Opportunity Grants Must be a California resident. (FSEOG) Complete a simple application form available online This program is limited to undergraduate students with RULQWKH)LQDQFLDO$LG2IÀFH H[FHSWLRQDOÀQDQFLDOQHHGZKRIRUODFNRIÀQDQFLDOPHDQV Be prepared to provide proof of eligibility. There are would be unable to enter or remain in college. Funding is four methods by which you may qualify: limited; therefore, students are encouraged to apply early. 6SHFLDO &ODVVLÀFDWLRQ 'HSHQGHQWV RI 9HWHUDQV RU 1DWLRQDO*XDUG UHFLSLHQWRUWKHFKLOGRIDUHFLSLHQW Folsom Lake College 2011-2012 43 State Cal Grants FRPPXQLW\VHUYLFHDQGRUZRUNH[SHULHQFH$ZDUGVPD\ &DO *UDQWV DUH DGPLQLVWHUHG DQG SURFHVVHG E\ WKH be renewed. A second application is required for the second &DOLIRUQLD6WXGHQW$LG&RPPLVVLRQ &6$& 7KH)$)6$DQG \HDU$ZDUGDPRXQWLVSHUVWXGHQWSHU\HDU D*3$9HULÀFDWLRQPXVWEHVXEPLWWHGE\0DUFKQGSULRU WRWKHDZDUG\HDU&RQWDFWWKH)LQDQFLDO$LGRIÀFHIRU*3$ Foundation Scholarship 9HULÀFDWLRQUHTXLUHPHQWV These awards are provided by the Folsom Lake College Foundation and are granted to graduating seniors and &DO*UDQW$ +HOSVORZDQGPLGGOHLQFRPHVWXGHQWV FXUUHQWO\HQUROOHGVWXGHQWVHQUROOHGLQDWOHDVWVL[XQLWVDW ZLWKWXLWLRQFRVWVDW\HDUFROOHJHVDQGXQLYHUVLWLHV )/&('&5&&DQGEDVHGRQWKHJRDOVVWDWHGE\WKHVWXGHQW *UDQWUHFLSLHQWVDUHVHOHFWHGRQWKHEDVLVRIÀQDQFLDO DFDGHPLFHIIRUWVKRZQE\DGHTXDWHJUDGHV *3$ need and grade point average. FRPPXQLW\VHUYLFHRUZRUNH[SHULHQFHDQGÀQDQFLDOQHHG The California Student Aid Commission will hold tuition fee awards for those who qualify, until the student &RQWDFW)LQDQFLDO$LGIRUVFKRODUVKLSLQIRUPDWLRQDW WUDQVIHUVWRDIRXU\HDUFROOHJH6WXGHQWVPXVWPDLQWDLQ eligibility each year. &DO *UDQW % $LGV VWXGHQWV IURP ORZLQFRPH DQG Loans (requires repayment) disadvantaged backgrounds. This grant may be used at Federal Direct Loan Program (Subsidized) a community college or a university for up to four years. 7KLVORDQLVRIIHUHGWRPLGGOHDQGORZLQFRPHERUURZHUV &DO*UDQW& 3URYLGHVDVVLVWDQFHIRUORZDQGPLGGOH ZKRGHPRQVWUDWHÀQDQFLDOQHHG/RDQOLPLWVDQGLQWHUHVW income students formally enrolled in and pursuing a rates are based on current federal guidelines. vocational training program at Folsom Lake College. Federal Direct Loan Program (Unsubsidized) On-Campus Employment (money earned - This loan is offered for middle and higher income borrowers. does not require repayment) :LWK WKH H[FHSWLRQ RI GHPRQVWUDWLQJ ÀQDQFLDO QHHG WKH Federal Work Study Program (FWS) unsubsidized Federal Direct Loan has the same eligibility The Federal Work Study program allows students to earn criteria as the subsidized Federal Direct Loan. This means that PRQH\ IRU WKHLU HGXFDWLRQDO H[SHQVHV ZKLOH LQ VFKRRO family income will not affect loan eligibility or disqualify a 6WXGHQWV DUH HQFRXUDJHG WR ÀQG MREV UHODWLQJ WR WKHLU student from receiving an unsubsidized loan. Loan limits and program of study on the college campus. Work study wages interest rates are based on current federal guidelines. are based on federal minimum wage guidelines. Students may qualify by virtue of their need, satisfactory academic To apply for a federally insured loan, institutional policy standing, availability, and feasible work skills. requires that a student must: Complete a Free Application for Federal Student Aid Scholarships (do not require repayment) )$)6$ %HHQUROOHGLQDWOHDVWVL[XQLWV Scholarship awards are available for students who are 5HFHLYHDZDUGOHWWHUIRURWKHUIRUPVRIIHGHUDOVWDWH LQWHUHVWHGLQSDUWLFXODUÀHOGVRIVWXG\ZKRDUHPHPEHUVRI ÀQDQFLDODLG underrepresented groups, who live in certain areas of the Attend a loan entrance counseling workshop to obtain FRXQWU\RUZKRGHPRQVWUDWHÀQDQFLDOQHHG7KH)LQDQFLDO loan applications. $LG 2IÀFH PDLQWDLQV D OLVW RI ORFDO VWDWH DQG QDWLRQDO $WWHQGH[LWORDQFRXQVHOLQJHYHU\DFDGHPLF\HDURU VFKRODUVKLSV (QUROOPHQW YHULÀFDWLRQ LV XVXDOO\ UHTXLUHG XSRQJUDGXDWLRQRUH[LWLQJWKHFROOHJH Scholarships from many donors are available for the student who is returning for a second year, as well as for Accepting any federal student loan is accepting a huge WKHVWXGHQWZKRSODQVWRWUDQVIHUWRDIRXU\HDULQVWLWXWLRQ responsibility. Defaulting on any federal student loans will 1XPEHURIDZDUGVGHSHQGVRQWKHQXPEHURIDSSOLFDWLRQV UHVXOWLQGLVTXDOLÀFDWLRQRIDOOÀQDQFLDODLGDGYHUVHFUHGLW and funds available. and severe legal action. By accepting a Federal Direct Student Loan, the student accepts the responsibility to repay it. El Dorado Center Patron’s Club Scholarship 7KHVHDZDUGVDUHGRQDWHGE\WKH(O'RUDGR&HQWHU3DWURQV Club. Awards are based on the goals stated by the student, DFDGHPLFHIIRUWVKRZQE\DGHTXDWHJUDGHVÀQDQFLDOQHHG 44 Folsom Lake College 2011-2012 Requirements for Federal/State 5. &RPSOHWLRQ RI 'HJUHH 6WXGHQWV ZKR FRPSOHWH Financial Aid a degree are considered to have reached their PD[LPXPWLPHIUDPHDQGZLOOEHGHQLHGÀQDQFLDO $ELOLW\WR%HQHÀW $7% $SSOLHVWRVWXGHQWVZKRDUHDGPLWWHG aid. For students whose educational goal is to to college but who do not have a high school diploma or HDUQDFHUWLÀFDWHWKH\ZLOOEHGLVPLVVHGRQFHWKH\ WKHHTXLYDOHQW$VWXGHQWPXVWVDWLVIDFWRULO\FRPSOHWHVL[ FRPSOHWHDFHUWLÀFDWH degree applicable or transfer units, or pass the ATB, which is a standardized placement test that measures the student’s ability to complete the course of study. To schedule a testing $VWXGHQWPD\EHSODFHGRQÀQDQFLDODLGGLVPLVVDOIRUQRW DSSRLQWPHQWSOHDVHFRQWDFWWKH$VVHVVPHQW2IÀFHDW PHHWLQJ6$36WXGHQWVZLWKH[WHQXDWLQJFLUFXPVWDQFHVPD\ $7%WHVWVSDVVHGDWDQ\/RV5LRV&RPPXQLW\ ÀOHD)LQDQFLDO$LG$SSHDOWRUHLQVWDWHÀQDQFLDODLG District college campus are acceptable at FLC. Basis for Denial of Financial Aid (OLJLELOLW\IRUÀQDQFLDODVVLVWDQFHLVGHWHUPLQHGE\ Financial Aid may be denied for the following reasons: 'HPRQVWUDWHG ÀQDQFLDO QHHG )LQDQFLDO QHHG H[LVWV Default on Federal Student Loans. ZKHQWKHFRVWRIHGXFDWLRQH[FHHGVDOORIWKHUHVRXUFHV 2ZLQJDUHIXQGRUUHSD\PHQWRQ3HOORU)6(2* available to a student. This need must be determined Failure to meet the satisfactory academic progress each academic year for which a student applies. VWDQGDUGDGRSWHGE\)/&IRUÀQDQFLDODLGUHFLSLHQWV %HLQJD86FLWL]HQDSHUPDQHQWUHVLGHQWRUVWDWXVDV Completion of an AA or AS Degree or 90 or more units, a resident alien with the appropriate visa. ZKLFKHYHU FRPHV ÀUVW XQOHVV D VSHFLDO SHWLWLRQ KDV Registering for Selective Service: Federal and state EHHQDSSURYHGE\WKH)LQDQFLDO$LG2IÀFH ODZV UHTXLUH WKDW PHQ EHWZHHQ WKH DJHV RI )DOVLÀFDWLRQRILQIRUPDWLRQWKDWDIIHFWVWKHGHWHUPLQDWLRQ UHJLVWHUZLWKWKH866HOHFWLYH6HUYLFH6\VWHPWREH of eligibility or aid. HOLJLEOHIRUVFKRRO)LQDQFLDO$LG 86&$SS )DLOXUHWRSURYLGHQHFHVVDU\YHULÀFDWLRQGRFXPHQWDWLRQ HWVHT of income and resources. Making satisfactory academic progress. Congress and WKH)HGHUDO'HSDUWPHQWRI(GXFDWLRQDZDUGIXQGVWR students who are making satisfactory progress toward their educational goal. Satisfactory academic progress LVGHÀQHGE\WKH)HGHUDO'HSDUWPHQWRI(GXFDWLRQDV 150 percent of normal length of time for a student to achieve an educational objective. Therefore, the )LQDQFLDO$LG2IÀFHLVUHTXLUHGWRPRQLWRUDFDGHPLF progress and deny aid to any student who fails to meet satisfactory academic progress as measured by: 1. *UDGH 3RLQW $YHUDJH *3$ PLQLPXP )/& *3$ of a 2.0 2. 0DLQWDLQ 3URJUHVV &RPSOHWH DW OHDVW RI units enrolled: 3. 3URJUHVV3HUFHQWDJH 7RWDO8QLWV:LWK´)µ´13µ “W”, “I”, and “RD” divided by the total units DWWHPSWHG 1RQFRPSOHWLRQ SHUFHQWDJH PXVW EH 25% or less. 4. 7RWDO8QLWV 0D[LPXP7LPH)UDPH 6WXGHQWVPD\ attempt up to 90 units toward the completion of GHJUHHRUFHUWLÀFDWHSURJUDP6WXGHQWVZKRKDYH DWWHPSWHG RUPRUHXQLWVZLOOEHGHQLHGÀQDQFLDO DLG8QLWVWDNHQDWDQRWKHUFROOHJHRUWDNHQZLWKRXW WKHDVVLVWDQFHRIÀQDQFLDODLGDUHFDOFXODWHGLQWR WKHWRWDOQXPEHURIXQLWVDWWHPSWHG8SWRXQLWV of remedial coursework may be deducted from the total units accumulated. Folsom Lake College 2011-2012 45 Policies on the Rights of Individuals Los Rios Community College District inglés, en ninguna de sus funciones o actividades, incluyendo Non-Discrimination Policy el empleo. The Los Rios Community College District, in compliance (O'LVWULWRFXPSOHDGHPiVFRQDTXHOODVOH\HVIHGHUDOHV\ with all pertinent Titles and Sections of the Civil Rights estatales y las normas de la Junta de Directores de los $FWRI WKH(GXFDWLRQDO$PHQGPHQWVRI WKH Colegios Comunitarios de California, las cuales prohíben Rehabilitation Act of 1973, Americans with Disabilities Act, HOKRVWLJDPLHQWRVH[XDO and all other applicable federal, state, and local laws, does not discriminate on the basis of race, color, marital status, 7DOHV SROtWLFDV DQWLGLVFULPLQDWRULDV VH H[WLHQGHQ D WRGDV UHOLJLRQVH[XDOSUHIHUHQFHQDWLRQDORULJLQVH[DJHRYHU ODV IXQFLRQHV \ DFWLYLGDGHV GHO 'LVWULWR 8QLYHUVLWDULR IRUW\KDQGLFDSRU9LHWQDPHUDYHWHUDQVWDWXVSK\VLFDORU Comunitario Los Rios, incluyendo el empleo y la selección mental disability, nor shall any students be discriminated de empleos, programas educativos, servicios, admisiones DJDLQVWIRUFRQYHUVLQJLQDODQJXDJHRWKHUWKDQ(QJOLVK \D\XGDÀQDQFLHUD in any of its functions or activities, including employment, educational programs and services, admissions, and Diversity/Equity Commitment ÀQDQFLDODLG Folsom Lake College believes that the world of tomorrow will be shaped by what happens to the individual and The District further complies with those federal and state the community today. Thus, we seek to enhance, through ODZV DQG WKH UHJXODWLRQV RI WKH %RDUGRI *RYHUQRUV RI learning, the unique potential of every person entering our WKH&DOLIRUQLD&RPPXQLW\&ROOHJHVZKLFKSURKLELWVH[XDO doors and to nourish the quality of life in our community. harassment. In particular, the college strives to create an institutional climate of full enfranchisement and participation for all 6XFK QRQGLVFULPLQDWLRQ SROLFLHV H[WHQG WR DOO RI WKH students, faculty, and staff. This includes addressing the functions and activities of the Los Rios Community College needs of the culturally diverse student population at the District including employment and employment selection, college, ensuring gender equity, and facilitating student HGXFDWLRQDOSURJUDPVVHUYLFHVDGPLVVLRQVDQGÀQDQFLDO and staff understanding of cultural perspectives of others, aid. as well as their own. ,QTXLULHVUHJDUGLQJWKLVSROLF\PD\EHGLUHFWHGWRWKH(TXLW\ Title IX (Sex Discrimination) 2IÀFHUDW *HQGHU(TXLW\&RRUGLQDWRU )ROVRP/DNH&ROOHJHVXSSRUWVDQGFRPSOLHVZLWK7LWOH,; 7LWOH,;6HFWLRQ DQG$'$2IÀFHU9LFH3UHVLGHQWRI (GXFDWLRQ$PHQGPHQWVZKLFKSURKLELWVH[GLVFULPLQDWLRQLQ $GPLQLVWUDWLRQDW WKH/RV5LRV&RPPXQLW\ admission to, or employment in, all its educational programs College District, Assistant Chancellor of Human Resources, DQGDFWLYLWLHV,QTXLULHVFRQFHUQLQJ7LWOH,;PD\EHGLUHFWHG 6SDQRV&RXUW6DFUDPHQWR&$ WRWKHFROOHJH7LWOH,;&RRUGLQDWRU(TXLW\2IÀFHUDW RUWRWKH'LUHFWRURIWKH2IÀFHRI&LYLO5LJKWV86 RUWRWKH'LUHFWRURIWKH2IÀFHRI&LYLO5LJKWV 'HSDUWPHQWRI+HDOWK(GXFDWLRQDQG:HOIDUH:DVKLQJWRQ 86'HSDUWPHQWRI(GXFDWLRQ:DVKLQJWRQ'& D.C. Disability Política Contra La Discriminación Folsom Lake College does not discriminate on the basis (O'LVWULWR8QLYHUVLWDULR&RPXQLWDULR/RV5LRVHQFXPSOLPLHQWR of disability in admission or access to, or treatment or con todos los Títulos y Secciones pertinentes de la Ley employment in, its programs and activities. Section 504 GH'HUHFKRV&LYLOHVGH ODV(QPLHQGDV(GXFDWLYDV of the Rehabilitation Act of 1973, as amended, and the de 1972, la Ley de Rehabilitación de 1973, la Ley de regulations adopted thereunder and the Americans with $PHULFDQRV FRQ ,QFDSDFLGDGHV \ WRGDV ODV GHPiV OH\HV Disabilities Act prohibit such discrimination. aplicables federales, estatales y locales, no discrimina con base en la raza, color, estado civil, religión, preferencia Race, Color, National Origin, or Disability VH[XDOQDFLRQDOLGDGVH[RHGDGGHPD\RUGHFXDUHQWD Folsom Lake College complies with the requirement of Title años, estado de inhabilitado o veterano de la guerra de 9,, RI WKH &LYLO 5LJKWV $FW RI DV DPHQGHG E\ WKH 9LHWQDPLQFDSDFLGDGItVLFDRPHQWDO \QLQJ~QHVWXGLDQWH Americans with Disabilities Act and the regulations adopted VHUiGLVFULPLQDGRSRUFRQYHUVDUHQXQLGLRPDTXHQRVHD WKHUHXQGHU1RSHUVRQVKDOORQWKHJURXQGVRIUDFHFRORU 46 Folsom Lake College 2011-2012 QDWLRQDORULJLQRUGLVDELOLW\EHH[FOXGHGIURPSDUWLFLSDWLRQ 4. Submission to, or rejection of, the conduct by the LQEHGHQLHGWKHEHQHÀWVRIRUEHRWKHUZLVHVXEMHFWHGWR individual is used as the basis for any decision discrimination under any program of Folsom Lake College. DIIHFWLQJ WKH LQGLYLGXDO UHJDUGLQJ EHQHÀWV DQG 5HIHUUDOVPD\EHPDGHWRWKH(TXLW\2IÀFHU services, honors, programs, or activities available at or through the educational institution. Age, Marital Status, Religion % )RU WKH SXUSRVH RI IXUWKHU FODULILFDWLRQ VH[XDO Folsom Lake College does not discriminate on the basis of harassment includes, but is not limited to: DJHPDULWDOVWDWXVUHOLJLRQRUVH[XDORULHQWDWLRQ5HIHUUDOV 1. Making unsolicited written, verbal, visual, or physical PD\EHPDGHWRWKH(TXLW\2IÀFHU FRQWDFWZLWKVH[XDORYHUWRQHV6RPHH[DPSOHVDUH HSLWKHWVGHURJDWRU\FRPPHQWVRUVOXUVRIDVH[XDO Gender Harassment nature; impeding or blocking movements or any 6H[ GLVFULPLQDWLRQ LQ WKH IRUP RI JHQGHU KDUDVVPHQW physical interference with normal work; derogatory consists primarily of repeated comments, jokes, and posters or cartoons. innuendoes directed at persons because of their gender or &RQWLQXLQJWRH[SUHVVVH[XDOLQWHUHVWDIWHUEHLQJ VH[XDORULHQWDWLRQ7KLVEHKDYLRUW\SLFDOO\LVQRWDLPHGDW LQIRUPHGWKDWWKHLQWHUHVWLVXQZHOFRPH 5HFLSURFDO HOLFLWLQJVH[XDOFRRSHUDWLRQEXWOLNHUDFLDOKDUDVVPHQWLW DWWUDFWLRQLVQRWFRQVLGHUHGVH[XDOKDUDVVPHQW contaminates the learning and work environment and has no place at Folsom Lake College. :LWKLQWKHZRUNHQYLURQPHQWHQJDJLQJLQH[SOLFLW RULPSOLFLWFRHUFLYHVH[XDOEHKDYLRUZKLFKFRQWUROV ([DPSOHVRIJHQGHUKDUDVVPHQWLQFOXGHWKHIROORZLQJ LQÁXHQFHV RU DIIHFWV WKH FDUHHU VDODU\ DQGRU Disparaging women’s intellectual abilities and work environment or any other term or condition potential; of employment; within the educational environment, 8VLQJVH[LVWVWDWHPHQWVLQFODVVURRPGLVFXVVLRQV HQJDJLQJ LQ H[SOLFLW RU LPSOLFLW FRHUFLYH VH[XDO Disparaging the lifestyles or behaviors of gays or EHKDYLRUZKLFKFRQWUROVLQÁXHQFHVRUDIIHFWVWKH lesbians. HGXFDWLRQDORSSRUWXQLWLHVJUDGHVDQGRUOHDUQLQJ Sexual Harassment Policy environment of the student. It is the desire of the Los Rios Community College District 4. Making reprisals, threats of reprisal, or implied Board of Trustees to provide for all students and employees threats of reprisal following a negative response an educational environment and workplace free from WR D VH[XDO DGYDQFH )RU H[DPSOH ZLWKLQ VH[XDOKDUDVVPHQW6H[XDOKDUDVVPHQWLQDQ\VLWXDWLRQLV the work environment, either suggesting or unacceptable, and is in violation of state and federal laws actually withholding support for an appointment, and regulations. Where evidence of harassment is found, promotion, or change of assignment; suggesting appropriate corrective action shall be taken. a poor performance report will be prepared, or 'HÀQLWLRQRIVH[XDOKDUDVVPHQW suggesting probation will be failed. Within the $ 6H[XDOKDUDVVPHQWPHDQVXQZHOFRPHVH[XDODGYDQFHV educational environment, either suggesting or UHTXHVWVIRUVH[XDOIDYRUVDQGRWKHUYHUEDOYLVXDORU actually withholding grades earned or deserved; SK\VLFDOFRQGXFWRIDVH[XDOQDWXUHPDGHE\VRPHRQH suggesting a poor performance evaluation from or in the work or educational setting, under any will be prepared; or suggesting a scholarship of the following conditions: recommendation or college application will be denied. 6XEPLVVLRQWRWKHFRQGXFWLVH[SOLFLWO\RULPSOLFLWO\ made a term or a condition of an individual’s 5. Offering favors or educational or employment employment, academic status, or progress. EHQHÀWVVXFKDVJUDGHVRUSURPRWLRQVIDYRUDEOH performance evaluations, favorable assignments, 2. Submission to, or rejection of, the conduct by the favorable duties, or shifts, recommendations, individual is used as the basis of employment or UHFODVVLILFDWLRQ HWF LQ H[FKDQJH IRU VH[XDO an academic decision affecting the individual. favors. 3. The conduct has the purpose or effect of having a negative impact upon the individual’s work Complaint Procedure And Impact or academic performance, or of creating an $Q\LQGLYLGXDOZKREHOLHYHVWKDWKHRUVKHKDVEHHQVH[XDOO\ intimidating, hostile, or offensive work or educational harassed is encouraged to follow the complaint procedures environment. as set forth in the District’s Discrimination Complaint 5HJXODWLRQ57KURXJKRXWWKHSURFHGXUHVWKH&ROOHJH Folsom Lake College 2011-2012 47 3UHVLGHQWDQGWKH&ROOHJH'LVWULFW(TXLW\2IÀFHUVZLOOLQVXUH of the work they do outside their institution with due WKDWFRQÀGHQWLDOO\ZLOOEHPDLQWDLQHGDQGWKDWGXHSURFHVV regard to their paramount responsibilities within it. will be followed with respect to both parties. In the case When considering the interruption or termination of of a student, it shall not affect grades, class selection, or their service, they recognize the effect of their decision other matters pertaining to his or her status as a student. upon the program of the institution and give due notice In a situation where evidence is found that an allegation of their intentions. RIVH[XDOKDUDVVPHQWLVEURXJKWVROHO\IRUWKHSXUSRVHRI YH[DWLRQWKHDSSURSULDWHGLVFLSOLQDU\DFWLRQZLOOEHWDNHQ Statement of Principles 6H[XDOKDUDVVPHQWSROLF\SURFHGXUDOVWHSVDQGIRUPVDUH DYDLODEOHIURPWKHFDPSXV(TXLW\2IÀFHU on Academic Freedom RU9LFH3UHVLGHQWRI$GPLQLVWUDWLRQ (American Association of University Professors) The purpose of this statement is to promote public Faculty Statement of Professional Ethics understanding and support of academic freedom and tenure and agreement upon procedures to ensure 1. Faculty members, guided by a deep conviction of the worth and dignity of the advancement of knowledge, them in colleges and universities. Institutions of higher recognize the special responsibilities placed upon them. education are conducted for the common good and not Their primary responsibility to their subjects is to seek to further the interest of either the individual teacher or and to state the truth as they see it. To this end they the institution as a whole. The common good depends devote their energies to developing and improving their XSRQWKHIUHHVHDUFKIRUWUXWKDQGLWVIUHHH[SRVLWLRQ scholarly and teaching competence. They accept the Academic freedom is essential to these purposes REOLJDWLRQWRH[HUFLVHFULWLFDOVHOIGLVFLSOLQHDQGMXGJPHQW and applies to both teaching and research. Freedom LQ XVLQJ H[WHQGLQJ DQG WUDQVPLWWLQJ NQRZOHGJH 7KH\ in research is fundamental to the advancement of practice intellectual honesty. Although they may follow truth. Academic freedom in its teaching aspect is subsidiary interests, these interests must never seriously fundamental for the protection of the rights of the hamper or compromise their freedom of inquiry. teacher in teaching and the freedom of the student in 2. As teachers, faculty members encourage the free pursuit learning. It carries with it duties correlative with rights. of learning in their students. They hold before them Teachers are entitled to freedom in the classroom in the best scholarly standards of their discipline. They discussing their subject, but they should be careful not demonstrate respect for the student as an individual to introduce into their teaching controversial matter, and adhere to their proper role as intellectual guides which has no relation to their subject. and counselors. They make every reasonable effort College and university teachers are citizens, members to foster honest academic conduct and to assure that RIDOHDUQHGSURIHVVLRQDQGRIÀFHUVRIDQHGXFDWLRQDO WKHLU HYDOXDWLRQ RI VWXGHQWV UHÁHFWV WKHLU WUXH PHULW institution. When they speak or write as citizens, they 7KH\UHVSHFWWKHFRQÀGHQWLDOQDWXUHRIWKHUHODWLRQVKLS should be free from institutional censorship or discipline, between faculty member and student. They avoid any but their special position in the community imposes H[SORLWDWLRQ RI VWXGHQWV IRU WKHLU SULYDWH DGYDQWDJH special obligations. As scholars and educational DQGDFNQRZOHGJHVLJQLÀFDQWDVVLVWDQFHIURPWKHP7KH\ RIÀFHUV WKH\ VKRXOG UHPHPEHU WKDW WKH SXEOLF PD\ protect their academic freedom. judge their profession and their institution by their 3. As colleagues, faculty members have obligations that utterances. Hence they should at all times be accurate, derive from common membership in the community of VKRXOG H[HUFLVH DSSURSULDWH UHVWUDLQW VKRXOG VKRZ scholars. They respect and defend the free inquiry of respect for the opinions of others, and should make WKHLUDVVRFLDWHV,QWKHH[FKDQJHRIFULWLFLVPDQGLGHDV every effort to indicate that they are not speaking for they show due respect for the opinions of others. They the institution. acknowledge their academic debts and strive to be objective in their professional judgment of colleagues. Los Rios Colleges Federation of Teachers They accept their share of faculty responsibilities for the governance of their institution. Statement on Academic Freedom 4. As members of their institution, faculty members seek The LRCCD and LRCFT agree that Academic Freedom above all to be effective teachers and scholars. LV HVVHQWLDO IRU WKH IXOÀOOPHQW RI WKH HGXFDWLRQDO PLVVLRQ Although they observe the stated regulations of the of the District and for the ability of faculty members to institution, provided they do not contravene academic perform their professional duties. In addition, Academic freedom, they maintain their right to criticize and seek Freedom ensures faculty member’s rights and obligations revision. They determine the amount and character of Professional Protection, Autonomy and Responsibility. 48 Folsom Lake College 2011-2012 Professional Protections—faculty members shall be DQGUHIHUIDFXOW\WRWKHLU'HDQRU9LFH3UHVLGHQWRI protected from: Instruction. censorship, restraint, or dismissal in their ability to study, &ODVVLÀHG VWDII VKRXOG QHYHU HQJDJH LQ RU FRQGRQH investigate, present, interpret, or discuss the relevant facts VH[XDOKDUDVVPHQW,QWKHSURIHVVLRQDOFRQWH[WWKHWHUP and ideas within the assigned curriculum and outline. ´VH[XDOKDUDVVPHQWµPD\EHXVHGWRGHVFULEHDZLGH H[WUDQHRXVFRQVLGHUDWLRQVVXFKDVDIDFXOW\PHPEHU·V range of behavior. However, the fundamental element HWKQLFLW\UDFHUHOLJLRQSROLWLFDOEHOLHIVRUDIÀOLDWLRQ LV WKH XQZHOFRPH SHUVRQDO DWWHQWLRQ E\ D FODVVLÀHG VH[XDORULHQWDWLRQRUGLVDELOLW\EHLQJXVHGLQHYDOXDWLRQV member to any person, staff, faculty, or student. of professional performance. &ODVVLÀHG VWDII LQWHUDFWLRQ ZLWK VWXGHQWV DQG IDFXOW\ should always take place in an appropriate setting. Professional Autonomy 6. If a staff member has a concern about a potential Faculty members have the principle right and responsibility breach of this code of ethics, they should consult with to determine the methods of instruction, the planning and their supervisor. presentation of course materials, and the fair and equitable methods of assessment in their assignment in accordance $SSURYHGE\WKH)ROVRP/DNH&ROOHJH&ODVVLÀHG6HQDWH with the approved curriculum and course outline and the April 2009 educational mission of the District in accordance with state laws and regulations. Administrator’s Code of Ethics The administrators of Folsom Lake College shall serve the Professional Commitments and Obligations—all faculty college community by facilitating the process of education members should: through creating and maintaining an environment conducive conduct a classroom environment that is conducive to to teaching, learning, supportive service and student success. student learning, growth, and development; in which $GPLQLVWUDWRUVKDYHDUHVSRQVLELOLW\WRH[HPSOLI\WKHEHVW students are free from discrimination, prejudice, and qualities of the college and to observe the highest standards KDUDVVPHQW DQGLQZKLFKVWXGHQWVDUHIUHHWRH[SUHVV of personal and professional conduct. An administrator at relevant ideas and opinions. Folsom Lake College shall: FOHDUO\GLIIHUHQWLDWHWRVWXGHQWVWKHH[SUHVVLRQRID 1. demonstrate personal integrity, truthfulness, honesty, faculty member’s personal opinions or convictions from DQG IRUWLWXGH LQ PHHWLQJ KLVKHU SURIHVVLRQDO the objective presentation of theory, fact, or ideas. responsibilities; adhere to District procedures for using approved 2. be accountable for serving the interests of the college; materials and resources. 3. accord respect to self and others; 4. strive to give fair and just treatment to all; ,QIRUPHGE\GRFXPHQWVRIWKH$$83/5&)7/5&&' 5. accept intellectual and moral responsibility for his or her actions; 5HDIÀUPHGE\WKH)ROVRP/DNH&ROOHJH$FDGHPLF6HQDWH 6. DVSLUHWRDFKLHYHH[FHOOHQFH on March 8, 2005 7. DYRLGFRQÁLFWRUWKHDSSHDUDQFHRIFRQÁLFWEHWZHHQ personal and institutional interests; &ODVVLÀHG6WDII&RGHRI(WKLFV 8. promote, support and implement diversity; 1. Acknowledging that faculty and student sensitivities 9. HQFRXUDJH FLYLO H[SUHVVLRQ RI RQH·V RZQ YLHZV DQG need to be respected at all times, we must appreciate tolerance for the views of others; and that remarks regarding gender, race, religion, ethnicity, 10. H[HUFLVHIUHHGRPRIFRQVFLHQFHDQGWKHULJKWWRUHIXVH SK\VLFDORUOHDUQLQJGLVDELOLW\RUVH[XDORULHQWDWLRQDUH to engage in actions that violate the ethical principles DSSURSULDWHRQO\LQDQHGXFDWLRQDOFRQWH[W contained in this code or provisions of law. 2. We should always demonstrate both the substance and the appearance of propriety at all times regarding $GRSWHG any gifts or other favors received from student, faculty, administrators, or the community. 6LQFHFODVVLÀHGVWDIIDUHFRQFHUQHGZLWKWKHZHOIDUHRI faculty and students and since either one will at times ZLVKWRVKDUHLQIRUPDWLRQRIDSHUVRQDOQDWXUHFODVVLÀHG VWDIIPXVWIRUDGGLWLRQDOKHOSDQGRULQIRUPDWLRQUHIHU students to the college’s counseling center or Dean of 6WXGHQW 'HYHORSPHQW DQG (QUROOPHQW 0DQDJHPHQW Folsom Lake College 2011-2012 49 Student Rights and Responsibilities Essential Elements of a Use & Release of Student Information (FERPA) High-Quality Education The Los Rios Board of Trustees, in order to meet the )/&HQYLVLRQVDQHGXFDWLRQV\VWHPLQZKLFKVSHFLÀFULJKWV SURYLVLRQVRIWKH)DPLO\(GXFDWLRQDO5LJKWVDQG3ULYDF\$FW REOLJDWLRQVDQGH[SHFWDWLRQVIRUVWXGHQWVDQGHGXFDWLRQ RI DQGWKH(GXFDWLRQ&RGHKDVHVWDEOLVKHGSROLFLHV SURYLGHUVZLOOEHFOHDUO\H[SUHVVHGVRWKDWDOOSDUWLFLSDQWV giving students and parents of dependent students access in the educational process, including families, can understand to certain designated records. A summary of the rights and respond to them. These rights, obligations, and and procedures for access are contained in the Students H[SHFWDWLRQV ZRXOG GHÀQH ZKDW ZH FRQVLGHU WR EH WKH Rights and Responsibilities section of the Los Rios Community HVVHQWLDOHOHPHQWVRIKLJKTXDOLW\WHDFKLQJDQGOHDUQLQJ College District Policy manual. Complete copies of the to which all students and education providers should have $FW (GXFDWLRQ &RGH DQG %RDUG SROLFLHV DUH DYDLODEOH access. Folsom Lake College proposes that these rights, LQWKH$GPLVVLRQVDQG5HFRUGVRIÀFHV7KHSULPDU\ULJKWV REOLJDWLRQVDQGH[SHFWDWLRQVEHGHÀQHGDVIROORZV afforded each student are the right to inspect and review KLVKHUHGXFDWLRQDOUHFRUGVWKHULJKWWRVHHNWRKDYHWKH (YHU\VWXGHQWKDVWKHULJKWWR records amended, and the right to have some control over %H WDXJKW E\ D FRPSHWHQW IXOO\ TXDOLÀHG IDFXOW\ the disclosure of information from the records. member; Receive an education, including intervention when District Regulation 2265 provides for the release, without QHFHVVDU\ WKDW LV VXIÀFLHQW WR DOORZ VXFFHVVIXO student consent, of Student Directory Information, i.e. WUDQVLWLRQLQWRWKHQH[WOHYHOVRIHGXFDWLRQDQGLQWRWKH VWXGHQW·V QDPH GDWH DQG SODFH RI ELUWK PDMRU ÀHOG RI workforce; VWXG\SDUWLFLSDWLRQLQRIÀFLDOO\UHFRJQL]HGDFWLYLWLHVDQG %HSURYLGHGDFFHVVWRKLJKTXDOLW\OHDUQLQJPDWHULDOV sports, weight and height of members of athletic teams, DQG UHVRXUFHV LQFOXGLQJ WH[WERRNV DQG WHFKQRORJLHV dates of attendance, degrees and awards received, and WKDWIRVWHUDQGVXSSRUWWKHNQRZOHGJHDQGVNLOOVVKH most recent previous public or private school attended. In LVH[SHFWHGWROHDUQ addition, federal law provides that representatives of the Receive counseling and academic advising to assist in 86'HSDUWPHQWRI'HIHQVHVKDOOEHSURYLGHGDVWXGHQW·V successful educational progress and planning; name, address, and telephone number for recruitment Be in a clean, modern, and safe environment that is purposes. Students have the right to refuse the release of one conducive to learning; or more such designated categories by submitting a written %H SURYLGHG ZLWK VXIÀFLHQW LQIRUPDWLRQ UHJDUGLQJ VWDWHPHQWWRWKH$GPLVVLRQV 5HFRUGVRIÀFH educational, economic, social, and political options to be able to make informed choices for his or her future; and Student Right-to-Know Program Completion 5HFHLYH LQIRUPDWLRQ DERXW ÀQDQFLDO VXSSRUW IRU In compliance with the Student Right to Know and Campus postsecondary education attendance. Security Act of 1990, completion and transfer rates for students attending Folsom Lake College can be found on (YHU\VWXGHQWZRXOGEHH[SHFWHGWR WKH&DOLIRUQLD&RPPXQLW\&ROOHJH6WDWH&KDQFHOORU·V2IÀFH Attend college regularly and participate in the Website at: www.cccco.edu. educational opportunities that are provided; Commit to the level of effort needed to succeed; and Student Academic Rights Contribute to maintaining a safe, positive college 7KHFODVVURRP LQFOXGLQJODERUDWRULHVÀHOGWULSVLQGHSHQGHQW environment. VWXG\ HWF LV WKH HVVHQWLDO SDUW RI DQ\ FROOHJH ZKHUH The Los Rios Student Rights and Responsibilities document IUHHGRP WR OHDUQ VKRXOG ÁRXULVK 7KH LQVWUXFWRU KDV WKH is based upon the following three fundamental concepts. responsibility for the manner of instruction and the conduct of the classroom. The instructor should not act in any way &ROOHJH VWXGHQWV FLWL]HQV RI WKH 8QLWHG 6WDWHV that denies the rights of students as set forth below: and foreign guests are members of the academic community. 1. In preparing student publications, the editorial staff They have the same rights and freedoms that all and faculty advisors shall be free from censorship citizens have as students, and must comply with federal DQGDGYDQFHFRS\DSSURYDOH[FHSWDVSURYLGHGE\ and state laws and statutes. published district policy, statutes, or campus regulation. Students must also comply with Los Rios Board policies These publications should do the following: and individual college rules and regulations. 50 Folsom Lake College 2011-2012 Adhere to canons of responsible journalism, such will be released only on the written consent of the as avoidance of libel, indecency, undocumented students or as provided by law. allegations, attacks on personal integrity, and the 7. 6WXGHQWV VKDOO KDYH WKH ULJKW WR ÀOH D JULHYDQFH DV techniques of harassment and innuendo. outlined in the procedures of the District Student State on the editorial page that the opinions *ULHYDQFH3ROLF\LQWKHHYHQWRIDQDOOHJHGEUHDFK H[SUHVVHGDUHQRWQHFHVVDULO\WKRVHRIWKHFROOHJH RI WKHLU ULJKWV 7KH GHVLJQDWHG *ULHYDQFH 2IÀFHU or the student body. will hear grievances of students who believe their 2. Students shall have the right to take stands on issues, academic rights have been denied or violated. WKHULJKWWRH[DPLQHDQGGLVFXVVTXHVWLRQVRILQWHUHVWWR them, and the right to support causes by orderly means Academic Integrity and Responsibility - which are in harmony with the regular functioning of Plagiarism and Cheating Policy the institution. What academic integrity and responsibility are: 3. Students shall have the right to hear speakers on Academic integrity and responsibility mean acting honestly, DQ\ VXEMHFW DQG RQFDPSXV UHFRJQL]HG VWXGHQW conscientiously, and most importantly, honorably in all organizations shall have the right to present speakers DFDGHPLF HQGHDYRUV Cheating includes but is not limited to: should consult the college catalog and district policies *LYLQJRUUHFHLYLQJXQDXWKRUL]HGDVVLVWDQFHGXULQJDQ and regulations for further information. H[DPLQDWLRQ 7KHRIÀFHRIWKH9LFH3UHVLGHQWRI6WXGHQW'HYHORSPHQW Fabricating or altering a source of data in a laboratory DQG (QUROOPHQW 0DQDJHPHQW ZLOO EH UHVSRQVLEOH IRU RUH[SHULPHQW maintaining records of reported cases of plagiarism Collaborating with others when collaboration is not DQGRUFKHDWLQJ permitted, or when the contributions of others are not made clear; 6XEPLWWHG E\ 0DWULFXODWLRQ6WXGHQW 6XFFHVV &RPPLWWHH 8VLQJ XQDXWKRUL]HG PDWHULDOV RU DLGV GXULQJ DQ 1RYHPEHU H[DPLQDWLRQ LQFOXGLQJ FDOFXODWRUV GLFWLRQDULHV RU $SSURYHGE\WKH$FDGHPLF6HQDWH'HFHPEHU information accessed via any electronic devices. $SSURYHGE\WKH&ROOHJH3UHVLGHQW'HFHPEHU Acquiring without permission, tests, or other academic material belonging to a member of the college faculty Student Responsibilities or staff. $GPLVVLRQ WR FROOHJH DVVXPHV WKH H[SHFWDWLRQ WKDW WKH student will be a responsible member of the college What the consequences of plagiarism and cheating are: community; will obey the law; comply with the published When plagiarism or cheating is suspected: rules and regulations of the college; respect the rights, A faculty member has the right to choose whether or not privileges, and property of the other members of the college to pursue suspected cases of plagiarism and cheating. community; and not interfere with legitimate college affairs. When reasonable evidence to suspect plagiarism or Students enrolled in a class are responsible for meeting FKHDWLQJH[LVWVWKHIDFXOW\PHPEHUVKRXOGQRWLI\WKH standards of performance and conduct established by student of the concern. the Los Rios Community College District and the instructor. A faculty member may consult with other faculty, the Students are responsible for registering and “adding” pertinent Division Dean, and the college disciplinary and “dropping” classes in a timely fashion, to insure that RIÀFHUZKHQHYDOXDWLQJZKHWKHUSODJLDULVPRUFKHDWLQJ others will have an opportunity to take classes. Students has occurred. are responsible for completing and submitting all class :KHQSODJLDULVPRUFKHDWLQJKDVEHHQFRQÀUPHG DVVLJQPHQWVH[DPLQDWLRQVWHVWVSURMHFWVUHSRUWVHWFE\ In situations where plagiarism or cheating has been scheduled due dates, or face penalties. If any problem confirmed, the faculty member will determine the arises regarding course work or attendance, the student consequences in compliance with Los Rios Community will be held responsible for initiating communication and &ROOHJH'LVWULFW /5&&' %RDUGSROLF\DQGUHJXODWLRQV7KH contact with the instructor. In addition, students will be consequences may include the following options: held responsible for behavior and conduct adverse to the *LYLQJWKHVWXGHQWDZULWWHQZDUQLQJ preservation of order as established by the college and *LYLQJWKHVWXGHQWDQDGGLWLRQDODVVLJQPHQW the instructor. Students are responsible for meeting their *LYLQJWKHVWXGHQWD]HURRU´)µRQWKHDVVLJQPHQW degree requirements as provided in the college catalog. Other appropriate consequences that comply with LRCCD Students also have the responsibility to use information Board policy and regulations, including suspension or WHFKQRORJ\ UHVRXUFHV HIIHFWLYHO\ (DFK XVHU KDV WKH H[SXOVLRQSHU%RDUGUHJXODWLRQVPD\EHSXUVXHGLIWKH responsibility to: faculty member has gone through the appropriate steps, 8VHWKHUHVRXUFHVDSSURSULDWHO\DQGHIÀFLHQWO\ LQFOXGLQJGLVFLSOLQDU\UHIHUUDO 5HJSDUH Respect the freedom and privacy of others; Disciplinary Referral Process: Protect the stability and security of the resources; In situations where plagiarism or cheating has occurred, and the faculty member may notify the student that a 8QGHUVWDQG DQG IXOO\ DELGH E\ HVWDEOLVKHG FROOHJH ´5HIHUUDOIRU6WXGHQW6WDQGDUGVRI&RQGXFW9LRODWLRQµ policies and applicable public laws. ZLOOEHÀOHGWKURXJKWKHFROOHJHGLVFLSOLQDU\RIÀFHU In the case of student conduct which involves an alleged or In the event that a referral is made, students have the proven violation of criminal law, the disciplinary authority right to grieve the action if they believe the action of the college will not be used to duplicate the function of YLRODWHV WKHLU VWXGHQW ULJKWV DV GHÀQHG LQ /RV 5LRV criminal authority. Disciplinary action may be taken if the &RPPXQLW\&ROOHJH'LVWULFWSROLF\DQGUHJXODWLRQV 3 conduct also involves a violation of District or campus policy. 5 +RZHYHUVWXGHQWVVKRXOG be aware that grievances relating to grades are subject WR WKH FRQGLWLRQV RI (GXFDWLRQ &RGH D DQG 52 Folsom Lake College 2011-2012 Student Conduct Standards Procedure A student enrolling in one of the Los Rios colleges may 1. 7KH 'LVFLSOLQDU\ $XWKRULW\ LV QRWLÀHG YHUEDOO\ DQG ULJKWIXOO\H[SHFWWKDWVWXGHQWVIDFXOW\DQGDGPLQLVWUDWRUVZLOO LQ ZULWLQJ ZLWKLQ WKUHH LQVWUXFWLRQDO GD\V RI DQ maintain an environment in which there is freedom to learn. infraction committed by a student. 2. The student is informed by the Disciplinary Authority of Student conduct must comply with federal and state laws, the alleged infraction and of the time and place of the college rules and regulations, and District policies and investigative meeting with the Disciplinary Authority. regulations. Students who violate such rules and regulations 3. The Disciplinary Authority shall interview the student are subject to disciplinary action. for the purpose of discussing the alleged misconduct Disciplinary Offenses and disciplinary action, if any, which should be taken. Any student found to have committed or to have attempted 4. The Disciplinary Authority may initiate disciplinary to commit the following misconduct is subject to appropriate DFWLRQE\QRWLI\LQJWKH&KLHI6WXGHQW6HUYLFHV2IÀFHURU GLVFLSOLQDU\DFWLRQ WKHOLVWRIRIIHQVHVIROORZV designee and serving such notice on the student charged. Willful disobedience, disruptive behavior, profanity or Action vulgarity, or the abuse of the college. Students are subject to the following disciplinary actions: Persistent serious misconduct. 9LRODWLRQ RI FROOHJH UXOHV DQG UHJXODWLRQV LQFOXGLQJ Probation via verbal or written reprimand. those concerning student organizations, the use of 6XVSHQVLRQIURPFODVVHVDFWLYLWLHVIRUDVSHFLÀHGWLPH college facilities, or the time, place, and manner of ([SXOVLRQIURPWKH'LVWULFW SXEOLFH[SUHVVLRQRUGLVWULEXWLRQRIPDWHULDOV Appeal Dishonesty, such as cheating, plagiarism, or knowingly 1. The notice of disciplinary action shall contain a furnishing false information to the college. statement affording the student the right to appeal by 8QDXWKRUL]HGHQWU\WRRUXVHRIWKHIDFLOLWLHV VXEPLWWLQJDOHWWHURIDSSHDOQRWODWHUWKDQVHYHQ Forgery, alteration, or misuse of college documents, days after service of notice. UHFRUGVRULGHQWLÀFDWLRQ 2. ,I QR DSSHDO LV ÀOHG LQ WKH SUHVFULEHG WLPH WKH Obstruction or disruption of teaching, or other disciplinary action shall be referred to the College authorized college activities. 3UHVLGHQWIRUDSSURYDOUHMHFWLRQRUPRGLÀFDWLRQ Theft of or damage to property, or the possession of 3. ,I DQ DSSHDO LV ÀOHG ZLWKLQ WKH SUHVFULEHG WLPH D stolen property belonging to the college, a member of Disciplinary Appeals Committee shall conduct a hearing. the college community, or a campus visitor. 4. The Disciplinary Appeals Committee shall prepare Misconduct which results in injury or death to a student D ZULWWHQ GHFLVLRQ WKDW LQFOXGHV ÀQGLQJV RI IDFWV or college personnel, or which results in damage to conclusion regarding whether the infraction occurred, any real or personal property owned by the District. and a recommendation for disciplinary action within Soliciting or assisting another to do any act which WHQ GD\VRIFRQFOXVLRQRIKHDULQJ would subject a student to discipline. 5. The decision of the Disciplinary Appeals Committee is $VVDXOWRUEDWWHU\VH[XDODVVDXOWDEXVHRUDQ\WKUHDW transmitted to the President for approval, rejection, or of force or violence directed toward any member of PRGLÀFDWLRQ7KHGHFLVLRQRIWKH3UHVLGHQWLVÀQDO the college community. 8VHSRVVHVVLRQGLVWULEXWLRQRUEHLQJXQGHUWKHLQÁXHQFH Expulsion of alcoholic beverages, narcotics, or dangerous drugs. ,I WKH 3UHVLGHQW UHFRPPHQGV H[SXOVLRQ WKH GHFLVLRQ LV .QRZLQJSRVVHVVLRQRIRUXVHRIH[SORVLYHVGDQJHURXV referred to the District Chancellor for approval, rejection, chemicals, or deadly weapons on college property. RU PRGLÀFDWLRQ 7KH %RDUG RI 7UXVWHHV PXVW DSSURYH D Without permission, accessing, altering, damaging, UHFRPPHQGDWLRQIRUH[SXOVLRQ7KHGHFLVLRQRIWKH%RDUG copying, deleting, destroying, or otherwise using RI7UXVWHHVLVÀQDO any data, computer program, computer system, or computer network. )RUIXUWKHUDVVLVWDQFHDQGRULQIRUPDWLRQ 6PRNLQJLQDQ\SRVWHGQRVPRNLQJDUHD Student Disciplinary Authority: Discipline Process 'LVWULFW3ROLFH An instructor may remove a student from the class and the QH[WPHHWLQJIRUYLRODWLRQRIWKH6WDQGDUGVRI&RQGXFW Folsom Lake College 2011-2012 53 Student Grievance Policy Process :ULWWHQDSSHDOVWDWLQJVSHFLÀFJURXQGVIRUDSSHDO It is the intent of the Los Rios Board of Trustees to provide VHH5 5HYLHZRIUHFRUGRQO\ prompt and equitable means for resolving student grievances. Decision :LWKLQ WHQ GD\V RI UHFHLSW RI DSSHDO GRFXPHQWV'HFLVLRQLVÀQDO $ VWXGHQW PD\ ÀOH D JULHYDQFH RU JULHYH DQ DFWLRQ RU decision of the District, or one of its colleges, when the &RPSOHWHSROLFLHVDQGUHJXODWLRQVRQWKH6WXGHQW*ULHYDQFH VWXGHQW·VVWDWXVDQGRUULJKWVDVSHU'LVWULFWSROLFLHVDQG procedure are available on the Los Rios Community College regulations have been adversely affected. District website at www.losrios.edu *ULHYDQFHVUHODWLQJWRJUDGHVDUHVXEMHFWWR(GXFDWLRQ&RGH Alcohol and Drug Policy 6HFWLRQ D ZKLFKUHDGV The abuse of illicit drugs and alcohol disrupts classes, “When grades are given for any course of instruction compromises one’s physical and mental health, subjects one taught in a community college district, the grade given WRFULPLQDOSHQDOWLHVDQGLPSDLUVRQH·VDELOLW\WREHQHÀWIURP to each student shall be the grade determined by WKHOHDUQLQJH[SHULHQFH:HWKHUHIRUHDVN\RXWRDFWLYHO\ the instructor of the course and the determination of VXSSRUWDGUXJDQGDOFRKROIUHHOHDUQLQJHQYLURQPHQWE\ the student’s grade by the instructor, in the absence knowing and making others aware of college policies and of mistake, fraud, bad faith, or incompetency, shall the substantial health and legal consequences of abuse. If EHÀQDOµ you or someone you know is having problems with alcohol or GUXJVFRQWDFWRQHRIWKHDJHQFLHVOLVWHGXQGHU´&RQÀGHQWLDO Steps to Filing Grievance: Assistance.” 6WXGHQW*ULHYDQFH2IÀFHU 'LVWULFW3ROLF\ Level 1 Los Rios Community College District policy 2443 states Informal Grievance Resolution (Mandatory) that the District “is committed to maintaining a GUXJDQG Timeline: Within ten days of alleged act. DOFRKROIUHHZRUNSODFHLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWV With Whom: Student shall meet with staff member involved RIWKH86'UXJ)UHH:RUNSODFH$FWRI DQGDGUXJ OR with staff member’s immediate supervisor. DQG DOFRKROIUHH FROOHJH HQYLURQPHQW IRU VWXGHQWV DQG Purpose 7RDWWHPSWLQIRUPDOUHVROXWLRQ$1'LIQRUHVROXWLRQ HPSOR\HHVLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH'UXJ LVUHDFKHGZLWKLQWHQ GD\VVWXGHQWPD\SURFHHGWR Free Schools and Community Act Amendment of 1989.” formal grievance process. Legal Sanctions Level 2 The LRCCD Standards of Student Conduct prohibit the Formal Grievance Process (Grievability) use, sale, or possession on campus of, or presence on Timeline :LWKLQÀYH GD\VRIFRPSOHWLRQRIWKHLQIRUPDO FDPSXVXQGHUWKHLQÁXHQFHRIDQ\FRQWUROOHGVXEVWDQFH SURFHVV$1'QRWODWHUWKDQWZHQW\ÀYH GD\VIURPGDWH Controlled substances include cocaine, marijuana, LSD, of alleged wrongful act. heroin, methadone, mescaline, peyote, and methaqualone, With Whom )RUPDOJULHYDQFHIRUP FRPSOHWHG WREHÀOHG among others. ZLWK6WXGHQW*ULHYDQFH2IÀFHU Purpose 7R GHWHUPLQH LI SUREOHP LV JULHYDEOH $1' LI If you abuse drugs or alcohol on campus, or appear on grievable, a hearing will be scheduled. FDPSXV RU DW D FROOHJHVSRQVRUHG IXQFWLRQ XQGHU WKH LQÁXHQFH RI GUXJV RU DOFRKRO \RX FDQ EH VXVSHQGHG Level 3 H[SHOOHGDQGRUFULPLQDOO\SURVHFXWHG7KHSHQDOWLHVIRU Formal Grievance Process (Hearing) the more common offenses are: Timeline :LWKLQWHQ GD\VRIDSSRLQWPHQWRID+HDULQJ 3RVVHVVLRQRUXVHRIDOFRKRO \HDULQMDLODQGRUÀQH 2IÀFHUDKHDULQJZLOOEHVFKHGXOHG 3RVVHVVLRQRIPDULMXDQD FULPLQDOFLWDWLRQDQGÀQH With Whom $OOSDUWLHVDQG+HDULQJ2IÀFHU Possession of cocaine: imprisonment in a state prison Purpose: To determine the merit of the grievance. Sales of any illegal drug: imprisonment in a state Decision :LWKLQWHQ GD\VRIFRPSOHWLRQRIKHDULQJ prison Possession or use of alcohol by a minor: one year in Level 4 MDLODQGRUÀQH Formal Grievance Process (Appeal If you are a student employee, you may be Timeline :LWKLQ ILYH GD\V RI +HDULQJ 2IILFHU·V terminated decisions. With Whom &KLHI6WXGHQW6HUYLFHV2IÀFHU 54 Folsom Lake College 2011-2012 Impaired judgment leading to accidents, unwanted All downloading and saving must be to a 3µÁRSS\]LS SUHJQDQF\ VH[XDOO\ WUDQVPLWWHG GLVHDVHV YLROHQW GLVNÁDVKGULYH86%RU&' EHKDYLRUDQGÀQDQFLDOSUREOHPV Any drug used intravenously can spread AIDS or Software may not be copied from the computers or network hepatitis. drives. Installing any software or games on campus computers is &RQÀGHQWLDO$VVLVWDQFH prohibited. 2Q&DPSXV&RXQVHOLQJ ...... )/& 3OD\LQJJDPHVRQFDPSXVFRPSXWHUVLVSURKLELWHGH[FHSW ('& for class assignments. Sacramento Mental Health Center.... Directions must be followed when given by any lab assistant or (O'RUDGR&RXQW\0HQWDO+HDOWK ...... LQVWUXFWRUFRQFHUQLQJHTXLSPHQWIDFLOLWLHVRUVWXGHQWFRQGXFW Alcoholics Anonymous ... 6DFUDPHQWR 3ODFHUYLOOH Internet Use Policy 1DUFRWLFV$QRQ\PRXV ...... Internet access is limited to classroom assignments only. Cocaine Anonymous ...... The rules and restrictions concerning Internet use must be Dept. of Alcohol & Drug Programs .. followed where applicable. The following activities are Alcohol & Drug Bureau ...... not allowed: Transmitting unsolicited information, which contains Smoking Policy SURIDQHODQJXDJHRUSDQGHUVWRELJRWU\VH[LVPRU It is Los Rios Community College District policy that no other forms of discrimination. smoking is permitted in buildings or facilities, including 8VLQJWKH,QWHUQHWWRJDLQXQDXWKRUL]HGDFFHVVWRDQ\ breezeways, or within 30 feet of a building’s entrance, computer. H[LW RSHUDEOH ZLQGRZV RU DLU YHQWV 5HJXODWLRQ (QJDJLQJ LQ SHUVRQDO DWWDFNV ZULWLQJ EXOO\LQJ 6LJQDJH LV SRVWHG WKURXJKRXW FDPSXV WKDW LGHQWLÀHV 1R intimidating, threatening, or harassing entries. Smoking areas. The college may designate certain other 0DNLQJWKUHDWV GLUHFWHGWRZDUGVRWKHUVRU\RXUVHOI SRSXODWHGDUHDVDVVPRNHIUHH)ROVRP/DNH&ROOHJHDLPV ZLWKRXWH[SHFWLQJWKHUHFLSLHQWVRIWKRVHWKUHDWVWKH WRSURWHFWWKHULJKWVDQGZHOOEHLQJRIDOOPHPEHUVZLWKLQ college, and the police to consider them real. its community. This policy is to be enforced through common Transmitting information that contains obscene, courtesy. Please remain considerate of each other because indecent, lewd, or lascivious material or other material we all “Share the Air!” WKDW H[SOLFLWO\ RU LPSOLFLWO\ UHIHUV WR VH[XDO FRQGXFW This includes displaying such material where other Computer Use Policy individuals could potentially view it. (TXLSPHQWLQWKHODEVKRXOGEHXVHGIRUclass assignments Inappropriate mass mailing, which includes multiple only. mailing to newsgroups, mailing lists, or individuals, e.g. &RPSXWHUVDUHDYDLODEOHRQDÀUVWFRPHÀUVWVHUYHGEDVLV ´VSDPPLQJµ´ÁRRGLQJµRU´ERPELQJµ )RRGDQGRUGULQNV LQFOXGLQJZDWHUERWWOHV DUHQRWDOORZHG Folsom Lake College 2011-2012 55 Attempts by students to obtain, manipulate, delete or FKDQJHWKHFRQWHQWVRIDQRWKHUXVHU·VÀOHVSDVVZRUGVHWF are regarded as infractions of the January 1980 California &RPSXWHU&ULPH3HQDO&RGH 6HQDWH%LOO1R $WWHPSWV to “break” the operating system constitute a felony under this law. Illegal Distribution of Copyrighted Materials Folsom Lake College students are prohibited from using the /RV5LRV&RPPXQLW\&ROOHJH'LVWULFW /5&&' LQIRUPDWLRQ network to illegally download or share music, video, and all other copyrighted intellectual property. The colleges of WKH/5&&'LQFOXGLQJWKLVRQHVXSSRUWWKH+LJKHU(GXFDWLRQ Opportunity Act and Digital Millennium Copyright Act, including efforts to eliminate the illegal distribution of FRS\ULJKWHGPDWHULDO8QGHUWKHODZFROOHJHDGPLQLVWUDWRUV may be obligated to provide copyright holders with information about users of the LRCCD information network who have violated the law. %HDZDUHWKDWLOOHJDOIRUPVRIGRZQORDGLQJDQGÀOHVKDULQJ as well as the unauthorized distribution of copyrighted materials are violations of the law and may subject you to academic sanctions from the college as well as criminal and civil penalties, including a lawsuit against you by WKH 5HFRUGLQJ ,QGXVWU\ $VVRFLDWLRQ RI $PHULFD 5,$$ Learn more at www.campusdownloading.com In addition WREHLQJLOOHJDOÀOHVKDULQJGUDLQVWKH/5&&'QHWZRUN·V bandwidth, which slows computer connections for students and employees who are using the network for legitimate academic purposes and ultimately costs the college money. LRCCD and its colleges have developed policies and consequences to ensure that students properly use the information LRCCD network and respect music and other forms of intellectual property as well as conduct responsible use of the Internet. Review these policies at www.losrios. HGXOHJDO3ROLFLHV33KWP DQG HVSHFLDOO\ ZZZORVULRVHGXOHJDO3ROLFLHV33KWP7KHUH are plenty of easy, affordable ways to get music online legally. To protect their intellectual property, companies have licensed hundreds of digital partners that offer a range of legal downloading options, including download DQGVXEVFULSWLRQVHUYLFHVOHJLWLPDWHSHHUWRSHHUVHUYLFHV YLGHRRQGHPDQGSRGFDVWVDQG&'NLRVNV)RUDOLVWRI sources that offer legal downloading sites, access www. riaa.com 56 Folsom Lake College 2011-2012 Campus Safety and Security &DPSXV7UDIÀF5HJXODWLRQV may be. All of us can further reduce risks by thinking about 7KH FROOHJH KDV SRVWHG ERWK PD[LPXP VSHHG OLPLWV DQG personal safety and taking common sense precautions. designated parking areas. It is the responsibility of all VWXGHQWVVWDIIDQGYLVLWRUVWRREVHUYHDQGKRQRUWKHVHWUDIÀF Safety programs at Folsom Lake College are under the regulations. All violators will be cited. GLUHFWLRQRIWKH9LFH3UHVLGHQWRI$GPLQLVWUDWLRQ7KHFROOHJH takes a proactive approach to campus safety that is best The issuance of a semester parking permit or daily viewed as education, prevention, and the ability to respond parking ticket does not guarantee parking availability. The to questionable events. UHVSRQVLELOLW\RIÀQGLQJDOHJDOSDUNLQJVSDFHUHVWVZLWKWKH motor vehicle operator. Lack of parking spaces on campus Safety Education is not considered a valid reason for violation of Los Rios The key to crime prevention is an awareness gained through SDUNLQJUHJXODWLRQVDQG&DOLIRUQLD9HKLFOH&RGHSURYLVLRQV education. At Folsom Lake College, the District Police 9HKLFOHVGLVSOD\LQJDYDOLGSDUNLQJSHUPLWPD\RQO\SDUN department, staff, faculty, and students work together and in spaces designated for student parking. A valid parking take responsibility for their own safety and are ready to permit or valid daily parking ticket is required from 7:00am help others in time of need. to 11:00pm Monday through Thursday, and 7:00am to 5:00pm on Friday whenever classes are in session. Parking The vast majority of incidents on college campuses can regulations will be enforced 24 hours a day, seven days be avoided if the college population recognizes they are SHUZHHN /5&&' potential victims and take basic precautions, such as using the “buddy system” when walking at night, locking car doors, Safety Awareness and Crime Prevention and not leaving valuables unattended. The District Police Safety at Folsom Lake College is everybody’s business. department is available to meet with groups or individuals Students, staff, and faculty are partners with the college in WRGLVFXVVDQWLFULPHWDFWLFVRUDQ\DQWLVRFLDODFWLYLWLHV creating an atmosphere that is safe and encourages learning. Folsom Lake College encourages the reporting of all crimes, Folsom Lake College is a diverse community within a even minor crimes, and any suspicious activity. The District community. At the same time, the college is very much a Police department would rather have a hundred unfounded SDUWRIWKHJUHDWHU6DFUDPHQWRPHWURSROLWDQDUHDDQG(O calls of suspicious activities than miss one call when a crime Dorado County. is occurring. We need to know about crimes that occur. If we are not informed of a crime, we cannot advise and help The college is a community center for lifelong learning students, faculty, and staff. through education, cultural, and recreational programs. Many community members visit and use the services the Crimes occurring on campus should be reported immediately college offers seven days a week. The college strives to WRD'LVWULFW3ROLFHRIÀFHU:KHQDSSURSULDWH'LVWULFW3ROLFH be accessible to the community and welcomes the use of will contact the local law enforcement agency for assistance its facilities. DQGRUWRFRQGXFWDQLQYHVWLJDWLRQ$'LVWULFW3ROLFHUHSRUW will be made; a copy of the report may be made available 1RFRPPXQLW\RIFRXUVHFDQEHWRWDOO\ULVNIUHHLQWRGD\·V WRWKHUHSRUWLQJLQGLYLGXDOSURYLGHGKHVKHLVWKHYLFWLP society. Folsom Lake College and its centers strongly RIWKHFULPH2IÀFHUVPD\EHFRQWDFWHGE\WHOHSKRQHRU believe they have a major role in providing a safe learning E\FRPLQJWRWKH3ROLFHRIÀFHORFDWHGDWWKHPDLQ)ROVRP environment, but, also, is realistic enough to recognize that FDPSXVLQSRUWDEOHEXLOGLQJ)/3 GXULQJFRQVWUXFWLRQ RU students, staff, and faculty must come together in a strong DWWKH(O'RUDGR&HQWHULQURRP%. partnership and use common sense precautions to reduce WKH RSSRUWXQLW\ IRU FULPLQDODQWLVRFLDO DFWLYLWLHV 7KHIWV DISTRICT POLICE: (916) 558-2221 assaults, and other crimes happen at Folsom Lake College just as at many other college campuses. Prevention The college actively supports crime prevention through a 7RUHGXFHWKHSRVVLELOLW\WKDWDQ\VWXGHQWPD\EHH[SRVHG number of programs. These include: to potential hazards, Folsom Lake College has taken many Emergency automobile assistance. While not steps, described herein, to reduce whatever risks there PHFKDQLFV 'LVWULFW 3ROLFH RIÀFHUV DUH HTXLSSHG DQG Folsom Lake College 2011-2012 57 WUDLQHGWRVWDUWFDUVZLWKGHDGEDWWHULHVRUXQORFNQRQ Reporting Sexual Assault HOHFWULFFDUGRRUV3URSHULGHQWLÀFDWLRQLVUHTXLUHGIRU 1.0 Procedure the performance of these services. ,WLVWKHREMHFWLYHRIWKHFROOHJHLQDFFRUGZLWK(& Firearms. Firearms are not permitted on campus that students, faculty, and staff who are victims of H[FHSW IRU SURIHVVLRQDO ODZ HQIRUFHPHQW RIÀFHUV VH[XDO DVVDXOW FRPPLWWHG DW RU XSRQ WKH JURXQGV RI 3HUVRQV ZLWK ÀUHDUPV RQ FDPSXV ZLOO EH VXEMHFW WR RU XSRQ RIIFDPSXV JURXQGV RU IDFLOLWLHV PDLQWDLQHG GLVFLSOLQDU\DFWLRQ /5&&'5HJXODWLRQ by the college shall receive information and referral Alcohol. &RQVXPSWLRQRIRUEHLQJXQGHUWKHLQÁXHQFH to treatment. This information shall be provided with of alcohol while on campus is strictly prohibited. sensitivity and in consideration of the personal needs 9LRODWRUVDUHVXEMHFWWRVXVSHQVLRQH[SXOVLRQDQGRU of the victim. FULPLQDOSURVHFXWLRQ /5&&'3ROLF\ Emergency Telephones. Outdoor emergency 1RWLÀFDWLRQ telephones have been installed at strategic locations 2.1 Any student, faculty, or staff member who is a victim of throughout the Folsom Lake College main campus. VH[XDODVVDXOWDWDFROOHJHIDFLOLW\DVGHÀQHGDERYH These phones, when accessed, will automatically should notify the District Police Department. With the connect the caller to the District Police department. consent of the victim, the District Police Department will Illegal Drugs. Folsom Lake College is committed to QRWLI\WKH'HDQRI6WXGHQW'HYHORSPHQWDQG(QUROOPHQW EHLQJDGUXJIUHHFDPSXV9LRODWRUVZLOOEHVXEMHFWWR Management. disciplinary procedures. The use, sale, or possession on FDPSXVRIRUSUHVHQFHRQFDPSXVXQGHUWKHLQÁXHQFH 3.0 Legal reporting of, any controlled substance is strictly prohibited. 3.1 Pursuant to legal requirements the District Police 9LRODWRUVDUHVXEMHFWWRVXVSHQVLRQH[SXOVLRQDQGRU Department will notify the appropriate local law FULPLQDOSURVHFXWLRQ /5&&'3ROLF\DQG HQIRUFHPHQWDJHQF\RIWKHUHSRUWHGVH[XDODVVDXOW Children on Campus. It is not appropriate for children 3.2 In accord with the Campus Crime Awareness and Security to attend classes with their parents. All children Act of 1990, the college, on an annual basis, shall notify on campus must be under the direct supervision VWXGHQWVDQGHPSOR\HHVRIVWDWLVWLFVFRQFHUQLQJVSHFLÀF of a parent, guardian, or other authorized adult. W\SHVRIFULPHLQFOXGLQJVH[XDODVVDXOW7KLVQRWLFHVKDOO 8QDWWHQGHGRUGLVUXSWLYHFKLOGUHQZLOOEHUHSRUWHGWR EHPDGHWKURXJKDSSURSULDWHSXEOLFDWLRQVPDLOLQJV the proper authorities. Parking. 5HPHPEHUWKDW)ROVRP/DNH&ROOHJHDQG(O 3.3 In case of violent crimes considered to be a threat to Dorado Center follow the same parking regulations other students and employees, the college shall make as the City of Folsom and the Counties of Sacramento WLPHO\ UHSRUWV UHVSHFWLQJ WKH FRQÀGHQWLDOLW\ RI WKH DQG(O 'RUDGR 9HKLFOHV QRW KDYLQJDYDOLG SDUNLQJ victim, to the college community in a manner that will decal or daily ticket properly displayed will be issued aid in the prevention of similar occurrences. DSDUNLQJFLWDWLRQ7KHUHLVDÀQHIRUSDUNLQJ LQGHVLJQDWHGGLVDEOHGVSDFHV LQFOXGLQJKDWFKPDUNV 4.0 Campus services and resources QH[W WR GLVDEOHG VSDFHV ZLWKRXW D VWDWHLVVXHG 8SRQ QRWLILFDWLRQ RI D VH[XDO DVVDXOW WKH District disabled decal or plate. Police Department will make available to the victim a Students attending Rancho Cordova Center are description of campus resources and services available reminded that parking is not allowed in spaces WRWKHYLFWLPDVZHOODVDSSURSULDWHRIIFDPSXVVHUYLFHV GHVLJQDWHGIRURWKHUWHQDQWVLQWKHEXVLQHVVFRPSOH[ This listing of resources and services shall be updated between 8:00am and 5:00pm. This is enforced through each September 1 or more frequently as required. common courtesy and security patrol. 4.2 The listing of resources and services shall be available Sexual Harassment. 6H[XDO KDUDVVPHQW LQ DQ\ through the District Police Department and the situation is unacceptable and is in violation of state Counseling Department. and federal laws and regulations. Corrective action ZLOOEHWDNHQZKHUHHYLGHQFHRIVH[XDOKDUDVVPHQWLV $ YLFWLP RI VH[XDO DVVDXOW VKDOO EH SURYLGHG ZLWK IRXQG /5&&'3ROLF\ LQIRUPDWLRQDERXWWKHH[LVWHQFHRIDWOHDVWWKHIROORZLQJ 'LVWULFW3ROLFHRIÀFHUVDUHDOVRDYDLODEOHWRDGGUHVVFODVVHV options: criminal prosecutions, civil prosecutions, the about prevention of crime. disciplinary process through the college, the availability of mediation, academic assistance alternatives, and mental health counseling. 58 Folsom Lake College 2011-2012 5.0 Case management $ YLFWLP RI VH[XDO DVVDXOW VKDOO EH NHSW LQIRUPHG E\ WKH &ROOHJH 3UHVLGHQWGHVLJQHH RI WKH VWDWXV RI DQG GLVSRVLWLRQ RI DQ\ 'LVWULFW&ROOHJH GLVFLSOLQDU\ SURFHHGLQJVLQFRQQHFWLRQZLWKWKHVH[XDODVVDXOW 5.2 The Counseling Department shall assist, upon request, WKHYLFWLPRIVH[XDODVVDXOWLQGHDOLQJZLWKDFDGHPLF GLIÀFXOWLHVWKDWPD\DULVHEHFDXVHRIWKHYLFWLPL]DWLRQ and its impact. &RQÀGHQWLDOLW\DQGUHTXHVWVIRULQIRUPDWLRQ 7KHLGHQWLW\RIDYLFWLPRIVH[XDODVVDXOWVKDOOUHPDLQ confidential unless otherwise prescribed by law. 5HTXHVWVIRULQIRUPDWLRQUHJDUGLQJWKHVH[XDODVVDXOW from the press, concerned students, and parents will be handled by the college Public Information Services 2IÀFH LQ DFFRUG ZLWK WKH IROORZLQJ UHJXODWLRQV WKH )DPLO\(GXFDWLRQDO5LJKWVDQG3ULYDF\$FWDSSOLFDEOH &DOLIRUQLD(GXFDWLRQDQG$GPLQLVWUDWLYH&RGHVHFWLRQV and Los Rios Community College District Policy. 7.0 Dissemination of Procedure 7.1 These procedures shall be published in all student, faculty, and staff handbooks and shall be given to any VWXGHQWRUHPSOR\HHZKRLVWKHYLFWLPRIVH[XDODVVDXOW Students who are required to comply with PC 290 must contact the District Police immediately. (916) 558-2221, Portable Building FLP-2 on the main Folsom campus (during construction). Folsom Lake College 2011-2012 59 The Jeanne Clery Disclosure (2000-2002) &ULPLQDODFWLYLWLHVLIDQ\DWRIIFDPSXVORFDWLRQVDUHUHTXLUHG of Campus Security Policy and to be monitored and recorded through local police agencies. 7KLV LV UHTXLUHG XQGHU 86& I 7KH -HDQQH &OHU\ Crime Statistics Act Disclosure of Campus Security Policy and Campus Crime This information is updated annually and is available to all Statistics Act. students, employees, and applicants. Additional information is available from District Police personnel. Any serious crime ,QFDVHVRIFULPLQDODFWLYLWLHVDWRIIFDPSXVORFDWLRQVWKH involving potential bodily harm will be reported promptly local agency will create a police report and case number to staff and students. for each incident, pursuant to their own procedures for UHFRUGLQJFULPLQDOLQFLGHQWUHSRUWVDQGXVLQJ)%,8QLIRUP In 1998, the federal government passed “The Jeanne Clery &ULPH5HSRUWLQJVWDQGDUGV/53')/&VKDOOUHTXHVWWKHVH Disclosure of Campus Security Policy and Campus Crime statistics under Clery Act offense categories, for each Statistics Act”, formerly “The Student Right to Know Act” of ORFDWLRQWKDWPHHWVWKHFULWHULDIRURIIFDPSXVSURSHUW\ 1990. Folsom Lake College must annually distribute statistics on the reported occurrences of the following offenses: $OOVWDWLVWLFVDUHDOVRDYDLODEOHLQWKH&ROOHJH3ROLFH2IÀFH. Murder 6H[ 2IIHQVHV IRUFLEOH UDSH VRGRP\ UDSH ZLWK D IRUHLJQREMHFWDQGIRUFLEOHIRQGOLQJ VH[XDOEDWWHU\ 6H[2IIHQVHVQRQIRUFLEOH LQFHVWDQGVWDWXWRU\UDSH Robbery Aggravated Assault Burglary 0RWRU9HKLFOH7KHIW Manslaughter Arson Statistics involving the aforementioned offenses or others involving bodily injury where there is evidence of victim selection based upon actual or perceived UDFHJHQGHUUHOLJLRQVH[XDORULHQWDWLRQHWKQLFLW\RU GLVDELOLW\ KDWHFULPHV Arrests or persons referred for campus disciplinary action for liquor law violations, drug abuse violations and weapons possession. These offenses must be reported according to their occurrence in the following location categories: &DPSXVFDPSXVSURSHUW\ 1RQFDPSXVEXLOGLQJRUSURSHUW\RIÀFLDOO\UHFRJQL]HG by Los Rios Community College District Public Property, reasonably contiguous to the campus 7KHVHVWDWLVWLFVUHÁHFWWKHQXPEHURIFULPHUHSRUWVRFFXUULQJLQ the above listed areas from both District Police and other Los 5LRV&RPPXQLW\&ROOHJH'LVWULFW)ROVRP/DNH&ROOHJH&DPSXV 6HFXULW\$XWKRULWLHV RWKHUWKDQDistrict3ROLFH IRUWKHRIIHQVH categories under The Clery Act of 1998. Although every effort has been made to avoid duplication between District Police DQGRWKHURIÀFLDOUHSRUWVLQGLYLGXDOLQFLGHQWVPD\EHUHSRUWHG more than once within the same calendar year. Furthermore, VRPHLQFLGHQWVUHSRUWHGWRDQGE\RWKHU&ROOHJH2IÀFLDOVPD\ not actually meet the criteria and guidelines set forth by The Clery Act for mandated reporting purposes. 60 Folsom Lake College 2011-2012 FOLSOM LAKE COLLEGE PUBLIC NON-HATE CRIME ON-CAMPUS NON-CAMPUS PROPERTY CRIMINAL OFFENSES 2007 2008 2009 2007 2008 2009 2007 2008 2009 Murder/Non-negligent manslaughter 0 0 0 0 0 0 0 0 0 Negligent manslaughter 0 0 0 0 0 0 0 0 0 Sex offenses - Forcible 0 0 0 0 0 0 0 0 0 Sex offenses - Non-forcible (Include only incest and statutory rape) 0 0 0 0 0 0 0 0 0 Robbery 0 0 0 0 0 0 0 0 0 Aggravated assault 0 0 0 0 0 1 0 0 0 Burglary 0 1 0 0 0 0 0 0 0 Motor vehicle theft 0 0 0 1 0 1 0 0 0 Arson 0 0 0 0 0 0 0 0 0 ARRESTS 2007 2008 2009 2007 2008 2009 2007 2008 2009 Illegal weapons possession 0 0 0 0 0 0 0 0 0 Drug law violations 0 0 3 0 0 0 1 0 0 Liquor law violations 1 0 0 0 0 0 0 0 0 DISCIPLINARY ACTION/JUDICIAL REFERRALS 2007 2008 2009 2007 2008 2009 2007 2008 2009 Illegal weapons possession 0 0 0 0 0 0 0 0 0 Drug law violations 0 2 0 0 0 0 0 0 0 Liquor law violations 0 0 0 0 0 0 1 0 0 FOLSOM LAKE COLLEGE SEXUAL RACE GENDER RELIGION ETHNICITY DISABILITY HATE CRIMES ORIENTATION ON-CAMPUS 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 Murder/Non-negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Forcible 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Non-forcible (Include only incest 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 and statutory rape) Robbery 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Aggravated assault 000000000000000000 Burglary 0 0 0 00 0 00 0 00 0 00 0 00 0 Motor vehicle theft 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Arson 0 0 0 00 0 00 0 00 0 00 0 00 0 Any other crime involving bodily injury 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Larceny-theft 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Simple assault 000000000000000000 Intimidation 000000000000 000 000 Vandalism 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 NON-CAMPUS 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 Murder/Non-negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Forcible 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Non-forcible (Include only incest 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 and statutory rape) Robbery 0 0 0 00 0 00 0 00 0 00 0 00 0 Aggravated assault 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Burglary 000000000000 000 000 Motor vehicle theft 000000000000000000 Arson 000000000000 000 000 Any other crime involving bodily injury 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Larceny-theft 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Simple assault 000000000000000000 Intimidation 000000000000 000 000 Vandalism 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 PUBLIC PROPERTY 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 2007 2008 2009 Murder/Non-negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Negligent manslaughter 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Forcible 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sex offenses - Non-forcible (Include only incest 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 and statutory rape) Robbery 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Aggravated assault 000000000000000000 Burglary 000000000000 000 000 Motor vehicle theft 000000000000000000 Arson 000000000000 000 000 Any other crime involving bodily injury 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Larceny-theft 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Simple assault 000000000000000000 Intimidation 0 0 0 00 0 00 0 00 0 00 0 00 0 Vandalism 0 0 0 00 0 00 0 00 0 00 0 00 0 Folsom Lake College 2011-2012 61 Course Numbering, Prerequisites, & More Course Numbering System Corequisite: A course that a student is required to take Folsom Lake College has a standardized course numbering WKHVDPHVHPHVWHUDVDQRWKHUFRXUVH)RUH[DPSOHWKH system described below. The numbers are designed to Basic Anatomy and Physiology Lab must be taken along provide students with general information regarding the with Basic Anatomy and Physiology. focus and intent of courses. Advisory on recommended preparation: A condition of Course Type enrollment when a student is advised, but not required, to Number meet before or in conjunction with enrollment in a course 1-99 Credit courses that are considered developmental or educational program. Students who believe they have or basic skills and are not acceptable for the VDWLVÀHGWKHDGYLVRU\E\PHDQVRWKHUWKDQWKHVWDWHG Associate Degree or transfer credit. advisory are urged to consult with the appropriate department to determine their readiness to enroll in the 100-299 Applicable to the Associate Degree but not course or educational program. transferable to a 4-year institution Verifying prerequisites 300-499 Articulated for transfer with four-year Students enrolled in courses that have a prerequisite must institutions and are intended to meet SURYLGHYHULÀFDWLRQWRWKHLQVWUXFWRUWKDWWKH\KDYHPHWWKH major, general education, or elective credit prerequisite. Supporting evidence includes: requirements. /RV5LRV&RPPXQLW\&ROOHJH'LVWULFWWUDQVFULSWWKDWYHULÀHV that you have earned a “C” or better in the prerequisite 1000-1999 Continuing education courses for working FRXUVH/RV5LRVVWXGHQWVPD\SULQWDQXQRIÀFLDOWUDQVFULSW professionals who need to update their skills for by logging on to eServices. Instructors have access to this employment or licensure, as well as tutoring and information on their roster if the class was taken within other attendance-only courses. These courses are /RV5LRVVLQFH SULRUFRXUVHLQIRUPDWLRQFDQQRWEH non-degree applicable YLHZHG /RV 5LRV &RPPXQLW\ &ROOHJH 'LVWULFW $VVHVVPHQW WHVW Transfer Credit – Courses accepted for transfer by the scores. 8QLYHUVLW\RI&DOLIRUQLD 8& DQGRU&DOLIRUQLD6WDWH8QLYHUVLW\ &68 DUHOLVWHGZLWKWKHFRXUVHGHVFULSWLRQDQGDUHLGHQWLÀHG Verifying corequisites under “course transferable to . . .” Students who have questions Prerequisites, Corequisites, and Advisories Prerequisite challenge process Many courses and educational programs have enrollment ,I\RXGRQRWKDYHWKHFUHGHQWLDOVGHVFULEHGDERYHEXW conditions such as prerequisites, corequisites or advisories believe that you should qualify to enroll in the course, RQ UHFRPPHQGHG SUHSDUDWLRQ 7KHVH IDFXOW\DSSURYHG RU RQH RI WKH FRQGLWLRQV EHORZ H[LVWV WKHQ \RX PD\ conditions are considered necessary and appropriate to challenge a prerequisite. ensure that students are adequately prepared to succeed &KDOOHQJHVPXVWEHÀOHGQRODWHUWKDQWKHHQGRIWKH LQWKHFRXUVHRUHGXFDWLRQDOSURJUDP(QUROOPHQWUHVWULFWLRQV ÀUVWZHHNRILQVWUXFWLRQ. Prerequisite Challenge Forms DUHGHÀQHGEHORZ,WLVWKHVWXGHQW·VUHVSRQVLELOLW\WRPHHW DUHDYDLODEOHDWDOOLQVWUXFWLRQDODUHDGHDQV·RIÀFHVDW any and all enrollment conditions. WKH$GPLVVLRQVDQG5HFRUGV2IÀFHDQGRQOLQH Prerequisite: A course that a student is required to take Criteria for challenging a course are: in order to demonstrate current readiness for enrollment Students who have not met the criteria outlined above but LQDQRWKHUFRXUVHRUHGXFDWLRQDOSURJUDP)RUH[DPSOH feel they are prepared to enroll in the course may challenge LQRUGHUWRWDNH(QJOLVK &ROOHJH&RPSRVLWLRQ the course prerequisite by completing the Prerequisite /LWHUDWXUH \RXPXVWDOUHDG\KDYHFRPSOHWHG(QJOLVK Challenge Application form. Criteria for challenging a 300 with a grade of “C” or better. course include: 62 Folsom Lake College 2011-2012 Once you have completed the challenge form, your challenge will be reviewed by the appropriate department’s SUHUHTXLVLWHFKDOOHQJHFRPPLWWHH Courses, Degrees, & Certificates: Accounting (ACCT) - Work Experience (WEXP) 64 Accounting Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Accounting COUNSELING Rancho Cordova Center - 916-255-0717 BUS 330 Managing Diversity in the Workplace ....3 DEGREE A.A. - Accounting BUS 340 Business Law ...... 3 CERTIFICATES OF Accounting BUSTEC 302 Computer-Keyboarding ...... 2 ACHIEVEMENT Accounting, Advanced A minimum of 3 units from the following: Accounting Clerk CISA 300, 310, 320, 330, 340, CISC 300, 310, 320 . Accounting, Computer ...... 3 Applications CISC 310 or CISC 300 must be completed to satisfy this requirement. This Folsom Lake College program provides training ECON 302 Principles of Macroeconomics or for entry-level employment in private industry or in ECON 320/BUS 320 Concepts of Personal Finance ..3 government accounting. Study for self-employment as a MKT 300 Principles of Marketing or provider of computer-based bookkeeping and/or tax MGMT 362 Techniques of Management ...... 3 services is also available. In addition, those individuals ACCT 103 Intermediate Accounting-Part I ...... 4 already employed in accounting can work toward career ACCT 104 Intermediate Accounting-Part II ...... 4 advancement by taking additional courses. Generally, ACCT 107 Auditing ...... 3 HPSOR\PHQWLQWKLVVSHFLDOL]DWLRQUHTXLUHVSURÀFLHQF\ ACCT 111 Cost Accounting ...... 3 in business calculations. ACCT 311 Managerial Accounting ...... 4 ACCT 341 Computerized Accounting ...... 2 Career Options BUSTEC 101 Computer Keyboarding: 10-Key ...... 1 Account Clerk; Accounting Technician; Accountant Trainee; TOTAL UNITS REQUIRED ...... 48 $XGLWRU %DQN (PSOR\HH([DPLQHU &HUWLÀHG 3XEOLF Accountant; Cost Accountant; Insurance Employment; Suggested Electives: Revenue Agent (FTB/IRS); Tax Preparer; Bookkeeper ACCT 125, 498; BUS 341, 498; CISA 311, 321; MGMT 372 for: Accounts Receivable, Accounts Payable, General Ledger, Full-Charge This A.A. degree may be obtained by completion of the Some career options may require more than two years Required Program, plus General Education Requirements, of college study. SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO The Accounting degree is designed for students planning to Highlights seek accounting positions in business, industry, or government A traditional course of study in Accounting upon completion of two years of college study. The program Fundamentals, three levels of Financial Reporting, also meets the needs of employed individuals seeking to Managerial Techniques, State and Federal Income learn applications of accounting theory as practiced in the Taxation, Cost Accounting, and Auditing ÀHOG7KHSURJUDPSURYLGHVWKHIRXQGDWLRQIRULQGLYLGXDOVWR State-of-the-art software and equipment to SUHSDUHÀQDQFLDOVWDWHPHQWVDQGUHFRUGEXVLQHVVWUDQVDFWLRQV provide computerized accounting training for all types of business and industry. Students develop Internships, work experience with local employers a strong knowledge base of U.S. Generally Accepted for college units, job shadowing, guest speakers Accounting Principles (GAAP) and accounting procedures. IURP WKH DFFRXQWLQJ LQGXVWU\ ÀHOG WULSV WR Communication skills, teamwork, computer technology, and DFFRXQWLQJRIÀFHV ethical behavior are also emphasized. A lab with tutorial assistance For those students interested in transferring to a four-year DEGREE college or university to pursue a bachelor’s degree in this A.A. — Accounting major, it is critical that you meet with an FLC counselor to select and plan the courses for your major. Schools vary widely REQUIRED PROGRAM ...... Units in terms of the required preparation. The courses that FLC ACCT 301 Financial Accounting ...... 4 require for an A.A. degree in this major may be different BUS 300 Introduction to Business ...... 3 from the requirements needed for a Bachelor’s degree. BUS 310 Business Communications ...... 3 Folsom Lake College 2011-2012 Accounting 65 Upon completion of this program, the student will be able to: &RPPXQLFDWHÀQDQFLDOLQIRUPDWLRQHIIHFWLYHO\ZLWKLQD Record, classify, summarize and report the business business environment. transactions of a company. Provide management support in the budgeting, planning Prepare financial statements in conformity with and decision-making processes. accounting principles generally accepted in the United States of America. CERTIFICATE OF ACHIEVEMENT Analyze and prepare financial information for Accounting, Advanced management decision-making. &RPPXQLFDWHÀQDQFLDOLQIRUPDWLRQHIIHFWLYHO\ZLWKLQD REQUIRED PROGRAM ...... Units business environment ACCT 107 Auditing...... 3 Provide management support in the budgeting, planning ACCT 111 Cost Accounting ...... 3 and decision-making processes. ACCT 125 Federal and State Taxation ...... 4 Understand the role of ethics and standards of ACCT 301 Financial Accounting ...... 4 professional conduct in the accounting profession. ACCT 311 Managerial Accounting ...... 4 Integrate the principles of business, business law, BUS 300 Introduction to Business ...... 3 taxation, and economics into accounting functions. BUS 340 Business Law ...... 3 Apply principles of accounting to business situations and BUSTEC 101 Computer Keyboarding: 10-Key ...... 1 to understand other functions of business: marketing, TOTAL UNITS REQUIRED ...... 25 PDQDJHPHQWÀQDQFHDQGLQIRUPDWLRQSURFHVVLQJ 7KHDGYDQFHGDFFRXQWLQJFHUWLÀFDWHLVGHVLJQHGWREXLOG CERTIFICATE OF ACHIEVEMENT XSRQWKHVNLOOVOHDUQHGLQWKHDFFRXQWLQJFHUWLÀFDWH6WXGHQWV Accounting will continue their studies and receive training in federal and state tax applications. REQUIRED PROGRAM ...... Units ACCT 107 Auditing...... 3 Upon completion of this program, the student will be able to: ACCT 111 Cost Accounting ...... 3 Record, classify, summarize and report the business ACCT 301 Financial Accounting ...... 4 transactions of a company. ACCT 311 Managerial Accounting ...... 4 Prepare financial statements in conformity with ACCT 341 Computerized Accounting ...... 2 accounting principles generally accepted in the United BUS 340 Business Law ...... 3 States of America. TOTAL UNITS REQUIRED ...... 19 Analyze and prepare financial information for *Business 341 recommended for students intending to enter management decision-making. public accounting profession. &RPPXQLFDWHÀQDQFLDOLQIRUPDWLRQHIIHFWLYHO\ZLWKLQD business environment. 7KH$FFRXQWLQJ&HUWLÀFDWHLVDSURJUDPZKLFKSUHSDUHV Provide management support in the budgeting, planning students for entry level positions in accounting. The program and decision-making processes. is designed for students who would like to gain a core Prepare fundamental individual federal and state understanding of the principals of accounting. Many who income tax returns. WDNHWKHFHUWLÀFDWHSURJUDPDUHORRNLQJIRUDGYDQFHPHQW in their careers or the ability to learn a new skill set. &HUWLÀFDWHUHFLSLHQWVDUHFRPSHWHQWWRUHFRUGDQGPDLQWDLQ ÀQDQFLDOGDWDLQMRXUQDOVDQGOHGJHUVIURPGDWHRIRULJLQDO transaction through a full accounting cycle terminating with closing entries and statement preparation. Upon completion of this program, the student will be able to: Record, classify, summarize and report the business transactions of a company. Prepare financial statements in conformity with accounting principles generally accepted in the United States of America. Analyze and prepare financial information for management decision-making. 66 Accounting Folsom Lake College 2011-2012 CERTIFICATE OF ACHIEVEMENT CERTIFICATE OF ACHIEVEMENT Accounting Clerk Accounting, Computer Applications REQUIRED PROGRAM ...... Units REQUIRED PROGRAM ...... Units ACCT 101 Fundamentals of College Accounting or ACCT 121 Payroll Accounting ...... 3 ACCT 301 Financial Accounting ...... 3 ACCT 301 Financial Accounting ...... 4 ACCT 121 Payroll Accounting ...... 3 ACCT 311 Managerial Accounting ...... 4 ACCT 341 Computerized Accounting ...... 2 ACCT 341 Computerized Accounting ...... 2 BUS 100 English for the Professional ...... 3 CISA 310 Intro to Electronic Spreadsheets...... 1 BUS 105 Business Mathematics ...... 3 CISA 311 Intermed Electronic Spreadsheets ....1 BUSTEC 101 Computer Keyboarding: 10-Key (1) or CISA 320 Intro to Database Management ...... 1 BUS 498 Work Experience ...... 1-4 CISA 321 Intermed Database Management ....1 BUSTEC 302 Computer Keyboarding or Plus one to three (1-3) units selected from: .H\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU CISC 300 Computer Familiarization (1) ...... 2 CISC 310 Intro to Computer Info Science (3) 1-3 CISC 300 Computer Familiarization ...... 1 TOTAL UNITS REQUIRED ...... 18-20 CISA 310 Electronic Spreadsheets ...... 1 TOTAL UNITS REQUIRED ...... 19-22 The Accounting Computer Applications program is designed IRUWKRVHLQGLYLGXDOVZKRZLVKWREHFRPHSURÀFLHQWLQWKHXVH 7KH$FFRXQWLQJ&OHUN&HUWLÀFDWHLVDSURJUDPRIIHULQJEDVLF of computers for business accounting purposes. The program courses designed for students with little or no work experience. offers a core curriculum that provides the academic and 7KHFHUWLÀFDWHSURYLGHVVWXGHQWVZLWKDQLQWURGXFWLRQWREXVLQHVV technical background for individuals who wish to prepare technology, communication and basic accounting skills and for entry-level accounting positions in business and industry helps prepare them for entry level positions as accounting using both accounting and personal computer skills. clerks, data entry clerks, accounts payable clerks, accounts UHFHLYDEOHFOHUNVRIÀFHÀQDQFLDOFOHUNVSD\UROODVVLVWDQWV This curriculum is designed for those individuals who wish DQGRWKHUSRVLWLRQVLQDQRIÀFHRUEXVLQHVVHQYLURQPHQW7KH WREHFRPHSURÀFLHQWLQWKHXVHRIFRPSXWHUVIRUEXVLQHVV program is also intended to prepare students who are currently accounting purposes. Students who continue their education employed and wish to gain new skill sets in bookkeeping, E\SXUVXLQJDQRWKHUDFFRXQWLQJFHUWLÀFDWHRUDQ$VVRFLDWH ÀQDQFLDOVRIWZDUHDQGFRPPXQLFDWLRQ in Arts degree in business may do so without repeating any courses taken during the Computer Applications for Upon completion of this program, the student will be able to: Accounting program. Perform basic bookkeeping and accounting tasks both manually and on the computer. Upon completion of this program, the student will be able to: 'HPRQVWUDWHSURÀFLHQF\RQWKHFRPSXWHUNH\ERDUGDQG Record, classify, summarize and report the business ten-key calculator. transactions of a company. Prepare written business communications. Prepare financial statements in conformity with Perform basic accounting operations using a spreadsheet accounting principles generally accepted in the United such as Excel. States of America. Understand essential features of the Windows XP Analyze and prepare financial information for operating system. management decision-making. &RPPXQLFDWHÀQDQFLDOLQIRUPDWLRQHIIHFWLYHO\ZLWKLQD business environment 3HUIRUP EDVLF EXVLQHVV FRPSXWHU VNLOOV ZLWK VSHFLÀF knowledge of commercial accounting software Folsom Lake College 2011-2012 Accounting 67 ACCT 121 PAYROLL ACCOUNTING 3 UNITS Accounting (ACCT) Prerequisite: None. Advisory: ACCT 101 or 301 ACCT 101 FUNDAMENTALS OF COLLEGE ACCOUNTING 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course is a study of payroll and personnel records, procedures and General Education: AA/AS Area II(b) regulations. The course will include a study of the various California and Federal Hours: 54 hours LEC laws pertaining to the computation of earnings and withholdings. Payroll tax This accounting course focuses on basic accounting practices which emphasize payment requirements and preparation of the employer’s California and Federal a practical application approach to the use of accounts, journals, ledgers, and payroll tax reports will be included. A comprehensive simulation project will be ÀQDQFLDOVWDWHPHQWV7KLVFRXUVHLVUHFRPPHQGHGIRUVWXGHQWVZKRLQWHQGWR completed as part of the course. The project will include one quarterly payroll VHHNHPSOR\PHQWLQWKHEXVLQHVVRIÀFHRIDVROHSURSULHWRUVKLSRUJDQL]HGIRU reporting cycle. service or sales activity. ACCT 125 FEDERAL AND STATE TAXATION 4 UNITS ACCT 103 INTERMEDIATE ACCOUNTING - PART I 4 UNITS Prerequisite: None. Prerequisite: ACCT 301. Grade of “C” or better required to meet prerequisite. Advisory: ACCT 101 or 301 Hours: 72 hours LEC Hours: 72 hours LEC This course provides a continuing study of the measurement and reporting of This course is a study of basic federal and California income tax regulations WKHUHVXOWVRIRSHUDWLRQVDQGWKHÀQDQFLDOFRQGLWLRQRISURÀWGLUHFWHGEXVLQHVV with an emphasis on the skills necessary for the preparation of individual entities. Special emphasis will be given to the valuation of assets using the LQFRPHWD[UHWXUQV,QFOXGHGDUHÀOLQJUHTXLUHPHQWVGHWHUPLQDWLRQRIWD[DEOH Financial Accounting Standards Board (FASB) as authority. Completion of ACCT income, allowable deductions, tax computation, tax credits, other taxes, payment 103 and 104 is required to complete the “advanced accounting” requirement methods, and audit procedures. The course is acceptable as an elective for civil IRUDFFRXQWLQJFODVVLÀFDWLRQVLQVWDWHVHUYLFH7KLVFRXUVHLVQRWLQWHQGHGIRU service professional accounting operations and recommended for accounting WUDQVIHUWRDIRXU\HDUFROOHJH PDMRUV7KLVFRXUVHIXOÀOOVWKHTXDOLI\LQJHGXFDWLRQDQGFRQWLQXLQJHGXFDWLRQ requirements under guidelines established by the California Tax Education ACCT 104 INTERMEDIATE ACCOUNTING - PART II 4 UNITS Council (CTEC). Prerequisite: ACCT 301 with a grade of “C” or better Hours: 72 hours LEC ACCT 295 INDEPENDENT STUDIES IN ACCOUNTING 1-3 UNITS This course is a continuing study of the measurement and reporting of the Prerequisite: None UHVXOWVRIRSHUDWLRQVDQGWKHÀQDQFLDOSRVLWLRQRIEXVLQHVVHQWLWLHV$Q Hours: 18 hours LEC ; 54 hours LAB HPSKDVLVLVSODFHGRQDFFRXQWLQJIRULQYHVWPHQWVVWRFNKROGHU·VHTXLW\ORQJ term liabilities, leases and income taxes. This course and ACCT 103 Intermediate ACCT 299 EXPERIMENTAL OFFERING IN ACCOUNTING .5-4 UNITS $FFRXQWLQJ3DUW,FRQVWLWXWHWKH´DGYDQFHGDFFRXQWLQJµUHTXLUHPHQWIRUVRPH Prerequisite: None SURIHVVLRQDOOHYHODFFRXQWLQJFODVVLÀFDWLRQVLQ&DOLIRUQLDVWDWHVHUYLFH7KLV Hours: 72 hours LEC FRXUVHLVQRWLQWHQGHGIRUWUDQVIHUWRDIRXU\HDUFROOHJH ACCT 301 FINANCIAL ACCOUNTING 4 UNITS Prerequisite: None. ACCT 107 AUDITING 3 UNITS Advisory: ACCT 101, BUS 105, or MATH 125 Prerequisite: ACCT 301 with a grade of “C” or better General Education: AA/AS Area II(b) Advisory: ACCT 103 and 104 Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 72 hours LEC 7KLVFRXUVHFRYHUVWKHSURFHGXUHVDQGSUDFWLFHVXVHGLQWKHYHULÀFDWLRQRI This is the study of accounting as an information system. The course provides ÀQDQFLDOVWDWHPHQWEDODQFHVDQGDFFRXQWLQJWUDQVDFWLRQV7KHW\SHVRIDXGLWV students with an understanding of the nature and purpose of accounting and its and audit occupations as well as the legal liabilities of the auditor will be function in business. The principles and concepts underlying transaction analysis discussed. This course is acceptable as elective units toward civil service DQGUHFRUGLQJ ÀQDQFLDOVWDWHPHQWSUHSDUDWLRQGLVFORVXUHVDQGDQDO\VLV DQG professional accounting education requirements. ethical issues are addressed. The course includes units on inventories, internal FRQWUROFDVKUHFHLYDEOHVÀ[HGDQGLQWDQJLEOHDVVHWVFXUUHQWDQGORQJWHUP ACCT 111 COST ACCOUNTING 3 UNITS liabilities, stockholders’ equity, income tax, and investments. Prerequisite: None. Advisory: ACCT 311 Hours: 54 hours LEC This course is an introduction to cost accounting methods, including job order, process and standard cost systems. Special attention will be given to managerial XVHVRIFRVWDFFRXQWLQJ7KLVFRXUVHLVQRWLQWHQGHGIRUWUDQVIHUWRDIRXU\HDU college. 68 Accounting Folsom Lake College 2011-2012 ACCT 311 MANAGERIAL ACCOUNTING 4 UNITS Prerequisite: ACCT 301 with a grade of “C” or better Course Transferable to UC/CSU Hours: 72 hours LEC This is a study of accounting information needed by decision makers of all types DQGVL]HVRIRUJDQL]DWLRQV VHUYLFHUHWDLOPDQXIDFWXULQJDQGQRWIRUSURÀW small businesses to large corporations). Emphasis is placed upon the analysis RITXDQWLWDWLYHLQIRUPDWLRQQHHGHGIRUVKRUWDQGORQJWHUPSODQQLQJGD\ WRGD\RSHUDWLRQVDQGUHYLHZLQJRIRSHUDWLRQVDQGSHUVRQQHO7KLVFRXUVHLV UHTXLUHGRIDOOEXVLQHVVPDMRUVPLQRUVDQGDFFRXQWLQJFHUWLÀFDWHFDQGLGDWHV ACCT 341 COMPUTERIZED ACCOUNTING 2 UNITS Prerequisite: ACCT 101 or 301 with a grade of “C” or better; Two years of high school accounting. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 7KLVLVDFRXUVHXVLQJWKHFRPSXWHUWRSUHSDUHÀQDQFLDODFFRXQWLQJVWDWHPHQWV and reports used in business. Areas of study include general ledger, accounts payable, accounts receivable, inventory, payroll, and depreciation. The ability to W\SHZRUGVDPLQXWHDQGWRXVHDWHQNH\FDOFXODWRUE\WKHWRXFKPHWKRG will be useful for completing class assignments. ACCT 495 INDEPENDENT STUDIES IN ACCOUNTING 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB ACCT 498 WORK EXPERIENCE IN ACCOUNTING 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity, or job related to career interests. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. ACCT 499 EXPERIMENTAL OFFERING IN ACCOUNTING .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Administration of Justice 69 Administration ACADEMIC Folsom campus - 916-608-6510 El Dorado Center - 530-642-5645 of Justice COUNSELING Rancho Cordova Center - 916-255-0717 In the history of the Administration of Justice there has never DEGREE A.A. - Administration of Justice been a greater demand for well-trained and educated professionals in the law enforcement, courts, and corrections Never before has there been a greater demand for ÀHOGV)ROVRP/DNH&ROOHJH·V$GPLQLVWUDWLRQRI-XVWLFHDQG well-trained and educated professionals in the law Criminal Justice programs concentrate on training individuals HQIRUFHPHQW DQG FRUUHFWLRQDO ÀHOGV )ROVRP /DNH for positions in a wide variety of careers in the Administration College’s program concentrates on training individuals RI-XVWLFHÀHOG*UDGXDWHVZLOOEHEHWWHUSUHSDUHGWRVHHN for entry-level positions in a wide variety of careers in employment at the local, state, federal and private level. WKH$GPLQLVWUDWLRQRI-XVWLFHÀHOG*UDGXDWHVZLOOEHDEOH to seek employment at either the local, state, federal or Upon completion of this program, the student will be able to: private level. Such careers include corrections, uniform Identify and evaluate various local, state, and federal SDWUROLQYHVWLJDWLRQVDQGFULPLQDOLGHQWLÀFDWLRQ law enforcement career options. Recognize the complexities of law enforcement career Career Options application and hiring process and develop the most 3ROLFH2IÀFHU 'HSXW\6KHULII &ULPH6FHQH,QYHVWLJDWRU effective career strategy. ,GHQWLÀFDWLRQ7HFKQLFLDQ &RPPXQLW\6HUYLFHV2IÀFHU Recall and appreciate the philosophy of the American &RUUHFWLRQV2IÀFHU 3DUROH2IÀFHU 3UREDWLRQ2IÀFHU justice system (adult and juvenile). and a variety of support service occupations. Potential Analyze crime causation, criminal statutes and procedures employers include: Federal, State and local law Understand the complexities of punishment, corrections, enforcement agencies (Sheriff, Police, California community and human relations. Highway Patrol, Federal Bureau of Investigations, Drug Recognize the complex legal aspects of criminal Enforcement Administration, Department of Justice, investigations, procedures, constitutional law, and case Crime Scene Investigations, and California Department law. of Corrections and Rehabilitation). Identify various controlled substances and interpret their DGGLFWLYHSURSHUWLHVLQÁXHQFHVDQGLPSDFWRQVRFLHW\ Some positions, however, require a four-year degree for and law enforcement. which FLC’s program is a good base for transfer. Apply laws and procedures for the collection and use of evidence. DEGREE Identify and adapt to ethical standards placed on law A.A. — Administration of Justice enforcement professionals and recognize how they impact their daily decisions and actions. REQUIRED PROGRAM ...... Units ADMJ 300 Introduction to Administration of Justice .. 3 ADMJ 301 Investigative Report Writing ...... 3 ADMJ 302 Community Relations: Multicultural Issues ..3 ADMJ 320 Concepts of Criminal Law ...... 3 ADMJ 323 Legal Aspects of Evidence ...... 3 ADMJ 330 Criminal Investigation ...... 3 Plus six (6) units selected from: ADMJ 308, 309, 310, 322, 331, 340, 370, 380, 381, 498 ...... 6 TOTAL UNITS REQUIRED ...... 24 This A.A. degree may be obtained by completion of the Required Program, plus General Education Requirements, SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO 70 Administration of Justice Folsom Lake College 2011-2012 ADMJ 309 CAREER PREPARATION FOR LAW ENFORCEMENT Administration of Justice (ADMJ) OCCUPATIONS 3 UNITS Prerequisite: None. ADMJ 300 INTRODUCTION TO ADMINISTRATION OF JUSTICE Course Transferable to CSU 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course is designed for students who are pursuing careers in law enforcement Course Transferable to UC/CSU and corrections. This course will cover employment and career search, Hours: 54 hours LEC application processes, resume development, and cover letter. Participation will This course introduces students to the characteristics of the American criminal SUHSDUHVWXGHQWVIRUSUHHPSOR\PHQWWHVWLQJLQWHUYLHZWHFKQLTXHVEDFNJURXQG justice system. Emphasis is placed on examining due process, U.S. Constitutional investigation, polygraph examination, medical screening, conditional job offer, Rights, criminal activity, crime causation, domestic and international criminal and hiring processes. threats, law enforcement response to criminal activity, and future trends for law enforcement. Students will explore the components of the American justice ADMJ 310 FORENSIC PHOTOGRAPHY 3 UNITS system, including law enforcement, courts, and correctional services with an Prerequisite: None. emphasis on ethics and leadership. Course Transferable to CSU Hours: 51 hours LEC ; 9 hours LAB ADMJ 301 INVESTIGATIVE REPORT WRITING 3 UNITS This course will introduce the student to the basic principles of forensic Prerequisite: ENGWR 101 with a grade of “C” or better photography, including: 1) The history of photography as it relates to the law, Course Transferable to CSU/UC DORRNDWKLVWRULFDOFDVHODZDQGUXOHVRIHYLGHQFH KRZÀOPDQGGLJLWDO Hours: 54 hours LEC cameras work and how a photograph is made and 4) macrophotography and This course provides a study of the techniques of communicating facts in PLFURSKRWRJUDSK\DVLWDSSOLHVWRSKRWRJUDSKLQJVSHFLÀFW\SHVRIHYLGHQFH a clear, comprehensive, concise, and logical manner. Emphasis is placed on such as impression evidence, trace evidence, questioned documents, blood administration of justice terminology, use of English and organization of stain patterns, arson scenes, etc. information, note taking and report writing, and presentation of testimony in court. ADMJ 320 CONCEPTS OF CRIMINAL LAW 3 UNITS Prerequisite: None. ADMJ 302 COMMUNITY RELATIONS: MULTICULTURAL ISSUES Advisory: ENGRD 310 and ENGWR 101 3 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 54 hours LEC Advisory: ENGWR 101 This course examines the philosophy, history and structure of criminal law in General Education: AA/AS Area V(b); AA/AS Area VI WKH8QLWHG6WDWHV6SHFLDOHPSKDVLVLVSODFHGRQWKHFODVVLÀFDWLRQRIFULPH Course Transferable to UC/CSU WKHJHQHUDOHOHPHQWVRIFULPHWKHGHÀQLWLRQVRIFRPPRQDQGVWDWXWRU\ODZ Hours: 54 hours LEC and the nature of acceptable evidence. This course utilizes case studies to This course examines the complex, dynamic relationship between communities LQWURGXFHVWXGHQWVWRFULPLQDOODZDQGWKHFODVVLÀFDWLRQRIFULPHVDJDLQVW DQGWKHLQVWLWXWLRQVRIWKHMXVWLFHV\VWHPLQDGGUHVVLQJFULPHDQGFRQÁLFWZLWK persons, property, morals, and public welfare. The course will also include some an emphasis on the challenges and prospects of administering justice within discussion of the U.S. Constitution, prosecution and defense decision making, a diverse, multicultural population. The course addresses the role that race, criminal culpability, and defenses to crimes. ethnicity, gender, sexual orientation, social class, culture and the criminal justice professional play in shaping these relationships. The course examines ADMJ 322 CRIMINAL PROCEDURES 3 UNITS new strategies, skills, tools, and cultural knowledge necessary for personnel Prerequisite: None. engaged in all aspects of the criminal justice system. Special topics include the Course Transferable to CSU impact that terrorism and the need for homeland security have changed the Hours: 54 hours LEC dynamics of police community relations. This course will study the criminal procedures and how they are applied in the American justice system. Topics will include fundamental concepts of law, ADMJ 308 CRIME SCENE INVESTIGATION 3 UNITS exclusionary rule, bail, extradition and rendition. Additional topics will include Prerequisite: None. laws and procedures of arrest, order of trial procedures, motions, writs and Course Transferable to CSU appeals, limitations of prosecution, rights of the accused, prosecution and Hours: 51 hours LEC ; 9 hours LAB defense strategies, judgment, and sentencing. This course will introduce the student to the basic principles of crime scene investigation, including the primary protection of the crime scene, the principles of physical evidence and how physical evidence can assist in solving crimes. The student will learn how to properly document a crime scene and will examine the relationship between the investigator, the crime scene investigator, and WKHFULPHODERUDWRU\$ÀHOGWULSWRDFULPHODEPD\EHUHTXLUHGLQWKLVFRXUVH Folsom Lake College 2011-2012 Administration of Justice 71 ADMJ 323 LEGAL ASPECTS OF EVIDENCE 3 UNITS ADMJ 380 PC832 ARREST, SEARCH & SEIZURE 3 UNITS Prerequisite: None. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 54 hours LEC This course examines the constitutional foundation of the rules of evidence as 7KLVFRXUVHVDWLVÀHVWKHDUUHVWVHDUFKDQGVHL]XUHUHTXLUHPHQWIRUSHDFH applied in “U.S.” law. Emphasis is placed on the types of evidence and the laws RIÀFHUVDVGHÀQHGLQVHFWLRQRIWKH&DOLIRUQLD3HQDO&RGH,QVWUXFWLRQZLOO governing admissibility of evidence in criminal proceedings. include the law enforcement application of leadership, professionalism, and ethics, community policing, laws of arrest, search and seizure, investigative ADMJ 330 CRIMINAL INVESTIGATION 3 UNITS report writing, use of force, cultural diversity/discrimination, arrest methods, Prerequisite: None. and defensive tactics. This course may be taken up to four times for POST Course Transferable to CSU FHUWLÀFDWLRQUHTXLUHPHQWV Hours: 54 hours LEC This course introduces students to basic investigative responsibilities and ADMJ 381 PC832 FIREARMS 1 UNIT procedures as applied to criminal investigations. Topics include crime scene Prerequisite: None. management, forensic and physical evidence handling, search and seizure, Enrollment Limitation: Students must present California Department of Justice property crimes, violent crimes, organized criminal enterprises, gangs, and '2- /LYHVFDQFOHDUDQFHOHWWHURQWKHÀUVWGD\RIFODVV7KLVOHWWHUPXVWEH domestic and international terrorist organizations. dated within the past six months. Course Transferable to CSU ADMJ 331 PATROL PROCEDURES 3 UNITS Hours: 8 hours LEC ; 16 hours LAB Prerequisite: None. 7KLVFRXUVHLVDEDVLFLQWURGXFWLRQWRWKHOHJDODVSHFWVRIÀUHDUPVXVDJHDQG Course Transferable to CSU is in compliance with California Penal Code section 832 and requirements of Hours: 54 hours LEC WKH&DOLIRUQLD&RPPLVVLRQRQ3HDFH2IÀFHU6WDQGDUGVDQG7UDLQLQJ 3267 7KLVFRXUVHZLOOH[SORUHWKHHDUO\GHYHORSPHQWDQGSUHVHQWGD\UROHRISDWURO &RXUVHWRSLFVLQFOXGH ÀUHDUPVVDIHW\EDVLFÀUHDUPVRSHUDWLRQÀUHDUPV operations and techniques used by local law enforcement agencies. Major topics DPPXQLWLRQÀUHDUPVFOHDQLQJDQGPDLQWHQDQFHDQGEDVLFIXQGDPHQWDOVRI will include community policing, effective patrol strategies, gang awareness, VKRRWLQJ6WXGHQWVPXVWSURYLGHWKHLURZQDSSURYHGVHPLDXWRPDWLFKDQGJXQ and key factors affecting deployment of patrol resources such as community 9mm or larger, 500 rounds of ammunition, and all safety gear. Students must involvement and meeting department objectives. DOVRSURYLGHD&$'HSDUWPHQWRI-XVWLFH/LYHVFDQÀQJHUSULQWFOHDUDQFHOHWWHU 6WXGHQWVPXVWSURYLGHWKHLURZQWUDQVSRUWDWLRQWRDQRIIVLWHÀUHDUPVUDQJH ADMJ 340 INTRODUCTION TO CORRECTIONAL SERVICES 3 UNITS 7KLVFRXUVHPD\EHWDNHQXSWRIRXUWLPHVIRU3267FHUWLÀFDWLRQUHTXLUHPHQWV Prerequisite: None. Pass/No pass only. Course Transferable to CSU Hours: 54 hours LEC ADMJ 494 TOPICS IN ADMINSTRATION OF JUSTICE .5-4 UNITS This course provides a review of various contemporary criminal justice Prerequisite: None correctional services. The course will include a description and evaluation of the Course Transferable to CSU impact of deviate behavior, police involvement, jails, and the judicial system, Hours: 18 hours LEC ; 54 hours LAB correctional institutions, and probation, parole and community resources. The 'HVLJQHGWRGHDOZLWKFXUUHQWSUREOHPVRUVSHFLÀFWRSLFVFRQFHUQLQJWKH FRXUVHDOVRLGHQWLÀHVDYDULHW\RIFDUHHURSSRUWXQLWLHVLQFRUUHFWLRQV administration of justice. The particular subject to be covered each semester will be determined by the Administration of Justice staff. May be taken two ADMJ 370 ILLEGAL DRUGS - IDENTIFICATION AND times for credit. INVESTIGATION 3 UNITS Prerequisite: None. ADMJ 495 INDEPENDENT STUDIES IN ADMINISTRATION OF Course Transferable to CSU JUSTICE 1-3 UNITS Hours: 54 hours LEC Prerequisite: None The study of current drugs of abuse will include identification, street Course Transferable to CSU terminology, pricing, packaging, methods of use, duration of effect, addiction, Hours: 18 hours LEC ; 54 hours LAB KLVWRU\DQGUHFRJQL]LQJSHUVRQVXQGHUWKHLQÁXHQFH7KHFRXUVHDOVRH[DPLQHV current laws and law enforcement agency functions, including search and seizure, search warrants, enforcement trends, ethics and leadership, and treatment SURJUDPVYHUVXVLQFDUFHUDWLRQ7KLVFRXUVHZLOODOVRVWXG\VHYHUDOKLJKSURÀOH GUXJWUDIÀFNHUVZKRKDYHEHHQLQFDUFHUDWHG 72 Administration of Justice Folsom Lake College 2011-2012 ADMJ 498 WORK EXPERIENCE IN ADMINISTRATION OF JUSTICE 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity or job related to the administration of justice/criminal MXVWLFHÀHOG6WXGHQWVDUHDGYLVHGWRFRQVXOWZLWKWKH$GPLQLVWUDWLRQRI -XVWLFH'HSDUWPHQWWRUHYLHZVSHFLÀFFHUWLÀFDWHDQGGHJUHHZRUNH[SHULHQFH requirements. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. ADMJ 499 EXPERIMENTAL OFFERING IN ADMINISTRATION OF JUSTICE .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Allied Health 73 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Allied Health COUNSELING Rancho Cordova Center - 916-255-0717 These courses offer valuable technical language skills Allied Health (AH) and information to students pursuing a career in the KHDOWKÀHOG AH 108 INTRODUCTION TO ALLIED HEALTH 1 UNIT Prerequisite: None. Career Options Enrollment Limitation: This class is funded in part by a $5 million grant from the U.S. Department of Labor and requires completion of an application and 0HGLFDOÀHOGRSSRUWXQLWLHV instructor consent to enroll. For additional information and to request an Some career options may require more than two years DSSOLFDWLRQSDFNHWFDOO PDLOER[RUHPDLO+HDOWK)RUFH# of college study. losrios.edu Hours: 18 hours LEC 7KLVFRXUVHSURYLGHVDQLQWURGXFWLRQWRWKHPHGLFDOÀHOG7RSLFVLQFOXGHWKH Highlight KLVWRU\RIPHGLFLQH ODZDQGHWKLFVDVWKH\SHUWDLQWRWKHPHGLFDOÀHOG &RXUVHV WDXJKW E\ FHUWLÀHG KHDOWK FDUH FRQÀGHQWLDOLW\DQGUHSRUWDEOHLQFLGHQWV XVDJHRIUHIHUHQFHPDWHULDOV DQG professionals various types of health care delivery systems and allied health careers, including scope of practice. AH 110 MEDICAL LANGUAGE FOR HEALTH-CARE PROVIDERS 3 UNITS Prerequisite: None. Hours: 54 hours LEC This course is an orientation to medical language including basic structure of PHGLFDOWHUPSUHÀ[HVVXIÀ[HVDQGURRWVDQGFRPELQLQJIRUPVZLWKHPSKDVLV on analysis, spelling, and pronunciation. The course builds a medical vocabulary applicable to the specialties of medicine, the systems of the body, names of major diseases, and terms used in physical examination, diagnosis, and treatment. AH 130 INTRODUCTION TO MEDICAL TRANSCRIPTION 1 UNIT Prerequisite: AH 110; BUSTEC 302 and BUS 100. Grade of “C” or better required to meet prerequisite. Hours: 12 hours LEC ; 18 hours LAB This course emphasizes transcription of various medical documents into PDLODEOHIRUPIURPSUHUHFRUGHGDXWKHQWLFSK\VLFLDQGLFWDWHGUHSRUWV organized by body systems or medical specialties. This course emphasizes development of accuracy, speed, and medical knowledge for transcription of letters, chart notes, history and physical examination reports, consultations, emergency room reports, operative reports, discharge summaries, laboratory reports, radiology reports and pathology reports. In addition, the following are covered: reference materials and other resources, editing and proofreading techniques, and grammar and punctuation. This course acquaints the student with specialized terminology and provides realistic materials and voices for DGGLWLRQDOSURÀFLHQF\ 74 Anthropology Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Anthropology COUNSELING Rancho Cordova Center - 916-255-0717 ANTH 310 CULTURAL ANTHROPOLOGY 3 UNITS This Folsom Lake College program offers basic lower Prerequisite: None. division courses in Anthropology. Anthropology serves General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D1; IGETC Area 4A as an excellent background to many other behavioral Course Transferable to UC/CSU sciences. It also assists students in understanding people Hours: 54 hours LEC and the world around them. This course is an introduction to the varieties of customs and forms of social OLIHRIKXPDQEHLQJVLQERWKZHVWHUQDQGQRQZHVWHUQSHRSOHVZLWKWKHDLP Career Options of understanding the structure and functioning of societies. Also analyzed are Anthropologist; Instructor; Museum Curator; Population multicultural customs and their usefulness in the societies in which they occur Analyst; Urban Planner; Transcultural Nursing; Health DQGKRZFXOWXUHLVÁH[LEOHDQGDGDSWLYHLQDYDULHW\RIVHWWLQJV Researcher; Environmental Impact Analyst; Forensic Science ANTH 319 VISUAL ANTHROPOLOGY: INTRODUCTION TO ETHNOGRAPHIC FILM 3 UNITS Some career options may require more than two years Prerequisite: None. of college study. General Education: AA/AS Area V(b); CSU Area D1 Course Transferable to CSU Highlights Hours: 54 hours LEC A friendly faculty with many cross-cultural 7KLVFRXUVHSURYLGHVDQLQWURGXFWLRQWRWKHXVHRIÀOPE\DQWKURSRORJLVWVDV experiences a research and educational tool. Students will view and evaluate a series of An anthropology lab experience ÀOPVGHSLFWLQJGLIIHUHQWFXOWXUHVIURPDURXQGWKHZRUOG$QDO\VLVZLOOIRFXVRQ H[DPLQLQJYDULRXVDWWULEXWHVRIHWKQRJUDSKLFÀOPDQGWKHLUWUHDWPHQWE\D QXPEHURIDQWKURSRORJLFDOÀOPPDNHUV Anthropology (ANTH) ANTH 320 INTRODUCTION TO ARCHAEOLOGY AND WORLD ANTH 300 PHYSICAL ANTHROPOLOGY 3 UNITS PREHISTORY 3 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area IV; CSU Area B2; IGETC Area 5B General Education: AA/AS Area V(b); CSU Area D1; IGETC Area 4A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course is designed to introduce students to the study of physical or This course introduces students to the discipline of archeology and provides ELRORJLFDODQWKURSRORJ\RQHRIWKHVXEGLVFLSOLQHVRIDQWKURSRORJ\3K\VLFDO a broad survey of world prehistory. Students will explore the fundamental anthropology considers the role of culture in the human biological experience. principles, theoretical approaches and methods utilized by archaeologists to This course traces the evolution of the human line and examines our relationship reconstruct prehistory, and will explore a sample of the major developments WRRXUFORVHVWOLYLQJUHODWLYHVWKHQRQKXPDQSULPDWHV7KLVFRXUVHSURYLGHV of human prehistory from the Upper Paleolithic period forward. Examples of an overview of human genetics, human variation, primatology, human and the archaeological record will be drawn from all major geographic areas of primate evolution, human growth and development, skeletal anatomy, and the world. forensic anthropology. ANTH 330 MAGIC, WITCHCRAFT, AND RELIGION 3 UNITS ANTH 301 PHYSICAL ANTHROPOLOGY LABORATORY 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D1; IGETC Area 4A Corequisite: ANTH 300 (may be taken previously) Course Transferable to UC/CSU General Education: CSU Area B3; IGETC Area 5B Hours: 54 hours LEC Course Transferable to UC/CSU 7KLVLVDFURVVFXOWXUDOVWXG\RIWKHIRUPVDQGIXQFWLRQVRIVXSHUQDWXUDOEHOLHIV Hours: 54 hours LAB and associated rituals in various societies of Africa, Asia, aboriginal Australia, This is an introductory laboratory course dealing with human evolution, human, Oceania, South America, native North America and elsewhere. The emphasis of DSHDQGPRQNH\ERQHLGHQWLÀFDWLRQ RVWHRORJ\ ,GHQWLÀFDWLRQDQGPHDVXUHPHQW the course is on understanding beliefs and rituals within their social contexts, of skeletons, determining age and sex from bones, examination of human and on broad comparisons to derive insight into the general functions of beliefs fossils, forensics, monkey and ape behavior as well as human development DQGULWXDOVLQKXPDQOLIH$ÀHOGWULSPD\EHLQFOXGHGLQWKHFRXUVHDFWLYLWLHV will be covered. Folsom Lake College 2011-2012 Anthropology 75 ANTH 390 ANTHROPOLOGY FIELD STUDY .5-4 UNITS ANTH 495 INDEPENDENT STUDIES IN ANTHROPOLOGY 1-3 UNITS Prerequisite: None Prerequisite: None Course Transferable to CSU Course Transferable to CSU Hours: 12 hours LEC ; 18 hours LAB Hours: 18 hours LEC ; 54 hours LAB 7KLVFRXUVHSURYLGHVDQRSSRUWXQLW\IRUÀUVWKDQGREVHUYDWLRQRIDYDULHW\RI ANTH 499 EXPERIMENTAL OFFERING IN ANTHROPOLOGY historic and prehistoric sites in the Sierra foothills environment, as well as an .5-4 UNITS examination of museum collections and presentation techniques of cultural Prerequisite: None materials. Depending on availability, it includes visits to active excavations Course Transferable to CSU in the area. This class is ideal for future teachers and those interested in the Hours: 18 hours LEC ; 54 hours LAB LQWHUSUHWDWLRQÀHOG ANTH 392 PRINCIPLES OF HERITAGE INTERPRETATION 3 UNITS Prerequisite: None Course Transferable to CSU Hours: 54 hours LEC This interdisciplinary course covers the basics of interpreting historical, cultural, and natural resources to the general public. Interpretation is a communication process that forges emotional and intellectual connections between the interests of the audience and the inherent meanings of the resource. Topics will LQFOXGH GHYHORSLQJDXGLHQFHDZDUHQHVV XQGHUVWDQGLQJUHVRXUFHLGHQWLÀFDWLRQ developing a program using a thematic approach; writing measurable performance objectives; and learning program delivery techniques. Completion RIWKLVFRXUVHZLOOTXDOLI\VWXGHQWVWRDSSO\IRUSURIHVVLRQDOFHUWLÀFDWLRQWKURXJK WKH1DWLRQDO$VVRFLDWLRQIRU,QWHUSUHWDWLRQDVD&HUWLÀHG,QWHUSUHWLYH*XLGH (CIG). This course is recommended for students interested in history, biology, anthropology, recreation, education, and communication. Not open to students who have received credit for BIOL 392 or HIST 392. ANTH 393 FIELD EXPERIENCE IN ANTHROPOLOGY OR HERITAGE INTERPRETATION 2 UNITS Same As: BIOL 393 and HIST 393 Prerequisite: None. Advisory: Completion of ANTH 310 or ANTH 392 with a grade of “C” or better. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB This course is a cooperative effort between the college and the organizations LQYROYHGLQDQWKURSRORJ\RUWKHUHODWHGÀHOGRIKHULWDJHLQWHUSUHWDWLRQ Internship sponsors assist students in acquisition of skills and the application of knowledge learned in the classroom. In addition to developing applied job related skills, students will learn skills in job seeking, career goal setting, WHDPEXLOGLQJDQGOHDGHUVKLS'XULQJWKHLQWHUQVKLSVWXGHQWVZLOOFRQWLQXHWR check in with the class to receive input and feedback on their experience. This course requires that the students obtain an internship during the course of the semester that will last a minimum of 54 hours. 76 Architecture Folsom Lake College 2011-2012 Architecture (ARCH) ARCH 310 HISTORY OF ARCHITECTURE 3 UNITS Prerequisite: None. Advisory: Eligibility for ENGWR 101 General Education: AA/AS Area I; CSU Area C1 Course Transferable to UC/CSU Hours: 54 hours LEC Architecture design theories and practices of the late 19th and 20th century to the present including the Beaux Arts, Art Nouveau, Expressionism, De Stijl international style, Fascist Ideologies, Regionism, Post World War II Amalgamations of Twentieth Century idioms and recent reactions to contemporary standardization. ARCH 320 ARCHITECTURAL DESIGN AND COMMUNICATION I 3.5 UNITS Prerequisite: None Course Transferable to UC/CSU Hours: 54 hours LEC ; 27 hours LAB This course includes the principles, concepts, methods and skills pertaining to the freehand and drafted construction of drawings employing orthographic, axonometric, oblique, and lineal perspective drawing systems to represent ideas, objects and environments. The principles and concepts of two and WKUHHGLPHQVLRQDOYLVXDODQGDUFKLWHFWXUDOGHVLJQDUHLQFOXGHG7KLVFRXUVHLV required of all beginning architectural students. ARCH 321 ARCHITECTURAL DESIGN AND COMMUNICATION II 3.5 UNITS Prerequisite: ARCH 320. Grade of “C” or better required to meet prerequisite. Course Transferable to UC/CSU Hours: 54 hours LEC ; 27 hours LAB This course is a continuation and development of the content and issues introduced in ARCH 320 plus the principles, concepts, methods and skills pertaining to the freehand and drafted construction of shadows, physical model building, entourage and color theory. ARCH 495 INDEPENDENT STUDIES IN ARCHITECTURE 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ARCH 499 EXPERIMENTAL OFFERING IN ARCHITECTURE .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Art 77 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Art COUNSELING Rancho Cordova Center - 916-255-0717 314, 318, 324, 326, 328, 330, 332, 333 DEGREE A.A. - Art, Studio Art A minimum of 9 units from chosen area (i.e., painting, drawing, A.A. - Art, Design sculpture): ...... 9 A.A. - Art, Art History Drawing: ART 302, 305, 308, 310, 312, 316, 322, 361, 364; Painting: ART 322, 327, 328, 330, 332, 334, Folsom Lake College’s art curriculum offers introductory 336, 337, 447; Sculpture: ART 322, 372, 373, 383, 386, and intermediate level courses in painting, watercolor, 387, 390, 402, 404 computer art, drawing, sculpture, ceramics, printmaking A minimum of 2 units from the following: ...... 2 and design, as well as courses in art appreciation and ART 494 or 499 art history. Through the program’s art theory and art TOTAL UNITS REQUIRED ...... 32 practice classes, students develop an awareness and understanding of the materials, tools, rationale and VLJQLÀFDQFHRIDUWLQVRFLHW\7KHDUWFXUULFXOXP·VFULWLFDO This A.A. degree may be obtained by completion of the thinking and technical skills components encourage Required Program, plus General Education Requirements, students to utilize independent thought processes and SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO problem-solving. This program provides transfer and employment opportunities as well as personal enrichment The A.A. degree in Art is designed for students to develop for students. The art faculty is composed of professional their skills in visual arts to further their studies, as well as artists with diverse specializations encompassing the for self enrichment. Students who transfer to earn their spectrum of the classes offered. BA or BFA can continue their studies in MA and MFA. The $UWSURJUDPLQFOXGHVWZRDQGWKUHHGLPHQVLRQDOÀQHDQG Career Options applied arts, as well as study in art history. Upon completion Painter; Sculptor; Ceramist; Art Instructor; Illustrator; of their higher degrees, students can work as independent Printmaker; Computer Publishing Specialist; Commercial artists, educators, restorers, designers, etc. Designer; Gallery Director; Graphic Artist; Computer Artist Upon completion of this program, the student will be able to: Create and critique works of art using different Some career options may require more than two years techniques in visual arts, elements of art, and principles of college study. of design Create works of art and express oneself using traditional Highlights and/or contemporary materials and techniques. Art faculty who have exhibited regionally, Distinguish historical developments in the visual arts. nationally and internationally Evaluate how different subjects and aesthetic view points Opportunities to explore artistic pursuits in two- are depicted in traditional and contemporary arts. and three-dimensional media using a wide variety of materials and techniques DEGREE Regularly scheduled trips to major museums A.A. — Art, Design Guest lectures and demonstrations REQUIRED PROGRAM ...... Units DEGREE ART 300 Elementary Drawing and Composition .3 A.A. — Art, Studio Art ART 304 Figure Drawing and Composition ...... 3 ART 320 Design: Fundamentals ...... 3 REQUIRED PROGRAM ...... Units ART 323 Design: Color Theory ...... 3 ART 300 Elementary Drawing and Composition ...3 ART 370 Three-Dimensional Design ...... 3 ART 304 Figure Drawing and Composition ...... 3 PHOTO 400 Digital Imaging ...... 3 ART 320 Design: Fundamentals ...... 3 A minimum of 2 units from the following: ...... 2 ART 323 Design: Color Theory ...... 3 CISA 330; CMED 300; PHOTO 410 ART 370 Three-Dimensional Design ...... 3 A minimum of 3 units from the following: ...... 3 A minimum of 6 units from the following: ...... 6 ARTH 300, 303, 309, 311, 312, 326, 332, 333 ARTH 300, 303, 304, 306, 307, 309, 311, 312, 313, 78 Art Folsom Lake College 2011-2012 A minimum of 2 units from the following: ...... 2 A minimum of 2 units from the following: ...... 2 ART 494, 499 ARTH 495, 499 ...... 2 TOTAL UNITS REQUIRED ...... 25 TOTAL UNITS REQUIRED ...... 23 This A.A. degree may be obtained by completion of the This A.A. degree may be obtained by completion of the Required Program, plus General Education Requirements, Required Program, plus General Education Requirements, SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO The A.A. Degree in Art History is designed for students The A.A. degree in Design is designed for students to to continue their education in Art History and Art develop their skills in Design areas to further their studies Administration as well as for students who seek self as well as for self enrichment. Students who transfer to earn HQULFKPHQWLQWKHÀHOGRI$UW+LVWRU\6WXGHQWVDIWHUWKHLU their BA or BFA can continue their studies in MA and MFA. transfer and completion of their BA in Art History, can The Design program includes two and three dimensional, further their studies in Master’s and Ph.D. in Art History and ÀQHDQGDSSOLHGDUWVDVZHOODVVWXG\LQDUWKLVWRU\8SRQ Art Administration. Upon the completion of their continued completion of their higher degrees, students can work education, students can work in galleries and museums as as designers in interior design, industrial design, graphic docents, programmers, curators, etc., as well as working for design, commercial areas, independent artists, and design private collectors and public organizations in the related consultant, educators, etc. ÀHOGVDVZHOODVHGXFDWRUVZULWHUVHWF Upon completion of this program, the student will be able to: Upon completion of this program, the student will be able to: Create, and critique, works of art using different Identify the roles and contributions of artists throughout techniques in visual arts, elements of art, and principles history. of design. Identify and evaluate works of art and architecture Create works of art using materials that are traditional according to their appropriate style and time period. and/or contemporary Analyze and critique art and architecture within the Identify the important roles and functions of design context of their function and meaning. HOHPHQWVLQÀQHDQGDSSOLHGDUWV Research and analyze meanings and purposes behind Analyze and understand the visual forms using art and architecture. different techniques Analyze art, architecture, and artifacts for their Express individual or collective ideas through visual FXOWXUDOVLJQLÀFDQFH forms Distinguish historical developments of design in traditional visual and commercial arts. Art (ART) Evaluate how different styles and aesthetic viewpoints are depicted in traditional and contemporary art. ART 294 TOPICS IN ART .5-4 UNITS Prerequisite: None. DEGREE Hours: 18 hours LEC ; 54 hours LAB A.A. — Art, Art History This course is designed for lifelong learners or art major students who seek LQGHSWKVWXG\RIGUDZLQJWHFKQLTXHVLQDSDUWLFXODUPHGLXP7KLVLVQRWD REQUIRED PROGRAM ...... Units transfer level course. Students may take this course up to four times based on ARTH 300 Introduction to Art ...... 3 topic choices without duplication. Students are required to purchase materials ARTH 303 Art Survey: Ancient to 14th Century...... 3 needed for the course. ARTH 309 Art Survey: Renaissance to 19th Century ...... 3 ART 300 ELEMENTARY DRAWING AND COMPOSITION 3 UNITS ARTH 311 Art Survey: Modern Art ...... 3 Prerequisite: None. A minimum of 3 units from the following: ...... 3 General Education: AA/AS Area I; CSU Area C1 ARTH 312, 324, 326, 328, 330, 332, 333 Course Transferable to UC/CSU A minimum of 3 units from the following: ...... 3 Hours: 36 hours LEC ; 54 hours LAB ARTH 304, 306, 307, 313, 314, 318; HIST 307, 308; This course covers the fundamentals of drawing emphasizing the use of line, HUM 300, 310, 332 shape, value, perspective, space, and composition. It introduces and uses various A minimum of 3 units from the following: ...... 3 media and techniques for drawing. This is a foundation requirement for all art ART 300, 304, 310, 312, 316, 320, 322, 323, 325, 327, students. Students will need to purchase art materials and tools. This course 330, 332, 334, 336, 361, 364, 370, 372, 383, 390, 402 may be taken twice for credit. Folsom Lake College 2011-2012 Art 79 ART 302 ELEMENTARY DRAWING AND COMPOSITION 3 UNITS ART 310 PEN AND INK DRAWING 3 UNITS Prerequisite: ART 300 with a grade of “C” or better Prerequisite: None. General Education: CSU Area C1 Advisory: ART 300 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course expands on the drawing skills presented in ART 300 and covers This course covers different techniques and materials used in pen and ink more complex problems in observation, personal expression, and the formal drawing. Topics include the historical development of pen and ink drawings exploration of composition. Students investigate subject, form, and content by different artists; study of lines and values to depict different subjects and through the elements of art, principles of design, as well as diverse materials textures; and use of elements of art and principles of design to create works and techniques; and historical and contemporary approaches to drawing. of art. The students are required to purchase materials needed for the course. Students will need to purchase art materials and tools. This course may be taken twice for credit. ART 312 PORTRAIT DRAWING 3 UNITS Prerequisite: None. ART 304 FIGURE DRAWING AND COMPOSITION 3 UNITS Advisory: ART 300 Prerequisite: ART 300 with a grade of “C” or better General Education: CSU Area C1 General Education: AA/AS Area I; CSU Area C1 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course is an introduction to and exploration of the human face as a subject 7KLVVWXGLRFODVVRIIHUVGUDZLQJIURPWKHKXPDQÀJXUH7KHUHZLOOEHOHFWXUHV in art. Focus will be placed on the development of skills needed to portray DQGGLVFXVVLRQRQSURSRUWLRQDQDWRP\DQGWKHUHODWLRQVKLSRIWKHÀJXUHWR VSHFLÀFLQGLYLGXDOVUDWKHUWKDQDJHQHUDOL]HGLPDJH7KLVLVSULPDULO\DSUDFWLFH space and composition. This course may be taken twice for credit. Student may course including elements of the history and traditions of portraiture as well wish to challenge the prerequisite by presenting to the instructor a portfolio as anatomy. Students will need to purchase art materials and tools. The course of their work. may be taken twice for credit. ART 305 FIGURE DRAWING AND COMPOSITION 3 UNITS ART 316 CARTOONING 3 UNITS Prerequisite: ART 304 with a grade of “C” or better Prerequisite: ART 300. Grade of “C” or better required to meet prerequisite. General Education: CSU Area C1 Course Transferable to CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course is an introduction to cartoon drawing, styles, and content This course utilizes the skills acquired in ART 305 to pursue more complex work development as used for comic strips, commercial art, graphic design, LQÀJXUHGUDZLQJ7KHUHZLOOEHOHFWXUHFODVVZRUNDQGGLVFXVVLRQRISURSRUWLRQ periodicals, political cartoons, and animation. This course may be taken two DQDWRP\DQGWKHUHODWLRQVKLSRIWKHÀJXUHWRLWVHQYLURQPHQWERWK\VSDWLDOO\ times for credit. and compositionally. This course may be taken twice for credit. ART 320 DESIGN: FUNDAMENTALS 3 UNITS ART 308 PERSPECTIVE DRAWING 3 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area I; CSU Area C1 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course introduces the study of linear, atmospheric, and isometric This is a studio course which covers the elements of art (line, shape, color, perspectives to create spatial relationship in drawings. Topics include historical texture, and space) and principles of design (such as unity, variety, balance, development of linear and atmospheric perspectives during the Renaissance movement, dominance, proportion, and economy) and the application of these and the development of atmospheric perspective in Asia; incorporation of HOHPHQWVLQERWKÀQHDQGDSSOLHGDUWV7KLVLVDUHTXLUHGFRXUVHIRUVWXGHQWV perspective in two dimensional arts; and creating spatial relationships through pursuing an AA in Studio Art and Design. The students are required to purchase the use of different perspectives. Field trips are required for this course. materials needed for the course. 80 Art Folsom Lake College 2011-2012 ART 322 DESIGN: IMAGE AND CONTENT 3 UNITS ART 328 PAINTING 3 UNITS Prerequisite: None. Prerequisite: ART 327 with a grade of “C” or better Advisory: ART 320 General Education: CSU Area C1 General Education: AA/AS Area I Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This is an intermediate studio painting course for the student who wishes This course emphasizes study of images and their meanings based on the use of to expand technical skills and work in a more independent framework. The elements of art (line, shape, color, texture, and space) and principles of design student will initiate and execute progressively complex assignments. Students (unity, variety, balance, proportion, dominance, movement, and economy). Topics must purchase all supplies for this course. This course may be taken two times include the historical development of visual images, the relationship between for credit. image and content, the use of different materials and techniques to create forms, images as visual expressions, and the use of elements of art and principles ART 330 MURAL PAINTING 3 UNITS of design. Students are required to purchase materials needed for the course. Prerequisite: None. Advisory: ART 300 and 320 ART 323 DESIGN: COLOR THEORY 3 UNITS General Education: AA/AS Area I Prerequisite: None. Course Transferable to CSU General Education: AA/AS Area I; CSU Area C1 Hours: 36 hours LEC ; 54 hours LAB Course Transferable to UC/CSU This course provides a survey of mural painting as a public art form. The course Hours: 36 hours LEC ; 54 hours LAB introduces the historical use of mural painting and examines the process This course covers studio practices in the application and understanding of color of creating a mural painting by analyzing a site, researching, planning, and DVWKH\DUHXVHGLQWKHÀQHDQGDSSOLHGDUWV7RSLFVLQFOXGHFRORUWKHRU\LWV executing murals in public space, and working collaboratively with others. applications in two and three dimensional art, and historical use of colors in the Field trips are required to execute the work on location if applied. Students visual arts. Students will need to purchase art supplies needed for the course. DUHUHTXLUHGWRSXUFKDVHVHOHFWHGPDWHULDOVQHHGHGIRUWKHFRXUVHDVVSHFLÀHG by the instructor. ART 325 INTRODUCTION TO GRAPHIC DESIGN 3 UNITS Prerequisite: None. ART 332 OIL PAINTING 3 UNITS Advisory: ART 300 and 320 Prerequisite: None. Course Transferable to CSU Advisory: ART 300 and 320 Hours: 36 hours LEC ; 54 hours LAB Course Transferable to CSU This course is an introduction to the graphic design. Topics include historical Hours: 36 hours LEC ; 54 hours LAB development of graphic design; typography; layout; logo; symbol; pictogram; This course is an introduction to the medium and techniques used in oil painting. relationship between text and image; terminology in graphic design; creating Topics include indirect and direct painting techniques in oil, application of works of art for different audiences; and application of principles of design to elements of art and principles of design to depicting diverse subjects in FUHDWHZRUNVRIDUWEDVHGRQKDQGVRQVWXGLRH[SHULHQFH6WXGHQWVDUHUHTXLUHG naturalistic and abstract representations, and expressing oneself through the to purchase any supplies needed for the course. medium. Students are required to purchase supplies needed for the course. ART 327 PAINTING 3 UNITS ART 334 ACRYLIC PAINTING 3 UNITS Prerequisite: ART 300 with a grade of “C” or better Prerequisite: None. General Education: CSU Area C1 Advisory: ART 300 and 320 Course Transferable to UC/CSU Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course is an introduction to the tools, materials, and techniques used in This course is an introduction to the medium and techniques used in acrylic painting. Coursework includes exercises in light and color theory, description painting. Topics include a historical development of acrylic as a painting medium, of form, color and spatial development, and composition. Students will need to techniques used in acrylic painting, and media used in acrylic painting. Students purchase art materials and tools. This course may be taken two times for credit. are required to purchase supplies needed for the course. ART 336 WATERCOLOR PAINTING 3 UNITS Prerequisite: ART 300 with a grade of “C” or better Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB This course is an introduction to transparent watercolor painting. The course topics include various materials and brush techniques in watercolor, color theory, and composition. Students will need to purchase art materials and tools. This course may be taken two times for credit. Folsom Lake College 2011-2012 Art 81 ART 337 INTERMEDIATE WATERCOLOR PAINTING 3 UNITS ART 373 INTERMEDIATE SCULPTURE 3 UNITS Prerequisite: ART 336. Grade of “C” or better required to meet prerequisite. Prerequisite: ART 372 with a grade of “C” or better Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB 7KLVFODVVEXLOGVRQVNLOOVGHYHORSHGLQ$57,WLQFOXGHVDQLQGHSWKVWXG\ This is an intermediate course in the practice of the expressive use of form in of contemporary methods and concepts in transparent watercolor. Emphasis WKUHHGLPHQVLRQDOVSDFH,WXWLOL]HVWUDGLWLRQDODGGLWLYHDQGVXEWUDFWLYHPHGLD is given to different approaches in watercolor, composition, technical problems such as clay and plaster, as well as constructive media such as metal, wood, and solutions, and individual style development. This course may be taken two IRXQGREMHFWVDQGRWKHUPDWHULDOV,WXWLOL]HVDSUREOHPVROYLQJIRUPDWLQRUGHU times for credit. Students may wish to challenge the prerequisite on the basis to develop knowledge of technical process, formal vocabulary, and individual of equivalent experience. expression. It examines both historical and contemporary approaches in developing form and content. Students will need to purchase art materials ART 361 PRINTMAKING: SURVEY 3 UNITS and tools. This course may be taken two times for credit. Students may wish Prerequisite: None. to challenge the prerequisite on the basis of equivalent experience. General Education: AA/AS Area I Course Transferable to UC/CSU ART 383 METAL DESIGN: EMPHASIS IN FABRICATION 3 UNITS Hours: 36 hours LEC ; 54 hours LAB Prerequisite: None This is a printmaking survey course which may include relief (wood and Course Transferable to CSU linoleum), intaglio (engraving, etching and drypoint), and planograph Hours: 36 hours LEC ; 54 hours LAB (silkscreening, collagraphy, and monotype) processes. Students will need to This course covers historical and contemporary approaches to fabrication of purchase art materials and tools. This course may be taken two times for credit. metal and jewelry design. Sculptural jewelry forms will be made utilizing processes of fabricating, surfacing, soldering, forming and forging of metals. ART 364 PRINTMAKING: RELIEF 3 UNITS Basic methods and techniques for use with silver and base metals will be Prerequisite: None. covered. Advisory: ART 300 and 320 Course Transferable to CSU ART 386 INTERMEDIATE METAL DESIGN: EMPHASIS IN Hours: 36 hours LEC ; 54 hours LAB FABRICATION 3 UNITS This course covers the techniques of relief printmaking by hand and by printing Prerequisite: ART 383 with a grade of “C” or better press. Topics include historical development of relief printmaking, materials, Course Transferable to CSU and techniques used in relief prints using wood and linoleum. Students are Hours: 36 hours LEC ; 54 hours LAB required to purchase supplies needed for the course. This is an intermediate course offering a historical and contemporary approach to fabrication of metal and jewelry design. Techniques may include ART 370 THREE DIMENSIONAL DESIGN 3 UNITS forging, raising hollow forms, and the use of the hydraulic press in anticlastic Prerequisite: None. and synclastic raising, matrix die forming and embossing molds. This is a General Education: AA/AS Area I; CSU Area C1 concentrated study of intermediate work in elements of metal design and form. Course Transferable to UC/CSU Students need to purchase metals and some required tools. Hours: 36 hours LEC ; 54 hours LAB 7KLVLVDVWXGLRFRXUVHFRYHULQJWKHVWXG\RIWKUHHGLPHQVLRQDOGHVLJQV&RXUVH ART 387 INTERMEDIATE METAL DESIGN: EMPHASIS IN topics include application of the elements of art and principles of design to FORMING 3 UNITS create three dimensional forms. Use of diverse materials and techniques used Prerequisite: ART 383 with a grade of “C” or better in three dimensional forms will be included. Students will need to purchase Course Transferable to CSU art materials and tools. Hours: 36 hours LEC ; 54 hours LAB This is an intermediate course offering a historical and contemporary approach ART 372 SCULPTURE 3 UNITS to the forming of metal and jewelry design. This class encompasses the wide Prerequisite: None. UDQJHRISURFHGXUHVXVHGWRFRQYHUWÁDWPHWDOLQWRYROXPHWULFIRUPXVLQJ General Education: AA/AS Area I; CSU Area C1 the hydraulic press and the rolling mill in forming three dimensional metal Course Transferable to UC/CSU objects. Students may take this course twice in each topic: Hydraulic Press Hours: 36 hours LEC ; 54 hours LAB Forming and Rolling Mill Forming. Students will need to purchase metals and This course provides basic practice in the expressive use of form and color in some required tools. WKUHHGLPHQVLRQDOVSDFH6WXGHQWVZLOOOHDUQWHFKQLFDOVNLOOVLQFOXGLQJFDVWLQJ additive, and reductive/carving sculptural methods, as well as construction and assemblage methods. Students will need to purchase art materials and tools. This course may be taken two times for credit. 82 Art & Art History Folsom Lake College 2011-2012 ART 390 CERAMICS 3 UNITS ART 494 TOPICS IN ART .5-4 UNITS Prerequisite: None. Prerequisite: None General Education: AA/AS Area I Advisory: ART 300 and 320. Course Transferable to UC/CSU Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 54 hours LEC ; 54 hours LAB This course is a beginning ceramic class in hand building and wheel throwing Designed to give students an opportunity to study topics not included in current techniques. Clay forming skills of pinch, coil, slab, press, and slump molds are course offerings. May be taken four times for credit, providing there is no covered, as well as an introduction to the potter’s wheel. The geology of clay duplication of topics. DQGJOD]HVLVLQFOXGHG0HWKRGVRIJOD]LQJDQGÀULQJDUHVWXGLHG+LVWRULFDO and modern ceramic traditions provide the context for this course material. ART 495 INDEPENDENT STUDIES IN ART 1-3 UNITS Students will need to purchase clay and some required tools. This course may Prerequisite: None be taken two times for credit. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB ART 402 BEGINNING CLAY SCULPTURE 3 UNITS ART 499 EXPERIMENTAL OFFERING IN ART .5-4 UNITS Prerequisite: None. Prerequisite: None Course Transferable to UC/CSU Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 18 hours LEC ; 54 hours LAB 7KLVFRXUVHLVDQLQWURGXFWLRQWRWKHEDVLFKDQGEXLOGLQJWHFKQLTXHVDQGPHWKRGV devoted to three dimensional and relief sculptural forms in clay. The course WRSLFVLQFOXGHJOD]LQJDQGÀULQJSURFHVVHVXVHGLQFOD\VFXOSWXUH6WXGHQWV will need to purchase art materials and tools. This class may be taken two Art History (ARTH) times for credit. ARTH 300 INTRODUCTION TO ART 3 UNITS Prerequisite: None. ART 404 INTERMEDIATE CLAY SCULPTURE 3 UNITS Advisory: ENGWR 101 Prerequisite: ART 402 with a grade of “C” or better General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 54 hours LEC This course is an intermediate class in ceramic sculpture techniques and This is an introduction to the visual arts and architecture in various world PHWKRGV7KHFODVVZLOOLQFOXGHJOD]LQJVXUIDFHWUHDWPHQWDQGYDULRXVÀULQJ cultures. Lecture and discussion include an overview of different materials and SURFHVVHVXVHGLQFOD\VFXOSWXUH)RFXVZLOOEHSODFHGRQLQGHSWKH[DPLQDWLRQ techniques that are used for the visual arts such as drawing, painting, sculpture, of contemporary ceramic sculpture. Students will need to purchase art materials artifacts, architecture, and printmaking. Topics also include the meaning and and tools. This class may be taken two times for credit. function of art, roles of artists, elements of art, and principles of design to develop visual literacy. It is a required course for art history majors. ART 430 ART AND CHILDREN 3 UNITS Prerequisite: None. ARTH 303 ART SURVEY: ANCIENT TO 14TH CENTURY 3 UNITS General Education: AA/AS Area I; CSU Area C1 Prerequisite: None. Course Transferable to CSU Advisory: ARTH 300 and ENGWR 101 Hours: 36 hours LEC ; 54 hours LAB General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A This is an exploratory course in children’s art; dealing with the three aspects Course Transferable to UC/CSU of art: seeing and feeling visual relationships, producing works of art, and Hours: 54 hours LEC knowing and understanding art objects. Students will select art as it relates to 7KLVFRXUVHLVDVXUYH\RIZRUOGDUWIURPWKH3UHKLVWRULFSHULRGWRWKHWK the child’s growth and development. This course is suggested for recreational century. The lecture and discussion include the developments of the visual arts OHDGHUVKLSSUHVFKRRO.WHDFKHUVDQGFDUHJLYHUV DQGDUFKLWHFWXUHRIWKHZHVWHUQDQGQRQZHVWHUQFXOWXUHV7KLVLVDUHTXLUHG class for art history major students. ART 447 CREATING SUPPORTS FOR PAINTING 2 UNITS Prerequisite: None. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB This course is an introductory course on creating different types of supports for painting. Topics include preparing wood panels for oil and acrylic painting, stretching canvas, and stretching papers. This course is recommended for students who are majoring in studio art with painting emphasis or/and lifelong learners who wish to improve their skills in creating different supports for painting. Students are required to purchase materials needed for the course. Folsom Lake College 2011-2012 Art History 83 ARTH 304 ANCIENT ART 3 UNITS ARTH 312 WOMEN IN ART 3 UNITS Prerequisite: None. Prerequisite: None. Advisory: ARTH 300 and ENGWR 101 Advisory: ARTH 300 and ENGWR 101 General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course covers the development of Western art from the Prehistoric era This is a survey course of women’s art: the depiction of women in the visual through the Roman period. Lecture and discussion focus on the visual arts and arts and the female artists and their works of art from the Middle Ages through architecture from the ancient Near Eastern, Egyptian, Greek, and Roman cultures. WKHVWFHQWXU\7KHOHFWXUHDQGGLVFXVVLRQLQFOXGHERWK(XURSHDQDQGQRQ European arts of women. ARTH 306 MEDIEVAL ART 3 UNITS Prerequisite: None. ARTH 313 HISTORY OF WESTERN ARCHITECTURE: PREHISTORIC Advisory: ARTH 300 and ENGWR 101 TO RENAISSANCE 3 UNITS General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Prerequisite: None. Course Transferable to UC/CSU Advisory: ARTH 300 and ENGWR 101 Hours: 54 hours LEC General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A This course is an introduction to Medieval arts and architecture from the fall of Course Transferable to UC/CSU Roman empire through late Gothic period. The lecture and discussion include Hours: 54 hours LEC the Early Christian, Byzantine, Celtic, Islamic, Romanesque, and Gothic arts. This course covers the history of Western Architecture from Prehistory to the Renaissance. Lecture and discussion include the development of architecture ARTH 307 ITALIAN RENAISSANCE ART 3 UNITS from c. 2500 B.C.E. to c. 1500 C.E.; architectural methods; relationship between Prerequisite: None. WKHDUFKLWHFWXUHDQGWKHFXOWXUH DQGFRPSDULVRQDQGFRQWUDVWZLWK1RQ:HVWHUQ General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A architecture. Course Transferable to UC/CSU Hours: 54 hours LEC ARTH 314 HISTORY OF WESTERN ARCHITECTURE: RENAISSANCE This course introduces the visual arts and architecture of Italy from duecento TO MODERN 3 UNITS (13th century) through cinquecento (16th century). Topics include the relationship Prerequisite: None. EHWZHHQWKHYLVXDODUWVDQGFXOWXUHDQGDUWLVWVDQGWKHLUZRUNVIURP3URWR Advisory: ARTH 300 and ENGWR 101 Renaissance, Renaissance, High Renaissance, and Mannerism. General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU ARTH 309 ART SURVEY: RENAISSANCE TO 19TH CENTURY Hours: 54 hours LEC 3 UNITS This course covers the history of Western Architecture from the Renaissance to Prerequisite: None. the 19th century modern time. Topics include architecture from Renaissance, Advisory: ARTH 300 and ENGWR 101 High Renaissance, Mannerism, Baroque, Rococo, and Neoclassicism periods in General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Europe and America and the meanings and functions of architecture within Course Transferable to UC/CSU Western culture. Hours: 54 hours LEC 7KLVFRXUVHLVDVXUYH\RIDUWIURPWKH3URWR5HQDLVVDQFH WKDQGWK ARTH 318 HISTORY OF AMERICAN ART 3 UNITS centuries) to Romanticism (19th century). The course examines paintings, Prerequisite: None. VFXOSWXUHVJUDSKLFDUWDUWLIDFWVDQGDUFKLWHFWXUHIURPZHVWHUQDQGQRQZHVWHUQ Advisory: ARTH 300 and ENGWR 101 cultures. This is a required class for art history major students. General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU ARTH 311 ART SURVEY: MODERN ART 3 UNITS Hours: 54 hours LEC Prerequisite: None. 7KLVFRXUVHFRYHUV$PHULFDQDUWIURPSUHFRORQLDOSHULRGWRWKHSUHVHQWGD\ Advisory: ARTH 300 and ENGWR 101 Lecture and discussion include visual arts and architecture of the Native General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Americans prior to the arrival of Europeans and Colonial periods, Early Course Transferable to UC/CSU American art and architecture, 19th century, 20th century, and the early 21st Hours: 54 hours LEC century American arts. This course is a survey of modern art from the mid 19th century to the late 20th century. Through lecture and discussion, the course examines visual arts and architecture from Europe and America. This is a required course for art history major students. 84 Art History Folsom Lake College 2011-2012 ARTH 324 ART OF THE AMERICAS 3 UNITS ARTH 333 INTRODUCTION TO ISLAMIC ART 3 UNITS Prerequisite: None. Prerequisite: None. Advisory: ARTH 300 and ENGWR 101 General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1; IGETC Area 3A General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Course Transferable to UC/CSU See UC Limitations & Counselor Hours: 54 hours LEC Hours: 54 hours LEC This course covers the visual arts and architecture of indigenous Mesoamerica This is a survey course that studies the art and culture of the Middle East. It and South America. Topics include the relationship between art and beliefs, primarily focuses on the Islamic Art and Architecture and provides fundamental materials and techniques used in art and architecture, and comparison and information on the formation of Islamic art, its history and philosophy. The contrast between the Mesoamerican and South American cultures. students will learn to identify works of art produced by artists from Muslim countries and regions. They will also be able to describe in writing characteristics ARTH 326 TRADITIONAL NATIVE AMERICAN ART 3 UNITS and key elements in Islamic Art and Architecture. This course will include but Prerequisite: None. not limited to visual examples from Arabic, Persian and Indian cultures. General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU ARTH 495 INDEPENDENT STUDIES IN ART HISTORY 1-3 UNITS Hours: 54 hours LEC Prerequisite: None. 7UDGLWLRQDO1DWLYH$PHULFDQFXOWXUHVH[HPSOLÀHGWKHLUUHOLJLRXVSKLORVRSK\DQG Course Transferable to CSU reverence for nature in the utilitarian and art objects they created with clay, Hours: 54 hours LEC VWRQHÀEHUDQGZRRG7KLVFODVVLQWURGXFHVWKHKLVWRU\FXOWXUHP\WKRORJ\DQG This course involves a student working individually on a topic of study and art of the Southwest, Nevada and California Native Americans. research beyond the scope of regularly offered courses. Upon the approval of the proposed topic, the student will work and keep in contact with the advisory ARTH 328 SURVEY OF AFRICAN ART 3 UNITS faculty to successfully complete the topic study. Students may take this course Prerequisite: None. up to four times without duplication of the topics. Advisory: ARTH 300 and ENGWR 101 General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1; IGETC Area 3A ARTH 499 EXPERIMENTAL OFFERING IN ART HISTORY .5-4 UNITS Course Transferable to UC/CSU Prerequisite: None Hours: 54 hours LEC Course Transferable to CSU This course covers the visual arts and architecture of Africa. Topics include Hours: 18 hours LEC ; 54 hours LAB cultural and philosophical background of African arts, materials and techniques used, and the impact of African art to Western art. ARTH 330 SURVEY OF AFRICAN-AMERICAN ART 3 UNITS Prerequisite: None. Advisory: ARTH 300 and ENGWR 101 General Education: AA/AS Area I (effective Fall 2009); AA/AS Area VI (effective Fall 2009); CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Hours: 54 hours LEC This course covers the visual arts and architecture of black artists in America. 7RSLFVLQFOXGHWKHURRWVRI$IULFDQ$PHULFDQDUWWKH+DUOHP5HQDLVVDQFHDQG WKHSROLWLFDODQGVRFLDOUHSUHVHQWDWLRQVRIWKH$IULFDQ$PHULFDQFXOWXUH ARTH 332 ASIAN ART 3 UNITS Prerequisite: None. Advisory: ARTH 300 and ENGWR 101 General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Hours: 54 hours LEC This course is a survey of Asian arts and architecture from the Prehistoric era to the contemporary. The course examines arts from China, India, Korea, and Japan. The lecture and discussion include the development of Eastern philosophy and beliefs and their relationship to the visual arts. Folsom Lake College 2011-2012 Biology 85 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Biology COUNSELING Rancho Cordova Center - 916-255-0717 PHYS 350 General Physics (4) and DEGREE A.S. - Biology: Biological Sciences PHYS 360 General Physics (4) or PHYS 411 Mechanics of Solids and Fluids (4) and Folsom Lake College’s Biology program offers courses which PHYS 421 Electricity and Magnetism (4) and satisfy general education requirements in Life Sciences, are PHYS 431 Heat, Waves, Light & Modern Physics (4) prerequisites for a degree in the Environmental Sciences ...... 8-12 or the health professions. In addition, the program helps TOTAL UNITS REQUIRED ...... 39-47 prepare students for transfer opportunities to four-year programs in biological sciences, nursing, physical therapy, and programs leading to careers in teaching, medicine, This A.S. degree may be obtained by completion of the dentistry, veterinary medicine, etc. All programs seek to Required Program, plus General Education Requirements, develop critical thinking skills while fostering a lasting SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO appreciation of biology. Students planning to continue for a four-year degree should consult the lower division Upon completion of this program, the student will be able to: requirements of the transfer program of the university to Apply acquired knowledge, skills, and abilities toward which they plan to attend. successful completion of coursework at transfer institutions. Demonstrate knowledge of the language, facts, and Career Options concepts that serve as the foundation for working Nursing/Physician’s Assistant/Physical Therapy; Teaching; independently on more complex problems. Microbiology; Wildlife Biology; Marine Biology; Employ appropriate information-gathering tools to Pharmacy; Medicine/Dentistry/Veterinary Medicine; LQYHVWLJDWHVFLHQWLÀFPDWWHUV Optometry; Research; Nutrition &OHDUO\FRPPXQLFDWHVFLHQWLÀFLQIRUPDWLRQERWKRUDOO\ Some career options may require more than two years of and in written form, to diverse audiences. college study. Classes beyond the associate degree may be Demonstrate laboratory habits consistent with accepted UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ practices for safety, documentation, and core techniques. for transfer to a university program. Analyze data sets, recognize the implications of disturbances to biological systems, and synthesize information to draw conclusions. DEGREE 'LIIHUHQWLDWHEHWZHHQVFLHQWLÀFDOO\GHULYHGNQRZOHGJH A.S. — Biology: Biological Sciences myth, and conjecture in professional or everyday encounters with information. Biology programs at FLC seek to prepare lower division Recognize and discuss ethical implications of biological students for transfer to higher education institutions, entry research when encountered in personal, community, and into vocational programs, or science-related employment. VFLHQWLÀFLVVXHV All programs seek to develop critical thinking skills while Engage in free exchange of ideas to support creative fostering a lasting appreciation of biology. problem solving. REQUIRED PROGRAM ...... Units BIOLOGY CONCENTRATION OPTION BIOL 400 Principles of Biology ...... 5 BIOL 410 Principles of Botany ...... 5 BIOL 420 Principles of Zoology...... 5 CHEM 400 General Chemistry ...... 5 CHEM 401 General Chemistry ...... 5 MATH 350 Calculus for the Life & Social Sciences I (3) and MATH 351 Calculus for the Life & Social Sciences II (3) or MATH 400 Calculus I (5) and MATH 401 Calculus II (5) ...... 6-10 86 Biology Folsom Lake College 2011-2012 HEALTH SCIENCE / PRE-PROFESSIONAL OPTION PRE-NURSING OPTION BIOL 400 Principles of Biology ...... 5 BIOL 430 Anatomy and Physiology ...... 5 BIOL 410 Principles of Botany ...... 5 BIOL 431 Anatomy and Physiology ...... 5 BIOL 420 Principles of Zoology...... 5 BIOL 440 General Microbiology ...... 4 CHEM 400 General Chemistry ...... 5 CHEM 305 Introduction to Chemistry ...... 5 CHEM 401 General Chemistry ...... 5 CHEM 306 Introduction to Chemistry ...... 5 CHEM 420 Organic Chemistry ...... 5 FCS 324/PSYC 370 ...... CHEM 421 Organic Chemistry ...... 5 Human Development: A Life Span ...... 3 MATH 350 Calculus for the Life & Social Sciences I (3) NUTRI 300 Nutrition ...... 3 and PSYC 300 General Principles (3) or MATH 351 Calculus for the Life & Social Sciences II (3) PSYC 320 Social Psychology ...... 3 or TOTAL UNITS REQUIRED ...... 33 MATH 400 Calculus I (5) and MATH 401 Calculus II (5) ...... 6-10 NOTE: This degree is designed for students intending to transfer PHYS 350 General Physics (4) and to a nursing program at a four-year college or university. It PHYS 360 General Physics (4) or does not prepare the student for immediate employment as a PHYS 411 Mechanics of Solids and Fluids (4) and nurse. Students earning a nursing degree will need to complete PHYS 421 Electricity and Magnetism (4) and several lower division nursing classes when transferring. PHYS 431 Heat, Waves, Light & Modern Physics (4) ...... 8-12 This A.S. degree may be obtained by completion of the TOTAL UNITS REQUIRED ...... 49-57 Required Program, plus General Education Requirements, SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO This A.S. degree may be obtained by completion of the Required Program, plus General Education Requirements, Upon completion of this program, the student will be able to: SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Utilize acquired knowledge, skills, and abilities toward successful completion of coursework at transfer institutions. Upon completion of this program, the student will be able to: Demonstrate knowledge of the language, facts, and Apply acquired knowledge, skills, and abilities toward concepts that serve as the foundation for working successful completion of coursework at transfer independently on more complex problems. institutions. Employ appropriate information-gathering tools to Demonstrate knowledge of the language, facts, and investigate health-related matters. concepts that serve as the foundation for working &OHDUO\FRPPXQLFDWHVFLHQWLÀFLQIRUPDWLRQERWKRUDOO\ independently on more complex problems. and in written form, to diverse audiences. Employ appropriate information-gathering tools to Demonstrate laboratory habits consistent with accepted LQYHVWLJDWHVFLHQWLÀFPDWWHUV practices for safety, documentation, and core techniques. &OHDUO\FRPPXQLFDWHVFLHQWLÀFLQIRUPDWLRQERWKRUDOO\ Demonstrate the ability to process information and and in written form, to diverse audiences. make decisions based on the quality and relevance of Demonstrate laboratory habits consistent with accepted the evidence. practices for safety, documentation, and core techniques. Utilize knowledge of the physical, cognitive, and 'LIIHUHQWLDWHEHWZHHQVFLHQWLÀFDOO\GHULYHGNQRZOHGJH social factors affecting individuals to improve human myth, and conjecture in professional or everyday interactions. encounters with information. 'LIIHUHQWLDWHEHWZHHQVFLHQWLÀFDOO\GHULYHGNQRZOHGJH Recognize and discuss ethical implications of biological myth, and conjecture in professional or everyday research when encountered in personal, community, and encounters with information. VFLHQWLÀFLVVXHV Recognize and discuss ethical implications of biological Engage in free exchange of ideas to support creative research when encountered in personal, community, and problem solving. VFLHQWLÀFLVVXHV Engage in free exchange of ideas to support creative problem solving. TOTAL UNITS REQUIRED: ...... 31-57 (Depending on option selected) Folsom Lake College 2011-2012 Biology 87 BIOL 323 ETHNOBOTANY 4 UNITS Biology (BIOL) Prerequisite: None. Advisory: ENGWR 101 and MATH 100; with a grade of “C” or better. BIOL 300 THE FOUNDATIONS OF BIOLOGY 3 UNITS General Education: AA/AS Area IV; AA/AS Area VI; CSU Area B2; CSU Area B3; Prerequisite: None. IGETC Area 5B Advisory: ENGWR 101 and MATH 100; or placement through the assessment Course Transferable to UC/CSU process. Hours: 54 hours LEC ; 54 hours LAB General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B This introductory course focuses on the concepts, questions, and methods Course Transferable to UC/CSU RIHWKQRERWDQ\WKHVFLHQWLÀFVWXG\RIWKHLQWHUDFWLRQVEHWZHHQSODQWVDQG Hours: 54 hours LEC KXPDQV6WXGHQWVZLOOXVHWKHVFLHQWLÀFPHWKRGWRLQYHVWLJDWHWKHHFRORJLFDO 7KLVFRXUVHLVDVXUYH\RIPDMRUWRSLFVLQWKHELRORJLFDOVFLHQFHVIRUWKHQRQ and biological traits of plants, how these traits have shaped multicultural science major with an emphasis on human biology. Units covered include the human use, and how plants have been affected by humans. Topics include plant origin of life, cell structure and chemistry, metabolism, Mendelian and molecular structure and reproduction, the role of biodiversity in natural and cultivated genetics, genetic engineering, evolution, anatomy and physiology of humans, systems, plant evolution under domestication, sustainable use of resources, animal behavior and ecology. ethnobotanical research techniques and ethical issues, and comparison of plant use by various cultures for food, medicine, shelter, basketry, and dyes. BIOL 307 BIOLOGY OF ORGANISMS 4 UNITS /DERUDWRU\WRSLFVLQFOXGHSODQWLGHQWLÀFDWLRQH[SHULPHQWDOLQYHVWLJDWLRQRI Prerequisite: None. medicinal and food value of selected plants, traditional preparation of selected Advisory: ENGWR 101 and MATH 100; with a grade of “C” or better SODQWVSUHSDUDWLRQRIKHUEDULXPVSHFLPHQVDQGDQDO\VLVRISODQWÀEHUVDQG General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B dyes. Field trips may be required. Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB BIOL 332 INTRODUCTION TO ORNITHOLOGY 3 UNITS This is a general biology course focusing on a survey of the plant and animal Prerequisite: None. kingdoms. The course covers the general principles of biology including: General Education: AA/AS Area IV methods of science, cell organization, genetics, evolution, ecology, biodiversity, Course Transferable to UC/CSU and anatomy. These principles are explored in more depth through the Hours: 18 hours LEC ; 108 hours LAB examination of additional topics which may include: disease and epidemiology, This introductory course covers the biology and natural history of birds. Topics physiological ecology, animal behavior, biotechnology, population growth LQFOXGHWKHHYROXWLRQDU\RULJLQVRIELUGVDQGÁLJKWDYLDQSK\VLRORJ\DQG and regulation, ecosystem ecology, and conservation biology. Evolution and sensory systems, migration, social behavior, reproduction, and conservation. biodiversity are continuing themes included in each major topic. The course is Laboratory work explores bird structure and function, and teaches the taxonomic GHVLJQHGIRUQRQVFLHQFHPDMRUVDQGLVHVSHFLDOO\XVHIXOIRUOLEHUDOVWXGLHV FODVVLÀFDWLRQDQGLGHQWLÀFDWLRQRIELUGVSDUWLFXODUO\WKRVHIRXQGLQ&DOLIRUQLD elementary education, environmental studies, recreation, and similar majors. DQGWKHZHVWHUQ8QLWHG6WDWHV/DERUDWRU\ZRUNLQFOXGHVÀHOGWULSVWRVWXG\ Field trips scheduled outside of class time may be required. ELUGLGHQWLÀFDWLRQEHKDYLRUDQGHFRORJ\ BIOL 310 GENERAL BIOLOGY 4 UNITS BIOL 350 ENVIRONMENTAL BIOLOGY 3 UNITS Prerequisite: None. Same As: ENVT 304 Advisory: ENGWR 101 and MATH 100; or placement through the assessment Prerequisite: None. process. General Education: AA/AS Area IV; CSU Area B2 General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC ; 54 hours LAB This course provides an overview of ecosystems and natural resources. Major This course is a survey of biological science with an emphasis on human topics covered include ecological principles, ecosystem functioning, conservation ELRORJ\,WLVLQWHQGHGIRUWKHQRQVFLHQFHPDMRUDVZHOODVHQYLURQPHQWDO biology, resource use (including historical and cultural values) and management, technology majors. Units covered include cell biology, metabolism, Mendelian SROOXWLRQDQGRWKHUKXPDQFDXVHGHQYLURQPHQWDOLPSDFWV7KLVFRXUVHSURYLGHV and molecular genetics, evolution, anatomy and physiology, animal behavior, the background needed to understand major global and regional issues such as and ecology. The laboratory activities are designed to further investigate and acid rain, global warming, hazardous waste disposal, deforestation, ecological illuminate each topic area. sustainability and endangered species recovery. BIOL 350 is especially useful for Environmental Technology, Environmental Sciences, Ecology, Recreation, Education and Political Science majors. This course is the same as ENVT 304. You cannot enroll in this course if you have passed ENVT 304. Field trips, attendance at public meetings and/or a semester project may be required. 88 Biology Folsom Lake College 2011-2012 BIOL 380 NATURAL HISTORY FIELD STUDIES: COASTAL ECOSYSTEMS BIOL 386 NATURAL HISTORY FIELD STUDIES: MARINE ECOSYSTEMS 1 UNIT 1 UNIT Prerequisite: None. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 12 hours LEC ; 18 hours LAB Hours: 12 hours LEC ; 18 hours LAB This course will study the ecology and natural history of coastal ecosystems This course will study the ecology and natural history of marine ecosystems FRYHUHGLQWKHÀHOG$QLPDOVSODQWVJHRORJ\DQGHQYLURQPHQWDOLPSDFWVXQLTXH FRYHUHGLQWKHÀHOG$QLPDOVSODQWVJHRORJ\DQGHQYLURQPHQWDOLPSDFWV to coastal areas will be studied and their interrelationships investigated. unique to ocean areas will be studied and their interrelationships investigated. $VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPVZLOOEHDQLQWHJUDOSDUWRI $VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPVTXL]]HVZLOOEHDQLQWHJUDO the course. Students will be responsible for providing their own lodging or part of the course. Students will be responsible for providing their own lodging camping equipment and meals. Campsites will be available. This course is or camping equipment and meals. Campsites will be available. This course is ideal for anyone interested in nature, environmental topics and the biological ideal for anyone interested in nature, environmental topics and the biological sciences. Teachers and resource managers seeking professional growth, and sciences. Teachers and resource managers seeking professional growth, and students from all academic disciplines are encouraged to take this course.Each students from all academic disciplines are encouraged to take this course. Each topic can be taken one time for credit. topic can be taken one time for credit. BIOL 382 NATURAL HISTORY FIELD STUDIES: DESERT ECOSYSTEMS BIOL 388 NATURAL HISTORY FIELD STUDIES: RIVER ECOSYSTEMS 1 UNIT 1 UNIT Prerequisite: None. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 12 hours LEC ; 18 hours LAB Hours: 12 hours LEC ; 18 hours LAB This course will study the ecology and natural history of desert and This course will study the ecology and natural history of river ecosystems arid ecosystems covered in the field. Animals, plants, geology, and FRYHUHGLQWKHÀHOG$QLPDOVSODQWVJHRORJ\DQGHQYLURQPHQWDOLPSDFWV HQYLURQPHQWDOLPSDFWVXQLTXHWRGHVHUWUHODWHGDUHDVZLOOEHVWXGLHGDQGWKHLU unique to rivers and riparian areas will be studied and their interrelationships LQWHUUHODWLRQVKLSVLQYHVWLJDWHG$VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPV LQYHVWLJDWHG$VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPVTXL]]HVZLOOEH will be an integral part of the course. Students will be responsible for providing an integral part of the course. Students will be responsible for providing their their own lodging or camping equipment and meals. Campsites will be available. own lodging or camping equipment and meals. Campsites will be available. This course is ideal for anyone interested in nature, environmental topics and This course is ideal for anyone interested in nature, environmental topics and the biological sciences. Teachers and resource managers seeking professional the biological sciences. Teachers and resource managers seeking professional growth, and students from all academic disciplines are encouraged to take this growth, and students from all academic disciplines are encouraged to take this course. Each topic can be taken one time for credit. course. Each topic can be taken one time for credit. BIOL 384 NATURAL HISTORY FIELD STUDY OF FOREST ECOSYSTEMS BIOL 389 NATURAL HISTORY FIELD STUDIES: WETLAND 1-4 UNITS ECOSYSTEMS 1 UNIT Prerequisite: None. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 12 hours LEC ; 18 hours LAB Hours: 12 hours LEC ; 18 hours LAB This course will study the ecology and natural history of forest ecosystems This course will study the ecology and natural history of wetland ecosystems FRYHUHGLQWKHÀHOG$QLPDOVSODQWVJHRORJ\DQGHQYLURQPHQWDOLPSDFWV FRYHUHGLQWKHÀHOG$QLPDOVSODQWVJHRORJ\DQGHQYLURQPHQWDOLPSDFWVXQLTXH unique to forest and mountain areas will be studied and their interrelationship to wetland areas will be studied and their interrelationships investigated. LQYHVWLJDWHG$VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPVTXL]]HVZLOOEH $VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPVTXL]]HVZLOOEHDQLQWHJUDO an integral part of the course. Students will be responsible for providing their part of the course. Students will be responsible for providing their own lodging own lodging or camping equipment and meals. Campsites will be available. or camping equipment and meals. Campsites will be available. This course is Additional fees for tours or transportation may also be required. This course is ideal for anyone interested in nature, environmental topics and the biological ideal for anyone interested in nature, environmental topics and the biological sciences. Teachers and resource managers seeking professional growth, and sciences. Teachers and resource managers seeking professional growth, and students from all academic disciplines are encouraged to take this course. Each students from all academic disciplines are encouraged to take this course. Each topic can be taken one time for credit. topic can be taken one time for credit. Folsom Lake College 2011-2012 Biology 89 BIOL 390 NATURAL HISTORY FIELD STUDY .5-4 UNITS BIOL 400 PRINCIPLES OF BIOLOGY 5 UNITS Prerequisite: None. Prerequisite: CHEM 305 or 400 with a grade of “C” or better; AND Intermediate Course Transferable to CSU Algebra (Math 120 or the equivalent) Hours: 48 hours LEC ; 72 hours LAB Advisory: CHEM 306 or 401 ; AND: ENGWR 101 AND ENGRD 110 with a grade 7KLVFRXUVHZLOOVWXG\WKHHFRORJ\DQGQDWXUDOKLVWRU\FRYHUHGLQWKHÀHOG of “C” or better. Animals, plants and geology will be studied and their interrelationships General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B investigated. The course(s) will be offered in the appropriate area (mountains, Course Transferable to UC/CSU GHVHUWRUVHDVKRUHDQGRFHDQ $VVLJQPHQWVÀHOGQRWHVDQGDSSURSULDWHH[DPV Hours: 54 hours LEC ; 108 hours LAB quizzes will be an integral part of the course. Students will be responsible for This course introduces universal biological principles, including biological providing their own lodging or camping equipment and meals. Campsites will molecules, enzymes, cell structure and function, biochemistry, Mendelian and be available. Additional fees for tours or transportation may also be required. molecular genetics, ecology and evolution. BIOL 400 is recommended for science This course is ideal for anyone interested in nature, environmental topics and PDMRUVDQGVWXGHQWVLQSUHSURIHVVLRQDOSURJUDPV the biological sciences. Teachers and resource managers seeking professional growth, and students from all academic disciplines are encouraged to take this BIOL 410 PRINCIPLES OF BOTANY 5 UNITS course. This course can be taken three times,without duplicating topics. Prerequisite: BIOL 400 with a grade of “C” or better Advisory: ENGWR 101 and MATH 120; with a grade of “C” or better. BIOL 392 PRINCIPLES OF HERITAGE INTERPRETATION 3 UNITS General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B Prerequisite: None Course Transferable to UC/CSU Course Transferable to CSU Hours: 54 hours LEC ; 108 hours LAB Hours: 54 hours LEC This course introduces the biology of plants, fungi, cyanobacteria, and algae. This interdisciplinary course covers the basics of interpreting historical, cultural, Topics covered include the morphology, anatomy, physiology, development, and natural resources to the general public. Interpretation is a communication FODVVLÀFDWLRQHYROXWLRQDQGHFRORJ\RIERWDQLFDORUJDQLVPVDQGRWKHUQRQ process that forges emotional and intellectual connections between the botanical organisms traditionally included in an introductory botany course for interests of the audience and the inherent meanings of the resource. Topics will ELRORJ\PDMRUV6RPHODEVPD\LQYROYHORFDOÀHOGWULSV DZHHNHQGÀHOGWULS LQFOXGH GHYHORSLQJDXGLHQFHDZDUHQHVV XQGHUVWDQGLQJUHVRXUFHLGHQWLÀFDWLRQ may be required (an alternative assignment will be available). developing a program using a thematic approach; writing measurable performance objectives; and learning program delivery techniques. Completion BIOL 420 PRINCIPLES OF ZOOLOGY 5 UNITS RIWKLVFRXUVHZLOOTXDOLI\VWXGHQWVWRDSSO\IRUSURIHVVLRQDOFHUWLÀFDWLRQWKURXJK Prerequisite: BIOL 400 with a grade of “C” or better WKH1DWLRQDO$VVRFLDWLRQIRU,QWHUSUHWDWLRQDVD&HUWLÀHG,QWHUSUHWLYH*XLGH Advisory: ENGWR 101; or placement through the assessment process. (CIG). This course is recommended for students interested in history, biology, General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B anthropology, recreation, education, and communication. Not open to students Course Transferable to UC/CSU who have received credit for ANTH 392 or HIST 392. Hours: 54 hours LEC ; 108 hours LAB 7KLVFRXUVHLVSDUWRIDWKUHHVHPHVWHUVHTXHQFHLQJHQHUDOELRORJ\IRUELRORJ\ BIOL 393 FIELD EXPERIENCE IN BIOLOGY OR HERITAGE majors. Topics include zoology with particular emphasis on comparative INTERPRETATION 2 UNITS anatomy and physiology of vertebrates and invertebrates. The basic principles Same As: ANTH 393 and HIST 393 of evolution, taxonomy, embryology, morphology, physiology, behavior and Prerequisite: None. ecology will be covered. Personal protective equipment including safety glasses Advisory: Completion of BIOL 392 or BIOL 400 with a grade of “C” or better. an disposable gloves will be required. Field trips may be required. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB BIOL 430 ANATOMY AND PHYSIOLOGY 5 UNITS This course is a cooperative effort between the college and the organizations Prerequisite: CHEM 305 with a grade of “C” or better LQYROYHGLQWKHELRORJLFDOVFLHQFHVRUWKHUHODWHGÀHOGRIKHULWDJHLQWHUSUHWDWLRQ Advisory: BIOL 310 and ENGWR 101; or placement through the assessment Internship sponsors assist students in acquisition of skills and the application process. of knowledge learned in the classroom. In addition to developing applied job General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B related skills, students will learn skills in job seeking, career goal setting, Course Transferable to UC/CSU WHDPEXLOGLQJDQGOHDGHUVKLS'XULQJWKHLQWHUQVKLSVWXGHQWVZLOOFRQWLQXHWR Hours: 54 hours LEC ; 108 hours LAB check in with the class to receive input and feedback on their experience. This This is an introductory course in which the basic principles of human course requires that the students obtain an internship during the course of the anatomy and physiology are presented in an integrated fashion. This course semester that will last a minimum of 54 hours. covers anatomical terminology, basic organic chemistry, histology, and the integumentary, skeletal, muscular and nervous systems. Both BIOL 430 and BIOL 431 must be taken to study all of the major body systems. Purchase of personal protective equipment including lab coats, safety glasses, and disposable gloves is required. 90 Biology Folsom Lake College 2011-2012 BIOL 431 ANATOMY AND PHYSIOLOGY 5 UNITS BIOL 470 BEHAVIORAL BIOLOGY 3 UNITS Prerequisite: BIOL 430 with a grade of “C” or better Prerequisite: None. Advisory: ENGWR 101; or placement through the assessment process. General Education: AA/AS Area IV; CSU Area B2; IGETC Area 5B General Education: CSU Area B2; CSU Area B3; IGETC Area 5B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC ; 108 hours LAB This course provides an overview of animal and human behavior in an This is an introductory course in which the basic principles of human anatomy evolutionary and ecological context. The course includes an introduction to and physiology are presented in an integrated fashion. This course covers the patterns of animal and human behavior, cell and physiological processes, circulatory, respiratory, urinary, immune, digestive, endocrine, and reproductive the structure and function of nervous systems, the genetics of behavior, the systems. Both BIOL 430 and BIOL 431 must be taken to study all of the major principles of evolution, and behavioral ecology. It is useful for both science body systems. Purchase of personal protective equipment including lab coats, and nonscience majors. safety glasses, and disposable gloves is required. BIOL 472 TEACHING SCIENCE TO SCHOOL-AGE CHILDREN 3 UNITS BIOL 440 GENERAL MICROBIOLOGY 4 UNITS Prerequisite: None. Prerequisite: CHEM 305 or CHEM 400 with a grade of “C” or better, or equivalent $GYLVRU\ &RPSOHWLRQRIDQ\JHQHUDOHGXFDWLRQODEVFLHQFHFRXUVH high school chemistry. Course Transferable to CSU Advisory: BIOL 307, BIOL 310, and ENGWR 101; or placement through the Hours: 54 hours LEC assessment process. This course will train future teachers in the art and skill of making elementary General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B DQGPLGGOHVFKRROVFLHQFHWHDFKLQJVXFFHVVIXODQGLQWHUHVWLQJ6WXGHQWVZLOO Course Transferable to UC/CSU JDLQKDQGVRQH[SHULHQFHZLWKQXPHURXVZD\VWRWHDFKOLIHSK\VLFDODQG Hours: 54 hours LEC ; 72 hours LAB earth science, including teaching students at an elementary or middle school. This course introduces the concepts of microbiology with an emphasis on Other topics will include how students learn, how to set up labs, lab safety, forms, modes of growth, cell specialization, mutual, commensal and parasitic environmental education, and assessment. This course is suitable for students relationships of bacteria, fungi, molds, protozoa and viruses. Topics will be majoring in education, interpretation, or science. Field trips to educational correlated with medical and health applications to animals and human beings. facilities are required. Students are required to purchase a laboratory coat, microscope slides, safety glasses, disposable gloves and a laboratory notebook. Field trips and/or a BIOL 495 INDEPENDENT STUDIES IN BIOLOGY 1-3 UNITS semester project may be required. Prerequisite: None Course Transferable to CSU BIOL 442 GENERAL BACTERIOLOGY 5 UNITS Hours: 18 hours LEC ; 162 hours LAB Prerequisite: CHEM 305 (Introduction to Chemistry), 306 (Introduction to BIOL 499 EXPERIMENTAL OFFERING IN BIOLOGY .5-4 UNITS Chemistry), or 400 (General Chemistry) with a grade of “C” or better; Or Prerequisite: None equivalent high school/college chemistry. Course Transferable to CSU Advisory: BIOL 307 (Biology of Organisms), BIOL 310 (General Biology), or Hours: 18 hours LEC ; 54 hours LAB ENGWR 101 (College Writing); or placement through the assessment process. Course Transferability to UC/CSU pending Hours: 54 hours lecture, 108 hours laboratory This course provides a survey of bacteria, viruses, fungi, protozoa, and helminths that are associated with human infectious diseases. It examines their cellular and molecular structure, physiology, metabolism, and genetics. Laboratory work introduces methods for cultivating and characterizing microorganisms. Students are required to purchase a laboratory coat, microscope slides, safety glasses, disposable gloves and a laboratory notebook. Field trips and/or a semester project may be required. Folsom Lake College 2011-2012 Business 91 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Business COUNSELING Rancho Cordova Center - 916-255-0717 DEGREES A.A. - Business, General Transfer TRANSFER IN BUSINESS ADMINISTRATION A.A. - Business, General A student transferring with upper division standing A.A. - Business, Small Business to California State University, Sacramento, College Management/Entrepreneurship of Business Administration, should have completed a A.A. - Business, Administrative minimum of 60, and a maximum of 70, transfer units. Assistant The Counseling Center has information regarding requirements, which may vary from the core listed below, CERTIFICATES OF ACHIEVEMENT at other four-year institutions. The course work may %XVLQHVV2IÀFH7HFKQLFLDQ include all of the pre-major core courses and transfer Business, Small Business general education requirements. Management/Entrepreneurship Each of the following core courses must be completed CERTIFICATE OF RECOGNITION with a grade of “C” or better: %XVLQHVV2IÀFH$VVLVWDQW Accounting 301, 311 Computer Information Science CISA 308, Folsom Lake College’s business programs are designed CISA 310, CISC 308 to provide an entrance into an exciting career. Many Economics 302, 304 opportunities are available that can lead to immediate Mathematics 343 employment and/or career advancement. FLC offers a Statistics 300 YDULHW\RIGHJUHHVDQGFHUWLÀFDWHVWRPHHWVWXGHQWV· present and future needs. Whether it is one class or a Competency in a foreign language at the 412 level is step toward a degree, there are a variety of options. required for an International Business major. FLC also offers the award-winning Students in Free Enterprise (SIFE) course for interested students. In addition to the above core, a student, in consultation with a counselor, should plan a program to meet the Career Options transfer general education requirements. Account Executive; Analyst; Bank Employee; Buyer; Clerk; Data-Entry Clerk; Data-Entry Specialist; Entrepreneur; Financial Planner; Government Service; Insurance DEGREE Representative; Investment Counselor; Manager; A.A. — Business, General 0DUNHWLQJ 0DUNHW5HVHDUFK 2IÀFH$VVLVWDQW 3XEOLF Administration; Purchasing Agent; Real Estate; Retail/ REQUIRED PROGRAM ...... Units Industrial Sales; Stockbroker; Tax Consultant ACCT 101 Fundamentals of College Accounting or ACCT 301 Financial Accounting ...... 3-4 There are some self-employment opportunities available in BUS 300 Introduction to Business ...... 3 WKHVHÀHOGV6RPHFDUHHURSWLRQVPD\UHTXLUHPRUHWKDQ BUS 310 Business Communication ...... 3 two years of college study. BUS 330 Managing Diversity in the Workplace ...... 3 Highlights BUS 340 Business Law or Additional training in courses acceptable as BUS 345 Law and Society ...... 3 electives for civil service occupations CISC 310 Intro to Computer Information Science or Hands-on experience in the use of computers for A minimum of 3 units from the following: business purposes CISA 300, 310, 320, 330, 340, CISC 300, 320 ...... 3 Opportunities for work experience in local industry ECON 302 Principles of Macroeconomics or and business ECON 320/BUS 320 Concepts of Personal Finance .....3 Training for small business management, MGMT 362 Techniques of Management ...... 3 entrepreneurship MKT 300 Principles of Marketing ...... 3 Exceptional and committed instructors An award-winning SIFE program 92 Business Folsom Lake College 2011-2012 A minimum of 3 units from the following: BUSTEC 302 Computer Keyboarding ...... 2 BUS 498 Work Experience (1-4) CISC 310 Intro to Computer Information Science (3) A minimum of 6 units selected from the following or concentrations: Accounting, Business, Computer Information A minimum of 3 units from the following: Science, Management, Marketing, or Real Estate CISA 300, 310, 320, 330, 340; CISC 300, 320 ...... 3 TOTAL UNITS REQUIRED ...... 36-37 ECON 302 Principles of Macroeconomics or ECON 320/BUS 320 Concepts of Personal Finance .3 Suggested Electives: MKT 300 Principles of Marketing ...... 3 ACCT 121, 311, 341; BUS 100, 210, 212, 214, 218, MKT 310 Selling Professionally or 350, 360; CISA 301, 302, 311, 321, 331; CISC 321, MKT 314 Advertising ...... 3 351; MGMT 176, 308, 360, 372; MKT 120, 122, 310, BUS 350 Small Business Mgmt/Entrepreneurship (3) 312, 314; RE 110, 120, 130, 300. or A minimum of 3 units from the following: This A.A. degree may be obtained by completion of the BUS 210, 212, 214, 218, 224 ...... 3 Required Program, plus General Education Requirements, BUS 498 Work Experience ...... 3 SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO TOTAL UNITS REQUIRED ...... 35-36 This program provides an overview of business fundamentals Suggested Electives: for students interested in most business occupations. The ACCT 125, 341; MGMT 362, 372. program is also recommended for general government service occupations. This A.A. degree may be obtained by completion of the Required Program, plus General Education Requirements, Upon completion of this program, the student will be able to: SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Identify and explain the major functional areas of business organizations including management, The Small Business Management degree provides training PDUNHWLQJÀQDQFHDQGDFFRXQWLQJ and education for those wishing to own or manage a small Develop leadership skills that are effective in managing entrepreneurial venture. The various elements involved in a multicultural workforce. starting and operating a small business are covered. Analyze practical business problems and integrate research and critical thinking to evaluate and recommend Upon completion of this program, the student will be able to: alternative solutions. Evaluate the feasibility of success when starting a Apply accounting concepts and principles to make new business venture. decisions about business operations. Research and compose a business plan that can be Integrate management principles in relationship to XVHGIRUSODQQLQJDVZHOODVÀQDQFLQJ ÀQDQFHSHUVRQQHOSURGXFWVVHUYLFHVDQGLQIRUPDWLRQ (PSOR\DSSURSULDWHPDQDJHPHQWÀQDQFHDFFRXQW- Communicate effectively verbally and in writing in ing, and marketing techniques required in operating various business settings. a business. Apply commonly used computer application programs Develop effective oral and written communication to create relevant business documents. skills that can be applied in various business settings. Demonstrate the ability to comprehend, apply, and DEGREE evaluate standards of ethical behavior in various A.A. — Business, Small Business Management/ business settings. Entrepreneurship Formulate original ideas and concepts in addition to integrating the ideas of others into the problem REQUIRED PROGRAM ...... Units solving process. ACCT 101 Fundamentals of College Accounting or ACCT 301 Financial Accounting ...... 3-4 DEGREE BUS 300 Introduction to Business ...... 3 A.A. — Business, General, Transfer BUS 310 Business Communication ...... 3 BUS 330 Managing Diversity in the Workplace REQUIRED PROGRAM ...... Units ...... 3 ACCT 301 Financial Accounting ...... 4 BUS 340 Business Law or ACCT 311 Managerial Accounting ...... 4 BUS 345 Law and Society ...... 3 BUS 300 Introduction to Business ...... 3 Folsom Lake College 2011-2012 Business 93 CISA 308 Exploring Word Process & Presentation BUS 310 Business Communications ...... 3 Software ...... 1 BUS 330 Managing Diversity in the Workplace ..3 CISA 310 Intro to Electronic Spreadsheets ...... 1 BUS 340 Business Law or CISC 308 Exploring Computer Environment & BUS 345 Law and Society ...... 3 the Internet ...... 1 BUS 498 Work Experience in Business ...... 1-4 ECON 302 Principles of Macroeconomics ...... 3 BUSTEC 101 Computer Keyboarding: 10-Key ...... 1 ECON 304 Principles of Microeconomics ...... 3 BUSTEC 302 Computer Keyboarding ...... 2 STAT 300 Introduction to Probability and Statistics BUSTEC 303 Computer Keyboard Formatting ...... 2 ...... 4 BUSTEC 304 Computer Keyboard Speed-& TOTAL UNITS REQUIRED ...... 24 -Accuracy Building ...... 2 CISA 301 Intermediate Word Processing ...... 1 Suggested Electives: A minimum of 5 units from the following: ACCT 341; BUS 310, 340, 345, BUSTEC 302; CISC 300, CISA 300, 310, 320, 330, CISC 300, 308, 310, 310; MATH 343, 350, 400; MGMT 362, 372; MKT 300; 320 ...... 5 RE 300. ECON 302 Principles of Macroeconomics or ECON 320 Concepts in Personal Finance ...... 3 This A.A. degree may be obtained by completion of the MGMT 362 Techniques of Management ...... 3 Required Program, plus General Education Requirements, MKT 300 Principles of Marketing ...... 3 SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO A minimum of 4 units from the following: ...... 4 This program provides the courses necessary for a transfer ACCT 121, 341; BUS 105; CISA 311 to a four-year college in business while also allowing the VWXGHQWWRVHOHFWFRXUVHVZKLFKÀWKLVKHULQGLYLGXDOQHHGV TOTAL UNITS REQUIRED ...... 45-49 and desires. This A.A. degree may be obtained by completion of the Upon completion of this program, the student will be able to: Required Program, plus General Education Requirements, Identify and explain the major functional areas SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO of business organizations including management, PDUNHWLQJÀQDQFHDQGDFFRXQWLQJ This program provides the courses necessary to transfer to a Develop leadership skills that are effective in managing 4-year college, while also allowing the student to prepare a multicultural workforce. for an entry-level position in business administration. Analyze practical business problems and integrate research and critical thinking to evaluate and recommend Upon completion of this program, the student will be able to: alternative solutions. Identify and explain the major functional areas of Apply accounting concepts and principles to make the business organizations including management, decisions about business operations. PDUNHWLQJÀQDQFHDQGDFFRXQWLQJ Integrate management principles in relationship to Apply accounting concepts and principles in making ÀQDQFHSHUVRQQHOSURGXFWVVHUYLFHVDQGLQIRUPDWLRQ decisions about business operations. Communicate effectively verbally and in writing in 0DQDJH PXOWLSOH RIÀFH WDVNV DQG XQGHUVWDQG WKH various business settings. importance of task prioritization. Apply commonly used computer application programs Develop leadership skills that are effective in managing to create relevant business documents. a multicultural workforce. Produce clear, concise and mechanically correct written business documents. DEGREE Demonstrate electronic communication skills in the A.A. — Business, Administrative Assistant SUHSDUDWLRQDQGFRPSOHWLRQRIRIÀFHFRUUHVSRQGHQFH 'HPRQVWUDWHSURÀFLHQF\LQXVLQJVRIWZDUHDSSOLFDWLRQ REQUIRED PROGRAM ...... Units (MS Word and Excel). ACCT 301 Financial Accounting or 'HPRQVWUDWHSURÀFLHQF\LQNH\ERDUGLQJDWZRUGV ACCT 101 Fundamentals of College Accounting ...3-4 per minute. BUS 100 English for the Professional ...... 3 BUS 300 Introduction to Business ...... 3 94 Business Folsom Lake College 2011-2012 CERTIFICATE OF RECOGNITION CERTIFICATE OF ACHIEVEMENT Business, 2IÀFH$VVLVWDQW Business, 2IÀFH7HFKQLFLDQ REQUIRED PROGRAM ...... Units REQUIRED PROGRAM ...... Units Core Courses: Core Courses: BUS 100 English for the Professional ...... 3 BUS 100 English for the Professional ...... 3 BUSTEC 101 Computer Keyboarding: 10-Key BUSTEC 101 Computer Keyboarding: 10-Key ...... 1 ...... 1 %867(& 6NLOOVIRU7RGD\·V2IÀFH...... 1 BUSTEC 302 Computer Keyboarding or BUSTEC 302 Computer Keyboarding or .H\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU .H\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU ...... 0-2 ...... 2 BUSTEC 303 Computer-Keyboard Formatting ..2 BUSTEC 303 Computer-Keyboard Formatting ..2 BUSTEC 304 Computer Keyboard Speed-& BUSTEC 304 Computer Keyboard Speed-& -Accuracy Bldg or -Accuracy Bldg or .H\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU .H\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU ...... 0-2 ...... 2 CISA 300 Beginning Word Processing ...... 1 CISA 300 Beginning Word Processing or CISA 310 Intro to Electronic Spreadsheets ....1 CISA 308 Exploring Word Processing & ...... CISC 300 Computer Familiarization ...... 1 Presentation Software ...... 1 2IÀFH7HFKQLFLDQ CISA 310 Intro to Electronic Spreadsheets ....1 BUSTEC 110 Administrative Procedures ...... 3 CISC 300 Computer Familiarization or CISA 301 Intermed Word Processing ...... 1 CISC 308 Exploring Computer Environments & .... CISA 311 Intermed Electr Spreadsheets ...... 1 the Internet ...... 1 Plus one (1) unit selected from:...... 1 TOTAL UNITS REQUIRED ...... 14 CISA 320 Database Management (1) CISA 340 Presentation Graphics (2) 7KLVFHUWLÀFDWHSURJUDPLVGHVLJQHGWRSURYLGHWKHWRROV TOTAL UNITS REQUIRED ...... 15-19 QHHGHGIRUHQWU\OHYHORIÀFHSRVLWLRQV7KH2IÀFH$VVLVWDQW &HUWLÀFDWHLVDSSURSULDWHIRUVWXGHQWVZKRGRQRWKDYHDQ\ 7KLVFHUWLÀFDWHSURJUDPLVGHVLJQHGWRSURYLGHWKHWRROV FOHULFDOZRUNH[SHULHQFH8SRQFRPSOHWLRQRIWKH2IÀFH QHHGHG IRU DQ HQWU\OHYHO RIÀFH SRVLWLRQ 7KH 2IÀFH $VVLVWDQW&HUWLÀFDWHWKHVWXGHQWZRXOGEHSUHSDUHGIRUDQ 7HFKQLFLDQFHUWLÀFDWHLVGHVLJQHGWRSURYLGHSURPRWLRQDO RIÀFHSRVLWLRQDVDWUDLQHH VNLOOVIRUVWXGHQWVGHVLULQJRIÀFHSRVLWLRQV8SRQFRPSOHWLRQ RIWKH2IÀFH7HFKQLFLDQFHUWLÀFDWHWKHVWXGHQWZRXOGEH Upon completion of this program, the student will be able to: SUHSDUHGIRUDQRIÀFHSRVLWLRQ 0DQDJH PXOWLSOH RIÀFH WDVNV DQG XQGHUVWDQG WKH Upon completion of this program, the student will be able to: importance of task prioritization. 0DQDJH PXOWLSOH RIÀFH WDVNV DQG XQGHUVWDQG WKH Produce clear, concise and mechanically correct written importance of task prioritization. business documents. Produce clear, concise and mechanically correct written Demonstrate electronic communication skills (internet business documents. and email). Demonstrate electronic communication skills (internet G'HPRQVWUDWHSURÀFLHQF\LQXVLQJVRIWZDUHDSSOLFDWLRQV and email). (MS Word and Excel). 'HPRQVWUDWHSURÀFLHQF\LQXVLQJVRIWZDUHDSSOLFDWLRQ 'HPRQVWUDWHSURÀFLHQF\LQNH\ERDUGLQJZSP (MS Word, Excel, PowerPoint and Database Management). 'HPRQVWUDWHSURÀFLHQF\LQNH\ERDUGLQJRIZSP ,PSOHPHQWDSSURSULDWHRIÀFHSURFHGXUHV 'HPRQVWUDWHFRPSHWHQFHXVLQJEXVLQHVVRIÀFHWHFKQRORJ\ (copy machine, fax machine, 10-key calculator). Folsom Lake College 2011-2012 Business 95 CERTIFICATE OF ACHIEVEMENT Small Business Management/Entrepreneurship Business (BUS) REQUIRED PROGRAM ...... Units BUS 100 ENGLISH FOR THE PROFESSIONAL 3 UNITS ACCT 101 Fundamentals of College Accounting ....3 Prerequisite: ENGWR 51, ESLR 310 and ESLW 310 with a grade of “C” or better; BUS 300 Introduction to Business ...... 3 or placement through the assessment process. BUS 350 Small Business ...... Hours: 54 hours LEC Management/Entrepreneurship ...... 3 This course is designed to prepare the student for business communication. MKT 300 Principles of Marketing ...... 3 It presents principles of correct and effective English usage as applied in Four (4) units selected from: ...... 4 business. The course focuses on skills and techniques of effective business ACCT 341; BUS 210, 212, 214, 218, 219, 224; written communication including appropriate sentence structure, word usage, ECON 304 punctuation, spelling, business vocabulary, and business document formatting. TOTAL UNITS REQUIRED ...... 16 Critical thinking and effective writing techniques are emphasized. This course 7KLV FHUWLÀFDWH LV GHVLJQHG IRU H[LVWLQJ DQG SRWHQWLDO focuses on teaching students the ability to analyze, compose, and organize entrepreneurs. It provides an organized course of study written communication into effective business documents. Proofreading skills that enables students to develop their entrepreneurial skills, are stressed throughout the course. This course is required of all business recognize opportunities, and learn the basics of starting technology majors and recommended for all business majors. and managing a small business. BUS 105 BUSINESS MATHEMATICS 3 UNITS Upon completion of this program, the student will be able to: Prerequisite: None. Create a business plan that covers all facets of operating Hours: 54 hours LEC a business. This course is a review of basic mathematical skills and introduces equations Organize and manage the different business functions and formulas in solving for unknowns. Applications of mathematics in business necessary for ongoing operations. include such areas as banking, commercial discounts, retail and wholesale Appraise and evaluate business opportunities. PDUNXSPDUNGRZQSD\UROOFRPSXWDWLRQVVLPSOHDQGFRPSRXQGLQWHUHVWEDQN GLVFRXQWSUHVHQWYDOXHWD[HVLQVXUDQFHGHSUHFLDWLRQDQGÀQDQFLDOVWDWHPHQWV BUS 121 BUSINESS ETIQUETTE 2 UNITS Prerequisite: None. Hours: 36 hours LEC 7KLVXQLWFRXUVHLVDQLQWURGXFWLRQWRWKHFXOWXUHZD\VDQGPDQQHUVRI American business. Unlike courses that focus on theories of management or SUDFWLFHVRIDFFRXQWLQJWKLVFRXUVHH[SORUHVDQGGHÀQHVWKHLQWULFDWHVHWRI manners, ways and practices of Americans in the business setting. Successful VWXGHQWVZLOOOHDUQKRZWRSHUIRUPLQDMRELQWHUYLHZZLWKLQDQRIÀFHDWD business social function, and with their subordinates, peers and superiors. This FRXUVHZLOOFXOPLQDWHZLWKDÀHOGWULSWRDQEXVLQHVVUHVWDXUDQWIRUDIRUPDO EXVLQHVVOXQFKZKHUHVWXGHQWVZLOOGHPRQVWUDWHWKHLUQHZO\OHDUQHGVNLOOV among other businesspeople. This will involve a course materials fee. This course is not transferrable. BUS 180 INTRODUCTION TO THE NONPROFIT SECTOR 3 UNITS Prerequisite: BUS 100 with a grade of “C” or better Advisory: ENGWR 101 Hours: 54 hours LEC 7KLVFRXUVHZLOOSURYLGHVWXGHQWVZLWKEDVHOHYHONQRZOHGJHRIWKH1RQSURÀW VHFWRUOD\LQJWKHIRXQGDWLRQIRUWKRVHLQWHUHVWHGLQSXUVXLQJD1RQSURÀW 2UJDQL]DWLRQDO0DQDJHPHQWFHUWLÀFDWH7KLVFRXUVHZLOOH[DPLQHDOODVSHFWV of business specific to Nonprofit Organizations and will identify key GLIIHUHQFHVEHWZHHQWKH1RQSURÀWVHFWRUDQGWKH)RUSURÀWDQGSXEOLFVHFWRUV Subject matter includes governance and boards, fundraising, marketing, communications, and techniques of management. Students completing this FRXUVHZLOOKDYHDQXQGHUVWDQGLQJRIWKHIXQGDPHQWDOVRIEXVLQHVVVSHFLÀF WR1RQSURÀWRUJDQL]DWLRQV 96 Business Folsom Lake College 2011-2012 BUS 181 NONPROFIT FUNDRAISING 3 UNITS BUS 219 DEVELOPING YOUR ENTREPRENEURIAL IDEA 1 UNIT Prerequisite: None. Prerequisite: None. Hours: 54 hours LEC Hours: 18 hours LEC This course will train students how interact professionally and consistently with This course provides students with insight and knowledge into developing WKHSXEOLFZKHQUDLVLQJIXQGV$VPDQ\1RQSURÀWVUHO\KHDYLO\RQIXQGUDLVLQJ their entrepreneurial idea. This course investigates the concepts of business this course will provide students with the essential knowledge that can be planning and business ownership (entrepreneurship), including the pros and directly applied to real world organizations to get them the critical, recurring cons of owning a business. Students will explore the characteristics, experience, IXQGVQHHGHGWRIXOÀOOWKHLUPLVVLRQ and skills necessary to be a successful entrepreneur. Students will research their business ideas and gain knowledge in marketing principles. Students will BUS 182 NONPROFIT GOVERNANCE AND FINANCIAL analyze the organization and management of a new business and begin to MANAGEMENT 3 UNITS learn how to plan a new business. At the end of this course, students will be Prerequisite: None. able to determine more clearly whether owning their own business is feasible. Hours: 54 hours LEC 7KLVFRXUVHZLOOH[DPLQHERDUGJRYHUQDQFHDQGÀQDQFLDOPDQDJHPHQWVSHFLÀF BUS 224 CUSTOMER SERVICE 1 UNIT WR1RQSURÀWRUJDQL]DWLRQV6WXGHQWVZLOOJHWDQXSFORVHORRNDW*RYHUQLQJ Prerequisite: None. Boards, examining their make up and purpose. Additionally, students will be Hours: 18 hours LEC H[SRVHGWRWKHXQLTXHÀQDQFLDOPDQDJHPHQWDVSHFWVRIWKH1RQSURÀWVHFWRU This course provides students with the insights to better understand customer needs and to help build better student relationships with both internal and BUS 210 THE BUSINESS PLAN 1 UNIT external customers. Participants gain knowledge and skills in services activities Prerequisite: None. in business, government, and other service industries. This course focuses on Hours: 18 hours LEC the importance of providing value added service through improved attitude, 7KLVFRXUVHRIIHUVDQRUJDQL]HGVWHSE\VWHSDSSURDFKWRSUHSDULQJDEXVLQHVV LPSURYHGOLVWHQLQJFRQÁLFWPDQDJHPHQWSUREOHPVROYLQJDQGVXFFHVVIXO plan. The plan will enable the students to solve problems “on paper” before they customer service interactions. Additional emphasis is placed on the importance become operational or incur money problems. Every business should have a of effective communications in providing customer service. business plan and students will have the opportunity to create one in this course. BUS 295 INDEPENDENT STUDIES IN BUSINESS 1-3 UNITS BUS 212 MARKETING FOR SMALL BUSINESSES 1 UNIT Prerequisite: None Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB Hours: 18 hours LEC 7KLVFRXUVHHPSKDVL]HVKRZDVPDOOEXVLQHVVRUQRQSURÀWRUJDQL]DWLRQFDQ BUS 299 EXPERIMENTAL OFFERING IN BUSINESS .5-4 UNITS market its service or product to the consumer. The student will learn about ways Prerequisite: None to improve market mix, identify target markets, and develop a marketing plan. Hours: 18 hours LEC ; 54 hours LAB BUS 300 INTRODUCTION TO BUSINESS 3 UNITS BUS 214 FINANCING A SMALL BUSINESS 1 UNIT Prerequisite: None Prerequisite: None. Course Transferable to UC/CSU Hours: 18 hours LEC Hours: 54 hours LEC This course covers sources and ways of raising capital for small businesses. The This course provides a survey of all business areas, including Accounting, Law, course focuses on determining the amount of capital needed and how to obtain Computer Information Science, Management, Marketing, Economics and Finance. capital. Emphasis will be placed on determining overall operating budgets, The course is designed to be taken by all beginning students interested in VWDUWXSFRVWVÀQDQFLDOUDWLRVDQGNH\ÀQDQFLDOVWDWHPHQWV business. It is a core requirement for business majors. This course provides an RYHUYLHZRIWHQYHU\KHOSIXOLQDVVLVWLQJVWXGHQWV·VHOHFWLRQRIDVSHFLÀFFDUHHU BUS 218 MANAGEMENT SKILLS FOR THE SMALL BUSINESS 1 UNIT LQWKHÀHOGRIEXVLQHVV Prerequisite: None. Hours: 18 hours LEC Small businesses heavily rely on the motivation of employees. Small business owners must understand and motivate others to help the business reach its objectives. This course covers such functions as planning and organizing work flow, delegating responsibilities, understanding leadership styles, decision making, stress and time management, and working with employee organizations. Folsom Lake College 2011-2012 Business 97 BUS 310 BUSINESS COMMUNICATIONS 3 UNITS BUS 341 BUSINESS LAW 3 UNITS Prerequisite: None. Prerequisite: None Advisory: BUS 100 Course Transferable to UC/CSU General Education: AA/AS Area II(a) Hours: 54 hours LEC Course Transferable to CSU General introduction to the legal concepts and principles of real property and Hours: 54 hours LEC landlord/tenant; bankruptcy, consumer law, corporations, securities law and This course is designed to emphasize the use of communication theory in FRUSRUDWHVRFLDOHWKLFDOUHVSRQVLELOLW\ ODERUHPSOR\PHQWODZHQYLURQPHQWDO planning and composing various types of effective business letters and reports. ODZDQWLWUXVWODZDQGEXVLQHVVUHODWHGFRQVWLWXWLRQDOODZ The course stresses style, appearance, grammar, punctuation, tone, vocabulary, DQGUHDGHUDSSHDO,QWHUSHUVRQDOFRPPXQLFDWLRQDQGOLVWHQLQJFURVVFXOWXUDO BUS 345 LAW AND SOCIETY 3 UNITS communication, electronic communication technology, and ethical and legal Prerequisite: None. guidelines are included. General Education: AA/AS Area V(b); CSU Area D8; IGETC Area 4G Course Transferable to UC/CSU BUS 320 CONCEPTS IN PERSONAL FINANCE 3 UNITS Hours: 54 hours LEC Same As: ECON 320 This course is an introduction to the American legal system emphasizing the Prerequisite: None. nature, purpose, sources and functioning of American law but including some Advisory: BUS 105 comparative analysis of other historical and contemporary legal systems. It General Education: AA/AS Area V(b) VWUHVVHVWKHHYROXWLRQRIOHJDOFRQFHSWVDVDUHÁHFWLRQRIWKHVRFLDOHQYLURQPHQW Course Transferable to CSU and the role of the judiciary. A theoretical rather than practical viewpoint is used Hours: 54 hours LEC through analysis of selected cases and legislation in the areas of individualism, 7KLVFRXUVHLVGHVLJQHGWRDVVLVWLQGLYLGXDOVLQDQDO\]LQJWKHLUÀQDQFLDO socioeconomic groups, the family, the economy, crime, criminal procedure and DIIDLUV(OHPHQWVDQGFRQFHSWXDOEDVLVRIÀQDQFLDOSODQQLQJDQDO\VLVDQG punishment, church and state separation, the environment, and torts. This course decision making in areas of budgeting, taxes, borrowing, money management, should not be taken in place of BUS 340 when required. Not open to students insurance, investments, and retirement will be examined with an emphasis on who have recieved credit for SOCSC 360. principles to develop students’ economic decision making. Students will be using mathematical concepts as well as reading and interpreting written and BUS 350 SMALL BUSINESS MANAGEMENT/ENTREPRENEURSHIP oral instructions. This course is not open to students who have received credit 3 UNITS for ECON 320. Prerequisite: None Advisory: ENGWR 101 BUS 330 MANAGING DIVERSITY IN THE WORKPLACE 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D7 This class provides an overview of the various elements involved in starting Course Transferable to CSU and operating a small business. It introduces such topics as developing a Hours: 54 hours LEC EXVLQHVVSODQÀQGLQJÀQDQFLDOUHVRXUFHVGHYHORSLQJSHUVRQDODQGEXVLQHVV This course examines the leadership skills and abilities needed to manage a goals, meeting legal requirements, understanding marketing concepts, and other multicultural workforce. A primary focus is placed upon the workplace impact topics of interest to the entrepreneur. of various historical, social, and cultural experiences/perspectives related to gender, age, ethnicity, and disability. Workforce issues related to the diversity BUS 354 STUDENTS IN FREE ENTERPRISE 3 UNITS of the American consumer and global consumer impact on the United States Prerequisite: None. are analyzed. Course Transferable to CSU Hours: 54 hours LEC BUS 340 BUSINESS LAW 3 UNITS This course provides students with an overview of what it takes to be successful Prerequisite: None in business through implementation of group projects and business leadership Course Transferable to UC/CSU SUDFWLFHV6WXGHQWVZLOOFRPSOHWHFRPPXQLW\EDVHGEXVLQHVVSURMHFWVIRFXVLQJ Hours: 54 hours LEC on business and project planning, team building, communications, preparing This course is an introductory coverage of the law in its relationship to the and processing information, and leadership. Students will plan, implement, environment of business. The course covers the American legal system as an and evaluate each project and then compose an annual report and deliver a instrument of economic, social, and political control. It stresses basic business professional presentation that will be evaluated by a selection of industry torts, crime and business, contracts and sales transactions, agency, legal and business leaders at a regional competition. Students receive instruction structures of business, government regulation and property rights. For more in the areas of entrepreneurship, small business management, business detailed coverage of some of these topics, see BUS 341. planning, project management, oral and written presentation skills. This course emphasizes activities and techniques that develop competencies needed to become a successful business leader. There is a material fee for this course. 98 Business & Business Technology Folsom Lake College 2011-2012 BUS 490 INDIVIDUALIZED PROJECTS IN BUSINESS 1-4 UNITS Prerequisite: None Business Technology (BUSTEC) Advisory: At least two semesters of successful work leading to an Associate 'HJUHHRU&HUWLÀFDWHLQ$FFRXQWLQJ%XVLQHVV&RPSXWHU,QIRUPDWLRQ6FLHQFH BUSTEC 101 COMPUTER KEYBOARDING: 10-KEY 1 UNIT )LQDQFH0DQDJHPHQW0DUNHWLQJ2IÀFH$GPLQLVWUDWLRQRURWKHUUHODWHGÀHOG Prerequisite: None. Course Transferable to CSU Hours: 18 hours LEC Hours: 18 hours LEC ; 54 hours LAB This course introduces the numeric keypad and develops the ability to key This course is designed to help the student focus skills previously learned in information into a computer with speed and accuracy. Simulated employment an area of business. The student, with the help of the instructor, will produce tests based on industry standards are included. Students are required to have a project that utilizes a variety of skills. The student will describe a problem, DFFHVVWRDFRPSXWHUZLWK,QWHUQHWFDSDELOLWLHVDQGDQHPDLODFFRXQW plan a process to arrive at a solution, work with the instructor to secure those BUSTEC 102 COMPUTER KEYBOARDING: 10-KEY 1 UNIT resources necessary to complete the project, submit progress reports on a Prerequisite: None. UHJXODUEDVLVDQGSUHVHQWDÀQLVKHGSURGXFW7KLVFODVVPD\EHUHTXLUHGIRU Hours: 9 hours LEC; 27 hours LAB VRPHGHJUHHVRUFHUWLÀFDWHV This course introduces the numeric keypad and develops the ability to key BUS 495 INDEPENDENT STUDIES IN BUSINESS 1-3 UNITS information into a computer with speed and accuracy. Simulated employment Prerequisite: None tests based on industry standards are included. Students are required to have Course Transferable to CSU DFFHVVWRDFRPSXWHUZLWKDNH\NH\SDG,QWHUQHWFDSDELOLWLHVDQGDQ Hours: 18 hours LEC ; 54 hours LAB HPDLODFFRXQW BUS 498 WORK EXPERIENCE IN BUSINESS 1-4 UNITS BUSTEC 110 BUSINESS PROCEDURES FOR PROFESSIONAL Prerequisite: None. SUCCESS 3 UNITS Advisory: ENGWR 101 Prerequisite: None. General Education: AA/AS Area III(b) Advisory: BUS 100, BUSTEC 302, BUSTEC 303, CISA 308, CISA 310, CISA 320, or (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS ENGWR 101 volunteer opportunity, or job related to management/business. Students are Hours: 54 hours LEC DGYLVHGWRFRQVXOWZLWKWKH0DQDJHPHQW%XVLQHVV'HSDUWPHQWWRUHYLHZVSHFLÀF This course prepares students to perform various information processing FHUWLÀFDWHDQGGHJUHHZRUNH[SHULHQFHUHTXLUHPHQWV SURFHGXUHVDQGSUREOHPVROYLQJWDVNVUHTXLUHGWRVXSSRUWERWKWRGD\·VRIÀFH Course Transferable to CSU systems and those of the future. Students learn critical thinking, problem +RXUV KRXUV/$% VROYLQJWHDPZRUNVXSHUYLVLRQVNLOOVRIÀFHSURFHGXUHVDQGLQIRUPDWLRQ This course provides students with opportunities to develop marketable skills processing technologies to manage their work, as well as necessary attributes of in preparation for employment or advancement within their current job. Course DQRIÀFHSURIHVVLRQDO7KHVHVNLOOVZLOOSURYLGHWKHEDFNJURXQGIRUDGYDQFHPHQW content will include understanding the application of education to the workforce; to supervision and management positions. Primary emphasis is on processing completion of required forms, which document the student’s progress and hours documents using introductory skills in word processing, spreadsheets, spent at the work site; and developing workplace skills and competencies. SUHVHQWDWLRQJUDSKLFVDQGHPDLO$OVRLQFOXGHGDUHPDQDJLQJLQIRUPDWLRQ 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU VWRUDJHDQGUHWULHYDODQGFRRUGLQDWLQJRIÀFHFRPPXQLFDWLRQVWRLPSURYHWKH orientation and 75 hours of related paid work experience, or 60 hours of HIÀFLHQF\RIRIÀFHIXQFWLRQV unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken BUSTEC 120 SKILLS FOR TODAY’S OFFICE 1 UNIT four times for credit, when there is new or expanded learning on the job, for Prerequisite: None. a maximum of 16 units. $GYLVRU\ %867(& RUNH\ERDUGLQJVSHHGYHULÀFDWLRQDWZDPRUEHWWHU Hours: 18 hours LEC BUS 499 EXPERIMENTAL OFFERING IN BUSINESS .5-4 UNITS This course is designed to build upon word processing and spreadsheet Prerequisite: None training in the computer science/business area, and complete the training Course Transferable to CSU necessary to perform effectively and become a skilled employee in the Hours: 18 hours LEC ; 54 hours LAB PRGHUQFRPSXWHUL]HGRIÀFH7KHFRXUVHLQFOXGHVSUHSDULQJDQGSURFHVVLQJ information: word processing and spreadsheet documents; communicating YLDID[HPDLOYRLFHPDLO,QWHUQHWDQGWHOHSKRQH DQGXVLQJFRSLHUVDQG RWKHURIÀFHHTXLSPHQW6WXGHQWVZLOOVLPXODWHRIÀFHVLWXDWLRQV7KLVFRXUVH emphasizes activities and techniques that enhance competencies needed in WRGD\·VRIÀFH6WXGHQWVZLOOQHHGVRPHW\SHRIUHPRYDEOHPHPRU\PHGLDIRU H[DPSOHDÁDVKPHPRU\VWLFN 86%ÁDVKGULYH Folsom Lake College 2011-2012 Business Technology 99 BUSTEC 121 NEXT SKILLS: SKILLS FOR TODAY’S WORKFORCE BUSTEC 304 COMPUTER-KEYBOARD SPEED-AND-ACCURACY 3 UNITS BUILDING 2 UNITS Prerequisite: None. Prerequisite: BUSTEC 302 with a grade of “C” or better Hours: 54 hours LEC Course Transferable to CSU This course is designed to provide training needed for today’s workforce. This Hours: 36 hours LEC FRXUVHWHDFKHVVNLOOVWKDWHPSOR\HUVIURPDFURVVWKHQDWLRQKDYHLGHQWLÀHG 7KLVFRXUVHEXLOGVXSRQFXUUHQWFRPSXWHUNH\ERDUGVNLOOVDQGVWUHVVHVVSHHGDQG as the key skills workers must master for businesses to increase their accuracy keyboarding techniques. It includes skills assessment and individually competitiveness. These eight categories include: navigating technology at work; prescribed improvement plans. The student will be reading and interpreting time management; organization skills; effective listening; valuing diversity; written and oral instructions. Students must have access to a computer with LQWHUSHUVRQDOFRPPXQLFDWLRQV YDOXHDGGHGVHUYLFH DQGXVLQJFUHDWLYLW\DQG Internet access and email. Students who feel that they have skills equivalent to innovation. This course utilizes activities including role playing and critical the prerequisite are encouraged to apply for credit by examination for BUSTEC thinking to teach these valuable skills. 302. This course may be taken two times for credit. BUSTEC 299 EXPERIMENTAL OFFERING IN BUSINESS TECHNOLOGY BUSTEC 307.1 INTRO KEYBOARDING/APPLICATION 2 UNITS .5-4 UNITS Prerequisite: None Prerequisite: None Course Transferability to CSU pending Hours: 18 hours LEC ; 54 hours LAB Hours: 24 hours lecture, 36 hours laboratory 7KLVLQWHQVLYHLQWURGXFWRU\FRPSXWHUNH\ERDUGFRXUVHHPSKDVL]HVRSHUDWLQJ BUSTEC 302 COMPUTER-KEYBOARDING 2 UNITS DOSKDEHWLFQXPHULFDQGV\PERONH\VE\WRXFK,WLQFOXGHVFRPSXWHUNH\ERDUGLQJ Prerequisite: None. WHFKQLTXHVVSHHGDQGDFFXUDF\GHYHORSPHQWSURRIUHDGLQJSURÀFLHQF\DQGWKH General Education: AA/AS Area III(b) XVHRIHVVHQWLDOFRPSXWHUNH\ERDUGLQJLQIRUPDWLRQ6WXGHQWVZLOOQHHGDFFHVV Course Transferable to CSU WRDFRPSXWHU,QWHUQHWDQGDQHPDLODFFRXQW Hours: 36 hours LEC 7KLVLQWHQVLYHLQWURGXFWRU\FRPSXWHUNH\ERDUGFRXUVHHPSKDVL]HVRSHUDWLQJ BUSTEC 499 EXPERIMENTAL OFFERING IN BUSINESS TECHNOLOGY DOSKDEHWLFQXPHULFDQGV\PERONH\VE\WRXFK,WLQFOXGHVFRPSXWHU .5-4 UNITS NH\ERDUGLQJWHFKQLTXHVVSHHGDQGDFFXUDF\GHYHORSPHQWSURRIUHDGLQJ Prerequisite: None SURÀFLHQF\HVVHQWLDOFRPSXWHUNH\ERDUGLQJLQIRUPDWLRQ6WXGHQWVZLOOQHHG Course Transferable to CSU DFFHVVWRDFRPSXWHUDQG,QWHUQHWDQHPDLODFFRXQWDQGVRPHW\SHRIFRPSXWHU Hours: 18 hours LEC ; 54 hours LAB PHGLDWRVWRUHGDWDÀOHVIRUH[DPSOHDÁDVKPHPRU\GULYH 86%PHPRU\VWLFN BUSTEC 303 COMPUTER-KEYBOARD FORMATTING 2 UNITS Prerequisite: BUSTEC 302 with a grade of “C” or better Course Transferable to CSU Hours: 36 hours LEC 7KLVLQWHQVLYHFRPSXWHUNH\ERDUGIRUPDWWLQJFRXUVHHPSKDVL]HVDSSOLFDWLRQRI the following formatting concepts: horizontal and vertical centering, business letter styles, memorandums, tables, and reports. The course includes developing SURRIUHDGLQJSURÀFLHQF\UHLQIRUFLQJFRPPXQLFDWLRQVNLOOVGHYHORSLQJVSHHG DQGDFFXUDF\DQGXVLQJWKHIHDWXUHVRIDFXUUHQWRIÀFHOHYHOZRUGSURFHVVLQJ SURJUDP6WXGHQWVQHHGDFFHVVWRDFRPSXWHUDQGWKH,QWHUQHWDQHPDLO DFFRXQWDQGVRPHW\SHRIFRPSXWHUPHGLDWRVWRUHGDWDÀOHVIRUH[DPSOHD ÁDVKPHPRU\VWLFN 86%PHPRU\GULYH 100 Chemistry Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Chemistry COUNSELING Rancho Cordova Center - 916-255-0717 The Chemistry Program at Folsom Lake College consists Chemistry (CHEM) of: A series of chemistry courses designed to meet CHEM 305 INTRODUCTION TO CHEMISTRY 5 UNITS transfer requirements for physical and biological Prerequisite: MATH 100 with a grade of “C” or better science majors General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A A series of courses intended for students majoring Enrollment Limitation: Students must be 16 and at least sophomores in high LQÀHOGVRWKHUWKDQFKHPLVWU\ELRORJ\RUSK\VLFDO school. Minor aged students who are not legally emancipated must have their science parent(s)/guardian review laboratory safety protocols prior to attending class. D FRXUVH GHVLJQHG VSHFLÀFDOO\ IRU VWXGHQWV ZKR Course Transferable to UC/CSU require preparation or review of the more basic Hours: 72 hours LEC ; 54 hours LAB chemical concepts This course introduces fundamental principles of chemistry including types of matter and physical states, physical and chemical transformations, chemical All chemistry courses at FLC include a practical equations and stoichiometry, bonding, atomic and chemical structure, component where students conduct hands-on chemical intermolecular forces, gas laws, solutions, colligative properties, acids and bases, experimentation in a modern, well-equipped laboratory. nuclear chemistry, and includes a brief introduction of organic chemistry. It is primarily intended for general education and majors in allied health (nursing, Career Options dental hygiene, respiratory care), home economics, physical education, physical Chemist; Pharmacist; Chemical Engineer; Physician; therapy(*), psychology(*), natural resources(*). CHEM 305 can also be used as Dentist; Veterinarian; Allied Health Professional; Biologist; a preparatory course prior to enrolling in CHEM 400. Students are required to Physicist; Geologist; Geochemist; Oceanographer purchase approved safety goggles and several pairs of disposable gloves. A laboratory coat or apron is advised but not required. *May require CHEM 400. Some career options may require more than two years of college study. Classes beyond the associate degree may be CHEM 306 INTRODUCTION TO CHEMISTRY 5 UNITS UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ Prerequisite: CHEM 305 with a grade of “C” or better for transfer to a university program. General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A Enrollment Limitation: Students must be at least 16 and sophomores in high Highlights school. Minor aged students who are not legally emancipated require their An outstanding chemistry faculty striving to parent(s)/guardian review laboratory safety protocols prior to attending class. maintain an aggressive and well-respected Course Transferable to UC/CSU chemistry program Hours: 72 hours LEC ; 54 hours LAB Ample contact with the instructor and the relaxed This course is the second semester of General, Organic and Biological chemistry atmosphere that only a limited class size can offer (a continuation of Chemistry 305). This course is intended for students majoring LQWKH$OOLHG+HDOWKÀHOGV QXUVLQJ%61GHJUHH SK\VLFDOWKHUDS\DQGGHQWDO NOTE: ALL CHEMISTRY STUDENTS hygiene). This course introduces students to the structure and function, as well as the physical and chemical properties of organic molecules. Emphasis All Chemistry students are required to wear closed-toe LVRQWKHVSHFLÀFIXQFWLRQDOJURXSVIRXQGLQFDUERK\GUDWHVSURWHLQVOLSLGV shoes at all times in the chemistry laboratory. They are and nucleic acids, the types of reactions they undergo and their relevancy to also required to wear indirect-vent safety goggles human physiology and health. Students will be required to purchase approved (safety glasses are not acceptable) while working in safety goggles and several pairs of disposable gloves. A lab coat or apron is the laboratory. advised but optional. Folsom Lake College 2011-2012 Chemistry 101 CHEM 321 ENVIRONMENTAL CHEMISTRY 3 UNITS CHEM 401 GENERAL CHEMISTRY 5 UNITS Prerequisite: None. Prerequisite: CHEM 400 with a grade of “C” or better General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A General Education: CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC ; 108 hours LAB This course explores the interrelationship of human beings and the surrounding 7KLVFRXUVHLVDFRQWLQXDWLRQRIWKHWZRVHPHVWHUVHULHVLQJHQHUDOFROOHJH environment with regard to the chemical substances that are encountered in chemistry. CHEM 401 is intended for students majoring in the scientific everyday life. The role of chemistry in both creating environmental problems disciplines including chemistry, biology, physics, and geology. Topics presented in as well as providing solutions to environmental problems will be examined. the course include kinetics, equilibrium, acid/base chemistry, thermodynamics, Students will learn how chemicals released to the environment can have adverse electrochemistry, nuclear chemistry, and coordination chemistry. A brief effects on ecosystems and human health. Chemical and physical methods of introduction to Organic Chemistry is included. Laboratory experiments include controlling and remediating air, water, and soil pollutants will be covered. The qualitative and quantitative analysis. role of environmental regulations in preventing and mitigating environmental degradation will also be covered. By the completion of this course, students CHEM 410 QUANTITATIVE ANALYSIS 5 UNITS will have acquired skills and techniques that can be utilized to examine Prerequisite: CHEM 401 with a grade of “C” or better environmental problems and their proposed solutions. General Education: AA/AS Area IV; CSU Area B1; CSU Area B3 Course Transferable to UC/CSU CHEM 322 ENVIRONMENTAL CHEMISTRY LABORATORY 1 UNIT Hours: 54 hours LEC ; 108 hours LAB Prerequisite: None. This course focuses on the principles and techniques utilized in modern quantitative Corequisite: CHEM 321; CHEM 321 (may be taken previously). Grade of “C” or analysis. Gravimetric, volumetric, electroanalytical, spectrophotometric, and better required to meet corequisite. chromatographic analytical methods will be studied theoretically and with General Education: CSU Area B1; CSU Area B3; IGETC Area 5A practical laboratory experiments. Emphasis throughout the course will be on Course Transferable to UC/CSU sampling, calibration, statistical analysis, and method validation procedures. Hours: 54 hours LAB This course is intended for science majors, including chemistry, chemical 7KLVFRXUVHSURYLGHV´KDQGVRQµRSSRUWXQLWLHVIRUVWXGHQWVWRFROOHFWDQG engineering, biochemistry, biology, forensic science, and microbiology. analyze data about chemicals found in the environment. Students will learn how to collect and analyze soil, water and air samples for environmental quality CHEM 420 ORGANIC CHEMISTRY 5 UNITS parameters and the presence of pollutants. Analysis of samples will involve the Prerequisite: CHEM 401 with a grade of “C” or better XVHRIUHDGLO\DYDLODEOHÀHOGWHVWHTXLSPHQW)LHOGWULSVIRUVDPSOHFROOHFWLRQ General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A will take place during laboratory periods or at arranged times. There may also Course Transferable to UC/CSU EHÀHOGWULSVWRHQYLURQPHQWDODQDO\WLFDOODERUDWRULHV Hours: 54 hours LEC ; 108 hours LAB This is a lecture/laboratory course designed to introduce students to the basic CHEM 400 GENERAL CHEMISTRY 5 UNITS FRQFHSWVRIRUJDQLFFKHPLVWU\7KLVFRXUVHLVGHVLJQHGIRUVFLHQFHPDMRUVSUH Prerequisite: CHEM 300 OR CHEM 305 OR one year high school chemistry lecture PHGSUHGHQWDODQGSUHSKDUPDF\PDMRUV/HFWXUHWRSLFVZLOOLQFOXGHDFLG and laboratory with a grade of “C” or better; AND MATH 120 with a grade base chemistry, pushing electrons, organic nomenclature, alkane chemistry, of “C” or better OR placement into a transfer level math course through the alkene chemistry, alkyl halides, alcohols, ethers, physical properties of alkanes assessment process. and cycloalkanes, SN1, SN2, E1, E2 mechanisms. Laboratory work will include General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A characterization of organic molecules using modern analytical instrumentation Course Transferable to UC/CSU such as (GC, GC/MS, NMR, FTIR, polarimetry, and HPLC) and the measurement Hours: 54 hours LEC ; 108 hours LAB RIWKHLUSK\VLFDOSURSHUWLHV6HSDUDWLRQDQGSXULÀFDWLRQRIRUJDQLFFRPSRXQGV This is a general college chemistry course intended for students majoring in will also be covered in the lab section; these techniques include distillation, WKHVFLHQWLÀFGLVFLSOLQHVLQFOXGLQJFKHPLVWU\ELRORJ\SK\VLFVJHRORJ\DQG UHFU\VWDOOL]DWLRQSUHSDUDWLYHFKURPDWRJUDSK\OLTXLGOLTXLGH[WUDFWLRQDQGWKLQ engineering. This course emphasizes the fundamental principles of chemistry. layer chromatography. This course requires that students purchase additional Topics include chemical measurement; physical and chemical processes; VXSSOLHVVXFKDVD*DV&KURPDWRJUDSK\PLFURV\ULQJHDQGVDIHW\JRJJOHV nomenclature; stoichiometry; atomic structure; quantum theory; molecular structure; bonding theory; physical properties of gases, liquids, and solids; thermochemistry; and properties of solutions. 102 Chemistry Folsom Lake College 2011-2012 CHEM 421 ORGANIC CHEMISTRY 5 UNITS Prerequisite: CHEM 420 with a grade of “C” or better General Education: CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Hours: 54 hours LEC ; 108 hours LAB 7KLVFRXUVHLVDOHFWXUHODERUDWRU\FRXUVHWKDWLVDFRQWLQXDWLRQRI&+(07KLV course concludes an introduction to organic chemistry. This course is designed IRUVFLHQFHPDMRUVSUHPHGSUHGHQWDODQGSUHSKDUPDF\PDMRUV/HFWXUH topics include the chemistry of ethers, epoxides, conjugated dienes, aromatic compounds, carbonyl compounds, enolate condensation, amines, phenols, polymerization reactions, and selected biologically important compounds. The course also includes continued application of spectroscopic methods (IR, 10589YLVDQG06 DSSOLHGWRRUJDQLFFKHPLVWU\/DERUDWRU\HPSKDVLVLVRQ synthesis of organic compounds. Experiments include the preparation, isolation, TXDQWLWDWLRQSXULÀFDWLRQLGHQWLÀFDWLRQDQGPHFKDQLVPHOXFLGDWLRQRIPROHFXOHV synthsized. Students will continue to expand their ability to operate and utilize DYDULHW\RIPRGHUQFKHPLFDOLQVWUXPHQWDWLRQJDVFKURPDWRJUDSK\KLJK SHUIRUPDQFHOLTXLGFKURPDWRJUDSK\IRXULHUWUDQVIRUPLQIUDUHGVSHFWURVFRS\ DQGJDVFKURPDWRJUDSK\PDVVVSHFWURVFRS\ CHEM 495 INDEPENDENT STUDIES IN CHEMISTRY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB CHEM 499 EXPERIMENTAL OFFERING IN CHEMISTRY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Communication Studies 103 Communication Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Studies COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE A.A. - Communication, offer students an opportunity to explore coursework Organizational Communication in oral communication, critical thinking, social sciences, multicultural studies, and living skills. CERTIFICATE OF RECOGNITION Applied Communication Skills 6WXGHQWVZLOOÀQGWKLVEDFNJURXQGKHOSIXODQGDSSOLFDEOH to their everyday pursuits. Students intending to transfer The Communication Studies Department at Folsom Lake to a university will have a solid base of courses that College is committed to excellent teaching that provides will interface with further, focused study in a major. an innovative and stimulating environment for student For those wishing to pursue a university degree in the learning in theoretical and pragmatic applications of ÀHOGRIFRPPXQLFDWLRQGHJUHHVFDQEHHDUQHGZLWK communication education. With the primary mission of emphasis in the following areas: encouraging completion of an Associate in Arts degree Mass Media Studies and promoting transfer opportunities, the Department Broadcast Electronic Communication Arts provides superior educational opportunities to a Organizational Communication diverse student population and supports a cooperative Intercultural Communication HQYLURQPHQW WKDW UHÁHFWV DQG KRQRUV WKH GLYHUVH Visual Communication backgrounds, perspectives, abilities and interests of all. Rhetoric The Department supports both faculty and students in the Group Communication pursuit of continuing education to better their personal, Interpersonal Communication academic and professional lives, to help them meet the communication challenges of an increasingly complex world, and to adapt to the changing communication DEGREE demands of the future. A.A. — Communication, Organizational Communication Career Options REQUIRED PROGRAM ...... Units Public Information; Human Resources Development; Core Courses: Corporate Training; Motivational Speaking; Political COMM 301 Introduction to Public Speaking ...... 3 Speech Writing; Radio & Television; Advertising; COMM 311 Argumentation and Debate ...... 3 Public Relations; College & University Instruction; COMM 321 Interpersonal Communication ...... 3 Organizational Administration; Negotiation & CMED 300/JOUR 310 Mass Media and Society ...... 3 Mediation Services; Writing for Publication; Personnel Communication in Organizations...... 6 Management; Customer Service; Social Science COMM 341 Organizational Communication (3) Research; Corporate Imaging; Campaign Management; A minimum of 3 units from the following: Marketing; Community Relations; Grant Writing BUS 330 Managing Diversity in the Workplace (3) COMM 315 Persuasion (3) Highlights MGMT 360 Management Communication (3) 'HJUHHDQG&HUWLÀFDWHSURJUDP Written Communication ...... 6 Transfer requirements simultaneously met while ENGWR 300 College Composition (3) pursuing degree A minimum of 3 units from the following: BUS 310 Business Communication (3) Many of the courses required for this degree can also ENGWR 302 Adv Composition & Critical Thinking* (3) EHXVHGWRIXOÀOOWUDQVIHUJHQHUDOHGXFDWLRQUHTXLUHPHQWV (* 2nd semester writing requirement for CSUS) for the CSU system. In the Communication program, our courses are multidisciplinary in nature. Communication studies 104 Communication Studies Folsom Lake College 2011-2012 Communication for a Diverse World ...... 6-7 CERTIFICATE OF RECOGNITION COMM 325 Intercultural Communication (3) Applied Communication Skills And one transfer level course of foreign language or American Sign Language (3-4) REQUIRED PROGRAM ...... Units Communication in Groups and Teams ...... 6 COMM 301 Introduction to Public Speaking ...... 3 A minimum of 6 units from the following: COMM 325 Intercultural Communication ...... 3 COMM 331 Group Discussion (3) COMM 331 Group Discussion ...... 3 COMM 373 Forensics Laboratory (3) COMM 341 Organizational Communication ...... 3 Or any department approved internship Plus one (1) additional course selected from: ...... 3 TOTAL UNITS REQUIRED ...... 36-37 COMM 311 Argumentation and Debate (3) COMM 315 Persuasion (3) This A.A. degree may be obtained by completion of the COMM 321 Interpersonal Communication (3) Required Program, plus General Education Requirements, COMM 361 The Communication Experience (3) SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO COMM 371 Voice and Diction (3) TOTAL UNITS REQUIRED ...... 15 The role of communication in the workplace today has grown in importance, and workplace communication 7KLV FHUWLÀFDWH SURJUDP SURYLGHV WKH FRPPXQLFDWLRQ VNLOOV competencies are increasingly in demand. The number one necessary for entry-level positions in business, and helps VNLOOLGHQWLÀHGE\HPSOR\HUVLVWKHDELOLW\WRFRPPXQLFDWH improve managerial attributes with an emphasis on abilities clearly in both oral and written form. The number two skill WR FRPPXQLFDWH HIIHFWLYHO\ HIÀFLHQWO\ DQG DSSURSULDWHO\ LGHQWLÀHGE\HPSOR\HUVDVQHFHVVDU\LVWKHDELOLW\WRZRUN LQRUJDQL]DWLRQDOVHWWLQJV6WXGHQWVZLWKWKLVFHUWLÀFDWHDUH effectively as a member of a team. A competitive workplace prepared to design messages based on analysis of the requires employees to exercise competence in interview intended audience and cultural context, apply effective skills, professional presentations, written communication, listening skills, analyze persuasive messages, and demonstrate JURXS SUREOHP VROYLQJ LQWHUFXOWXUDO LQWHUDFWLRQV FRQÁLFW HIIHFWLYH RUDO SUHVHQWDWLRQ VNLOOV 7KH FHUWLÀFDWH SUHSDUHV management, and analytical reasoning. This degree gives VWXGHQWVZLWKWKHVNLOOVQHFHVVDU\WRGHPRQVWUDWHSURÀFLHQF\LQ students a foundation that can be used in any career path, different communication settings by identifying and appraising increasing their preparation for employment and preparing factors that affect organizational communication structures in them for transfer to a four-year college or university. small group, interpersonal and intercultural settings. Upon completion of this program, the student will be able to: Upon completion of this program, the student will be able to: Demonstrate an understanding of the history, evolution Design and relate messages clearly for effective and and multidisciplinary nature of human communication. appropriate oral communication. Analyze evidence and reasoning to identify and Apply effective listening skills to comprehend spoken provide appropriate and credible support for written messages, analyze information critically and consider and oral communication. multiple perspectives. Demonstrate individual responsibility, integrity, and Compose ideas clearly in effective, appropriate and respect in all communication interactions. well-organized written messages. Design and deliver effective and appropriate written Demonstrate effective communication appropriate to and/or oral messages in a variety of personal, diverse contexts and people. professional, and social contexts. Demonstrate communication competency utilizing both nonverbal and verbal communication strategies appropriate for diverse audiences. Differentiate amongst various theoretical perspectives within the discipline of Human Communication. Differentiate amongst various theoretical perspectives ZLWKLQWKHÀHOGRI2UJDQL]DWLRQDO&RPPXQLFDWLRQ Folsom Lake College 2011-2012 Communication Studies 105 COMM 315 PERSUASION 3 UNITS Communication Studies (COMM) Prerequisite: ENGWR 300 with a grade of “C” or better General Education: AA/AS Area II(b); CSU Area A3; IGETC Area 1B COMM 301 INTRODUCTION TO PUBLIC SPEAKING 3 UNITS Course Transferable to UC/CSU Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through Hours: 54 hours LEC the assessment process. This course presents fundamental theories and techniques of persuasion General Education: AA/AS Area II(b); CSU Area A1; IGETC Area 1C as they occur in various communication contexts, including commercial, Course Transferable to UC/CSU interpersonal, public, and mass media. Students develop critical thinking Hours: 54 hours LEC skills by engaging in oral and written analysis, evaluation, and composition This course prepares students to speak in a variety of rhetorical situations: of persuasive messages and by examining the personal, political, cultural, academic, professional, social, and political. Students will demonstrate effective and social impacts of persuasion. Students explore ethical considerations verbal and non verbal delivery, ethical research methodology, analytical of persuasive communication; learn about types of reasoning; and identify thinking and listening skills, organization and outlining skills, and appropriate fallacious arguments as they occur in persuasion. Students will write a minimum presentation skills. In order to effectively assess oral communication of 6,000 written words in a variety of essay formats. competency, each student will complete a minimum of 22 minutes of evaluated speaking time. Emphasis is on researching, preparing, organizing, COMM 321 INTERPERSONAL COMMUNICATION 3 UNITS writing and presenting a variety of speeches for different audiences. Video Prerequisite: ENGWR 51 with a grade of “C” or better; or placement through WDSLQJHTXLSPHQWPD\EHXVHGDVDQDLGWRWKHVWXGHQW·VVHOIDQDO\VLVDQG the assessment process. improvement. Access to a computer with online capabilities may be required General Education: AA/AS Area III(b); CSU Area E1 and is available on campus. Course Transferable to UC/CSU Hours: 54 hours LEC COMM 305 ORAL INTERPRETATION 3 UNITS Students in this course will explore and apply communication concepts Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through associated with developing and maintaining satisfying interpersonal the assessment process. relationships. Through a variety of class activities, students experiment with Advisory: COMM 301 or ENGWR 300 various approaches to successful communication in interpersonal contexts, General Education: CSU Area C1; IGETC Area 3A LQFOXGLQJFRQÁLFWPDQDJHPHQWDQGDFWLYHOLVWHQLQJ$GGLWLRQDOO\VWXGHQWVZLOO Course Transferable to UC/CSU improve communication competency through a heightened awareness of the Hours: 54 hours LEC complexity of interpersonal communication and the development of skills as 7KLVFRXUVHLQWURGXFHVVWXGHQWVWRWKHÀHOGRISHUIRUPDQFHVWXGLHVWKURXJK both senders and receivers of shared messages. WKHRUDOLQWHUSUHWDWLRQRIYDULRXVOLWHUDU\JHQUHVLQFOXGLQJ:HVWHUQDQG1RQ Western literature. The focus is on audience analysis, selection and thematic COMM 325 INTERCULTURAL COMMUNICATION 3 UNITS analysis of literature, script writing, discussion and application of vocal and Prerequisite: ENGWR 51 with a grade of “C” or better; or placement through physiological delivery techniques, program performance, and post performance the assessment process. evaluation. Theoretical issues and historical developments are examined and General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D7; IGETC Area 4G applied to the current performance trends in solo, duo and interpreters’ theatre. Course Transferable to UC/CSU Hours: 54 hours LEC COMM 311 ARGUMENTATION AND DEBATE 3 UNITS This course introduces students to the challenges and promises of intercultural Prerequisite: ENGWR 300 with a grade of “C” or better communications in the United States. Variations and commonalities in Advisory: COMM 301 communication patterns across cultures are examined as well as processes and General Education: AA/AS Area II(b); CSU Area A1; CSU Area A3; IGETC Area 1C RXWFRPHVDPRQJSHUVRQVRIGLIIHUHQWJURXSEDVHGH[SHULHQWLDOEDFNJURXQGV Course Transferable to UC/CSU 3UDFWLFDODSSOLFDWLRQRIIDFWRUVZKLFKLQÁXHQFHFRPPXQLFDWLRQDPRQJLQGLYLGXDOV Hours: 54 hours LEC of different cultures is emphasized. This course covers both the theory and practice of argumentation and debate. Students will learn to effectively develop and respond to reasoned written and oral arguments, to critically evaluate various types of evidence, and to advocate within the structures of formal debate. This course will allow students to develop critical thinking and communication skills necessary for personal, professional, and academic success. 106 Communication Studies Folsom Lake College 2011-2012 COMM 331 GROUP DISCUSSION 3 UNITS COMM 363 INTRODUCTION TO COMMUNICATION THEORY Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through 3 UNITS the assessment process. Prerequisite: None. General Education: AA/AS Area II(b); CSU Area A1; IGETC Area 1C General Education: AA/AS Area II(b); CSU Area D7 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC Group communication is pervasive in all academic, professional, and social This course will introduce the student to the symbolic process of human environments. This course is designed to increase students’ understanding communication through the study of basic communication models, fundamental of group communication and to prepare students to function more effectively WKHRU\DQGUHOHYDQWUHVHDUFKÀQGLQJV(PSKDVLVZLOOEHSODFHGRQDFKLHYLQJDQ in various types of groups. Students will learn about the dynamics of group understanding of the communication process, and the process through which UROHVWKHPXOWLSOHIXQFWLRQVRIJURXSVOHDGHUVKLSVW\OHVFRQÁLFWPDQDJHPHQW UHVHDUFKHUVLQWKHÀHOGDGGWRWKHLUH[LVWLQJERG\RINQRZOHGJH SUREOHPVROYLQJDQGGHFLVLRQPDNLQJ,QGLYLGXDODQGJURXSSUHVHQWDWLRQVDUH UHTXLUHG9LGHRWDSLQJHTXLSPHQWPD\EHXVHGDVDQDLGWRWKHVWXGHQW·VVHOI COMM 371 VOICE AND DICTION 3 UNITS analysis and improvement. Access to a computer with online capabilities may Prerequisite: None be required and computer access is available on campus. Course Transferable to UC/CSU Hours: 54 hours LEC COMM 341 ORGANIZATIONAL COMMUNICATION 3 UNITS This course focuses on individual speech improvement through the study and Prerequisite: ENGWR 101 with a grade of “C” or better; eligibility for ENGWR 300 practice of voice control and manipulation, proper breathing, and diction. General Education: AA/AS Area V(b); CSU Area D7 Emphasis is placed on achieving correct pronunciation, enunciation, and Course Transferable to CSU voice production. Students will build on basic theories and practice of the Hours: 54 hours LEC interpretation of various oral selections chosen by the instructor and by the This course is designed to allow students to examine both theoretical and student. This course is intended for public speaking students, and drama and pragmatic essentials of effective organizational messages from preparation and media majors. presentation to effective observation and analysis. Students will explore the dynamics of organizational communications in various situations including focus COMM 373 FORENSICS LABORATORY 2 UNITS JURXSVTXDOLW\FRQWUROJURXSVDGKRFFRPPLWWHHVFRQÁLFWQHJRWLDWLRQWHDPV Prerequisite: None and problem solving/decision making groups. The roles of internal and external Course Transferable to CSU messages on the communication process and organizational effectiveness will Hours: 108 hours LAB be examined and analyzed. A laboratory class for students who wish to participate in intercollegiate forensics competition. Areas of interest include debate, persuasion, oral COMM 361 THE COMMUNICATION EXPERIENCE 3 UNITS interpretation, expository speech, impromptu speaking and readers’ theatre. Prerequisite: ENGWR 101 with a grade of “C” or better; eligibility for ENGWR 300. May be taken four times for credit. General Education: AA/AS Area II(b); CSU Area A1; IGETC Area 1C Course Transferable to UC/CSU COMM 494 TOPICS IN COMMUNICATION STUDIES .5-4 UNITS Hours: 54 hours LEC Prerequisite: None This course introduces students to the fundamental concepts and skills necessary Course Transferable to CSU for effective interpersonal, small group and public communication. Course Hours: 72 hours LEC content includes an emphasis on both communication theory and practice by A survey of contemporary communication topics that allows students to choose a providing students with the opportunity to develop communication competency particular option from several. Possible options may include, but are not limited through a variety of presentation formats. Special emphasis is placed on to: extemporaneous speaking, intercultural communication in the workplace, practical experiences within groups, facilitation of interpersonal relationships, FRPPXQLFDWLRQLQWKHFODVVURRPFRQÁLFWSULQFLSOHVRIYLVXDOFRPPXQLFDWLRQ as well as message design and delivery for multiple purposes and to diverse readers’ theatre, parliamentary procedure and decision making techniques. audiences. In order to effectively assess oral communication competency, each Students may receive one unit of credit in each topic area. Consult class schedule student will complete a minimum of 22 minutes of evaluated speaking time. IRUVSHFLÀFWRSLFVRIIHUHG Videotaping may be required for this course. Access to a computer with online capabilities may be required and is available on campus. COMM 495 INDEPENDENT STUDIES IN COMMUNICATION STUDIES 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Communication Studies 107 COMM 499 EXPERIMENTAL OFFERING IN COMMUNICATION .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 54 hours LEC ; 54 hours LAB 108 Communications Media & Film and Media Studies Folsom Lake College 2011-2012 Communications Media ACADEMIC Folsom campus - 916-608-6510 & Film and Media El Dorado Center - 530-642-5645 Studies COUNSELING Rancho Cordova Center - 916-255-0717 CMED 360 INTRODUCTION TO MOTION GRAPHICS: ADOBE Folsom Lake College has limited offerings in AFTER EFFECTS 3 UNITS Communications Media. The courses are designed to Prerequisite: None. provide a small range of courses for the student wanting Course Transferable to CSU hands-on experience in Television Production and Editing Hours: 36 hours LEC ; 54 hours LAB while providing other students the opportunity to take 7KLVLVDQLQWURGXFWRU\FRXUVHIRUVWXGHQWVLQWHUHVWHGLQPXOWLPHGLD' a course of study in the Survey of Mass Media and an computer animation, and emerging broadcast technologies commonly known as Introduction to Film History. Students taking these courses GHVNWRSYLGHR6WXGHQWVZLOOJDLQKDQGVRQH[SHULHQFHZLWKSLFWXUHDQGYLGHR should have a working knowledge of keyboarding. PDQLSXODWLRQ'FRPSRVLWLQJSDLQWDQGGUDZDSSOLFDWLRQVIRUEURDGFDVW multimedia and the Internet. CMED 362 DIGITAL NON-LINEAR VIDEO EDITING: FINAL CUT Communications Media (CMED) PRO 3 UNITS CMED 300 MASS MEDIA AND SOCIETY 3 UNITS Prerequisite: None Same As: JOUR 310 Course Transferable to CSU Prerequisite: None. Hours: 36 hours LEC ; 54 hours LAB General Education: AA/AS Area V(b); CSU Area D7; IGETC Area 4J The last decade has ushered in a phenomenal convergence of capabilities Course Transferable to UC/CSU among traditional audio/video production technology and personal computers. Hours: 54 hours LEC 0XOWLPHGLDQRQOLQHDUHGLWLQJFRPSXWHUJUDSKLFVFRPSXWHUDQLPDWLRQDQG The class will offer a survey of the mass media: history, philosophy, structure digital video are but a few of the applications developed as a result of these and trends, as well as theories which help to explain effects and the importance joint technologies. This course will trace the development of the computer audio/ as a social institution. The course will explore economics, technology, law, ethics, visual applications. Major uses will be explored and future trends examined. and social issues, including cultural and ethnic diversity. This course is the same ,QDGGLWLRQVWXGHQWVZLOOUHFHLYHKDQGVRQSURGXFWLRQHGXFDWLRQZLWK$SSOH·V as JOUR 310, and only one may be taken for credit. Final Cut Pro with limited exposure to a variety of other digital video software. This course may be taken two times for credit. CMED 305 THE HISTORY OF FILM 3 UNITS Prerequisite: None. CMED 377 CORPORATE VIDEO 3 UNITS General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Prerequisite: None Course Transferable to UC/CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 36 hours LEC ; 54 hours LAB $QLQWURGXFWLRQWRWKHDUWRIPRWLRQSLFWXUHVXVLQJERWKOHFWXUHVDQGÀOPV Students will learn how to produce an effective corporate documentary, 6WXGHQWVZLOOEULHÁ\VWXG\WKHKLVWRU\RIPRWLRQSLFWXUHVDQGZLOOYLHZHYDOXDWH marketing or training presentation. The roles and relationships of the DQGFULWLTXHÀOPVZKLFKDUHODQGPDUNVLQWKHDUWRIPRYLHPDNLQJ7KLVFRXUVH many players in the telecommunications industry are explored. Students is the same as FMS 305, and only one may be taken for credit. gain experience in organizing, planning, allocating and directing resources. Instruction includes targeting an audience to get a desired response, designing CMED 332 ADVANCED TELEVISION PRODUCTION 2 UNITS the message, writing the script, shooting, editing and distribution. Students Prerequisite: CMED 331. Grade of “C” or better required to meet prerequisite. learn about managing complex interrelationships, managing technology in an Course Transferable to CSU environment which mix and match vendors, standards, applications and unique Hours: 108 hours LAB customer requirements. Students planning the total operational process for actual television programs RQDLURUFORVHGFLUFXLW SDUWLFLSDWHLQDQGWDNHUHVSRQVLELOLW\IRUYDULRXVDVSHFWV RIWKHÀQLVKHGSURJUDPVXFKDVDXGLRVZLWFKLQJOLJKWLQJVHWVJUDSKLFVDQG ÀOP0D\EHWDNHQWZRWLPHVIRUFUHGLW Folsom Lake College 2011-2012 Communications Media & Film and Media Studies 109 CMED 495 INDEPENDENT STUDIES IN COMMUNICATIONS MEDIA 1-3 UNITS Film and Media Studies (FMS) Prerequisite: None Course Transferable to CSU FMS 300 INTRODUCTION TO FILM STUDIES 3 UNITS Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None. Course Transferable to UC/CSU CMED 498 WORK EXPERIENCE IN COMMUNICATIONS MEDIA General Education: CSU: C1, IGETC: 3A 1-4 UNITS Hours: 54 hours lecture Prerequisite: None. 7KLVFRXUVHRIIHUVDQLQWURGXFWLRQWRWKHÀOPPHGLXPZLWKHPSKDVLVRQ Advisory: ENGWR 101 aesthetics, theory and methods of critical analysis. Students will examine General Education: AA/AS Area III(b) ÀOPDVDQDUWIRUPDVDPHGLXPIRUFRPPXQLFDWLQJLGHDVDQGDVDVRFLDODQG (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS cultural force. volunteer opportunity or job related to career goals. Course Transferable to CSU FMS 320 FILM GENRE 3 UNITS +RXUV KRXUV/$% Same As: TA 320 (Cinema Genres) This course provides students with opportunities to develop marketable skills Prerequisite: None. in preparation for employment or advancement within their current job. Course Advisory: ENGWR 300 (College Composition) content will include understanding the application of education to the workforce; Course Transferable to UC/CSU completion of required forms, which document the student’s progress and hours Hours: 54 hours lecture spent at the work site; and developing workplace skills and competencies. This course is designed to explore in depth one or more motion picture genres. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU Special attention is paid to development, aesthetics, popularity and artists of the orientation and 75 hours of related paid work experience, or 60 hours of VSHFLÀFIRUP7KLVFRXUVHPD\RQO\EHUHSHDWHGLIWKHJHQUHFRYHUHGLVGLIIHUHQW unpaid work experience, for one unit. An additional 75 or 60 hours of related each time (see the schedule of classes). This course is equivalent to TA 320. The work experience is required for each additional unit. The course may be taken combined number of units between FMS 320 and TA 320 cannot exceed 12 units. four times for credit, when there is new or expanded learning on the job, for FMS 495 INDEPENDENT STUDIES IN FILM AND MEDIA STUDIES a maximum of 16 units. 1-3 UNITS Prerequisite: None CMED 499 EXPERIMENTAL OFFERING IN COMMUNICATIONS Course Transferable to CSU MEDIA .5-4 UNITS Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None Course Transferable to CSU FMS 499 EXPERIMENTAL OFFERING IN FILM AND MEDIA Hours: 18 hours LEC ; 54 hours LAB STUDIES .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 110 Computer Information Science Folsom Lake College 2011-2012 Computer Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Information Science COUNSELING Rancho Cordova Center - 916-255-0717 The Folsom Lake College educational program in Science and Programming provide comprehensive exposure to FRPSXWLQJFRQVLVWVRIFRXUVHVFHUWLÀFDWHVDQGGHJUHHV computer science in preparation for upper-division computer in a variety of areas related to computing. science courses, and preparation for entry-level employment in government, business, and computer-related industries. Individual courses are organized into several groups, Career Options related to computer application user skills (CISA), 3URJUDPPHU7HFKQLFLDQ6RIWZDUH9HULÀFDWLRQDQG7HVWLQJ programming (CISP), the web (CISW), and general Systems Analyst, Systems Designer, Software Engineer; “core” topics (CISC). Students interested in pursuing Firmware Engineer, Software Architect, Computer Engineer, DFHUWLÀFDWHRUGHJUHHPD\FKRRVHIURPDYDULHW\RI Computer Techologist, Technical Manager. Many of these educational programs. These educational programs are options require a Bachelors degree, although some entry- organized into several groups: level opportunities exist for individuals with an Associates GHJUHHRU&HUWLÀFDWH Computer Science and Programming Database Technology and Information Technology Highlights Management Information Systems A great foundation for entry to university A broad-based technical education State-of-the-art computer facilities Computer Science and Programming 6WXG\LQDÀHOGWKDWKDVJUHDWHPSOR\PHQWRSSRUWXQLWLHV and encompasses many careers DEGREES A.S. — Computer Science DEGREE A.S. — Computer Science CERTIFICATES OF ACHIEVEMENT The Computer Science degree provides a comprehensive Programming exposure to computer science in preparation for upper- division computer science courses. The program also prepares What is Computer Science? students for entry level employment in the computer and New technology creates the future. Computer scientists use a related industries. The Computer Science Associate in body of skills and knowledge to create these new computer Science (A.S.) Degree may be obtained by completion of hardware and software technologies. Computer scientists the required program, plus general education requirements, are technically educated professionals, and can be found SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO6HH)/& ZRUNLQJ LQ PDQ\ ÀHOGV DV SURJUDPPHUV DQG GHVLJQHUV graduation requirements. DVH[SHUWVLQWKHXVHRIWHFKQRORJ\LQRWKHUÀHOGVDQGDV managers in a variety of organizations. Required Program ...... Units CISC 310 Introduction to Computer Information &RPSXWHU 6FLHQFH DV D ÀHOG RI VWXG\ HQFRPSDVVHV WKH Science ...... 3 following subareas: Algorithms and Data Structures, CISP 300 Algorithm Design/Problem Solving ...... 3 Programming Languages, Hardware and Software CISP 310 Assembly Language Prog. for Microcomputers $UFKLWHFWXUH 6RIWZDUH (QJLQHHULQJ 'DWDEDVHV $UWLÀFLDO (4) or ENGR 303 Intro to Logic Design (4) ...... 4 Intelligence and Robotics, Computer Animation and Graphics, CISP 360 Introduction to Structured Programming 4 Computer Games, Networks, Security, and Bioinformatics. CISP 400 Object Oriented Programming with C++ (4) or CISP 401 Object Oriented Programming with Java Academic Programs (4) ...... 4 Help create the technological future of computing. CISP 430 Data Structures ...... 4 CISP 440 Discrete Structures for Computer Science The Folsom Lake College academic programs in Computer ...... 3 A minimum of 10 units from the following: Folsom Lake College 2011-2012 Computer Information Science 111 CHEM 400 General Chemistry (5) Required Program ...... Units CISP 351 Introduction to Relational Database CISC 310 Introduction to Computer Information Design & SQL (3) Science ...... 3 CISP 365 Windows API Programming with C (4) CISP 300 Algorithm Design/Problem Solving ...... 3 CISP 370 Beginning Visual Basic (4) CISP 360 Introduction to Structured Programming (4) CISP 371 Intermediate Visual Basic (4) or CISP 370 Beginning Visual Basic (4) ...... 4 CISP 405 Object Oriented Programming using C# CISP 400 Object Oriented Programming with C++ on Visual (4) Studio .NET (4) or CISP 401 Object Oriented Programming with JAVA CISP 453 Introduction to Systems Programming (4) in Unix (4) or CISP 405 Object Oriented Programming ENGR 303 Introduction to Logic Design (4) using C# on Visual Studio .NET (4) ENGR 400 Introduction to Electrical Circuits and or CISP 371 Beginning Visual Basic (4) ...... 4 Devices (3) CISP 430 Data Structures ...... 4 MATH 400 Calculus I (5) CISP 440 Discrete Structures for Computer Science MATH 401 Calculus II (5) ...... 3 PHYS 411 Mechanics of Solids and Fluids (4) TOTAL UNITS REQUIRED ...... 21 PHYS 421 Electricity and Magnetism (4) PHYS 431 Heat, Waves, Light and Modern Physics (4) Upon completion of this program, the student will be able to: TOTAL UNITS REQUIRED ...... 35 Design, write, test and debug computer programs, using a structured language, and an object-oriented Transfer students should select electives and general language. HGXFDWLRQFRXUVHVWRIXOÀOOWKHUHTXLUHPHQWVRIWKHWUDQVIHU Evaluate software systems for conformance to system institution. Transfer students are advised to consult with an requirements. FLC counselor to plan their programs. Transfer students Participate as a member of a software development should also see www.assist.org for required transfer course team. articulation. CERTIFICATE OF ACHIEVEMENT Upon completion of this program, the student will be able to: Computer Programmer - SQL Design, write, test and debug computer programs, Relational Database Administration using a low-level language, a structured language, and an object-oriented language. CERTIFICATES OF RECOGNITION Evaluate various solutions to a proposed problem in Database Analyst - SQL terms of programming languages, software architecture, and other appropriate computer technologies. What is Information Technology? Demonstrate a fundamental knowledge of the basic The modern world runs on information technology. IT FRQFHSWVWKDWGHÀQHWKHGLVFLSOLQHRIFRPSXWHUVFLHQFH professionals use software tools to design, create, and such as data structures, discrete mathematics, basic maintain the information systems used to run organizations. computer architecture, operating system internals, networking fundamentals, and programming languages. Academic Programs This Folsom Lake College program includes study in CERTIFICATE OF ACHIEVEMENT Database Technology and Information Technology systems. Programming It is designed for the student interested in entry-level 7KH3URJUDPPLQJ&HUWLÀFDWHSURYLGHVVWXGHQWVZLWKWKHEDVLF information-technology oriented employment in government, SURÀFLHQFLHVUHTXLUHGRIHQWU\OHYHOVRIWZDUHWHFKQLFLDQV business and industry. The Database Technology option and computer programmers, or for further study in computer RIIHUVFHUWLÀFDWHVLQD´ODGGHUµDSSURDFKZLWKLQWURGXFWRU\ science. FHUWLÀFDWHV SURYLGLQJ SURJUHVV WRZDUGV PRUH DGYDQFHG FHUWLÀFDWHV7KH:HEDQG,QWHUQHW3URJUDPPLQJFHUWLÀFDWHV provide students with skills required to create database- driven websites for the Internet and the internal intranets used by most business and industry organizations. 112 Computer Information Science Folsom Lake College 2011-2012 Career Options Database Ladder - Level 2 Database Analyst – SQL; Computer Programmer – SQL; CERTIFICATE OF ACHIEVEMENT Relational Database Administrator; Systems Analyst; Computer Programmer - SQL Programmer; Data Entry Specialist; Internet Programmer; 7KLVFHUWLÀFDWHLVGHVLJQHGIRUVWXGHQWVZKRKDYHFRPSOHWHG Web Programmer WKH'DWDEDVH$QDO\VW²64/&HUWLÀFDWHDQGDVSLUHWREHHQWU\ level programmers using the Structured Query Language Highlights 64/ 7KLV LV WKH VHFRQG LQ D VHULHV RI WKUHH FHUWLÀFDWH Technical training in designing and administering IT programs in Relational Database Management Systems. systems Hands-on experience in a state-of-the-art computer REQUIRED PROGRAM ...... Units center CISC 310 Intro to Computer Information Science ..3 6WXG\LQDÀHOGWKDWKDVJUHDWHPSOR\PHQWRSSRUWXQLWLHV CISC 323 Linux Operating System ...... 1 and encompasses many careers. CISC 324 Intermed Linux Operating System ...... 1 CISP 300 Algorithm Design/Problem Solving ...... 3 Database Ladder - Level 1 CISP 351 Intro to Relational Database Design & CERTIFICATE OF RECOGNITION SQL ...... 3 Database Analyst - SQL CISP 352 Intermediate SQL ...... 3 7KLVFHUWLÀFDWHLVGHVLJQHGIRUEHJLQQLQJVWXGHQWVDVZHOO CISP 353 Application Development in a Client as technical professionals who aspire to design, create, Server Environment ...... 3 or administer relational databases and create client Two to four (2-4) units selected from the following: ...2-4 applications. Successful students will be prepared to apply CISP 370 Beginning Visual BASIC (4) or for entry-level positions in industry such as business analyst. CISA 320 Database Management (1) and 7KH'DWDEDVH$QDO\VW&HUWLÀFDWHLVWKHÀUVWLQDVHULHVRI CISA 321 Intermed Database Management (1) WKUHH FHUWLÀFDWH SURJUDPV GHVLJQHG IRU WKH HQWU\OHYHO TOTAL UNITS REQUIRED ...... 19-21 student and business user. Required Program ...... Units Upon completion of this program, the student will be able to: CISC 310 Intro to Computer Information Science ..3 List the hardware components of a computer system CISC 323 Linux Operating System ...... 1 and differentiate among system and application CISC 324 Intermed Linux Operating System ...... 1 software. CISP 300 Algorithm Design/Problem Solving ...... 3 Describe the relationship of operating systems to CISP 351 Intro to Relational Database Design & GDWDEDVHÀOHPDQDJHPHQW SQL ...... 3 Apply intermediate level Linux utilities, such as awk CISP 352 Intermediate SQL ...... 3 and sed, to implement complex algorithms. TOTAL UNITS REQUIRED ...... 14 Explain the common gateway interface (CGI) protocol and apply those concepts to build an interactive web Upon completion of this program, the student will be able to: page. List the hardware components of a computer system Devise computerized solutions in the development and differentiate among system and application of databases by applying a solid foundation of software. algorithmic principles. Describe the relationship of operating systems to Distinguish between the user interfaces of the operating GDWDEDVHÀOHPDQDJHPHQW system text in regards to using either most effectively. Devise computerized solutions in the development Compare and contrast hierarchical, network, and of databases by applying a solid foundation of relational databases. algorithmic principles. Design, create, and administer relational databases. Distinguish between the user interfaces of the operating Create client applications using structured query system text in regards to using either most effectively. language (SQL). Compare and contrast hierarchical, network, and Create a user interface with visual basic to connect to relational databases. a database server. Design, create, and administer relational databases. 'HVLJQWDEOHVIRUPVTXHULHVDQGUHSRUWVXVLQJRIÀFH Create client applications using structured query database application software. language (SQL). Folsom Lake College 2011-2012 Computer Information Science 113 Database Ladder - Level 3 Management Information Systems CERTIFICATE OF ACHIEVEMENT CERTIFICATES OF ACHIEVEMENT Relational Database Administration M.I.S. - Application Technician 7KH 5HODWLRQDO 'DWDEDVH $GPLQLVWUDWLRQ &HUWLÀFDWH LV M.I.S. - Information Processing designed for a person who is responsible for interacting CERTIFICATES OF RECOGNITION with SQL Programmers, Database Designers, Systems M.I.S. - Application Data Entry Administrators, and Network Engineers as well as the day- to-day operation of a Relational Database Management What is Management Information Systems? System. This course of study is appropriate for an entry Management Information Systems is concerned with the level Database Administration position. use and management of computer hardware and software application programs in a business environment. REQUIRED PROGRAM ...... Units CISA 320 Database Management ...... 1 Academic Programs CISA 321 Intermediate Database Management ..1 This Folsom Lake College program includes study in CISC 310 Intro to Computer Information Science ..3 management information systems. The MIS option offers a CISC 323 Linux Operating System ...... 1 ´ODGGHUµDSSURDFKZLWKLQWURGXFWRU\FHUWLÀFDWHVSURYLGLQJ CISC 324 Intermed Linux Operating System ...... 1 SURJUHVVWRZDUGVPRUHDGYDQFHGFHUWLÀFDWHV*UDGXDWHV CISC 325 Adv Linux Operating System ...... 1 RIWKHSURJUDPVKRXOGH[SHFWWRÀQGHQWU\OHYHOFRPSXWHU CISP 300 Algorithm Design/Problem Solving ...... 3 application management or administration oriented CISP 351 Intro to Relational Database Design & employment in government, business and industry, and/or SQL ...... 3 acquire skills for the use of computer applications. CISP 352 Intermediate SQL ...... 3 CISP 354 Intro to Relational Database Admin ...... 3 Career Options TOTAL UNITS REQUIRED ...... 20 Computer Operator; Applications Software Specialist; Systems Analyst; Data Entry Specialist; Computer Systems Upon completion of this program, the student will be able to: Specialist; Computer Technician, Webmaster List the hardware components of a computer system and differentiate among system and application Highlights software. Hands-on experience in a state-of-the-art computer center. 'HVLJQWDEOHVIRUPVTXHULHVDQGUHSRUWVXVLQJRIÀFH 6WXG\LQDÀHOGWKDWKDVJUHDWHPSOR\PHQWRSSRUWXQLWLHV database application software. and encompasses many careers. Design multi-table forms, establish table relationships and create macros using visual basic for applications MIS Ladder - Level 1 (VBA). CERTIFICATE OF RECOGNITION Describe the relationship of operating systems to Management Information Systems - GDWDEDVHÀOHPDQDJHPHQW Application Data Entry Apply system administration concepts and perform 7KLVFHUWLÀFDWHLVGHVLJQHGIRUSHUVRQVZKRQHHGWRNQRZ WDVNVVXFKDVFUHDWLQJÀOHV\VWHPVDQGPRQLWRUV\VWHP how to perform computer-related data entry. Students performance. ZKRFRQWLQXHWKHLUHGXFDWLRQE\SXUVXLQJDQRWKHU2IÀFH Devise computerized solutions in the development Administration or Management Information Systems of databases by applying a solid foundation of FHUWLÀFDWH PD\ GR VR ZLWKRXW UHSHDWLQJ DQ\ FRXUVHV algorithmic principles. FRPSOHWHGIRUWKLVFHUWLÀFDWH Distinguish between the user interfaces of the operating system text in regards to using either most effectively. Required Program ...... Units Compare and contrast hierarchical, network, and BUSTEC 101 Computer Keyboarding: 10 Key...... 1 relational databases. %867(& 2IÀFH3URFHGXUHV ...... 3 Design, create, and administer relational databases. BUSTEC 302 Computer Keyboarding ...... 2 Create client applications using structured query BUSTEC 303 Computer Keyboard Formatting ...... 2 language (SQL). CISA 300 Beginning Word Processing ...... 1 Create a user interface with visual basic to connect to CISC 300 Computer Familiarization (1) or a database server. CISC 310 Intro. to Computer Information Science (3) Perform database backup and recoveries...... 1-3 TOTAL UNITS REQUIRED ...... 10-12 114 Computer Information Science Folsom Lake College 2011-2012 Upon completion of this program, the student will be able to: 'HPRQVWUDWHDVXIÀFLHQWZRUNLQJNQRZOHGJHRIHIIHFWLYH 'HPRQVWUDWH LQGHSWK NQRZOHGJH RI FRPPRQ RIÀFH FRPPXQLFDWLRQDQGXVHRIRIÀFHFRPSXWHUDSSOLFDWLRQVWR computerized application software and operating VHHNHPSOR\PHQWLQDQRIÀFHHQYLURQPHQWDVLQIRUPDWLRQ systems. processing workers Describe and apply ergonomic principles required to maintain appropriate posture and hand positions, and MIS Ladder - Level 3 to avoid eyestrain while using computers for data entry. CERTIFICATE OF ACHIEVEMENT Use the keyboard to input data and use a mouse or Management Information Systems - Application other pointing device to issue computer commands or Technician access software functions 7KLVFHUWLÀFDWHSURYLGHVDGGLWLRQDOWUDLQLQJLQWKHXVHRIWKH Type thirty six words a minute with a maximum of three most common computerized business application programs. errors. This course of study would be appropriate for a user who Operate a numeric keypad by touch at a rate of LVWKHOHDGSHUVRQLQDQRIÀFH 10,000 or more keystrokes an hour with 98 percent accuracy. Required Program ...... Units Create business documents such as letters and reports Management Information Systems - Information Processing using appropriate business writing style, document &HUWLÀFDWH ...... 16-18 appearance, grammar usage, and writing mechanics. CISA 311 Intermed Electr Spreadsheets ...... 1 2SHUDWHRIÀFHHTXLSPHQWVXFKDVFRPSXWHUVWHOHSKRQHV CISA 321 Intermed Database Management ...... 1 fax machines, and reprographic equipment. CISC 320 Operating Systems ...... 1 CISA 340 Presentation Graphics ...... 2 MIS Ladder - Level 2 TOTAL UNITS REQUIRED ...... 21-23 CERTIFICATE OF ACHIEVEMENT Management Information Systems - Information Upon completion of this program, the student will be able to: Processing Create formal business documents, labels and 7KLV FHUWLÀFDWH LV GHVLJQHG IRU WKH SHUVRQ ZKR QHHGV envelope through mail merging, inclusion of graphics familiarity with the most common computerized business and tables, and use of templates. application programs. Compose on-screen and print presentations and web pages Required Program ...... Units Prepare and present a variety of charts that present 0DQDJHPHQW,QIRUPDWLRQ6\VWHPV'DWD(QWU\&HUWLÀFDWH data in a clear and understandable manner...... 10-12 Demonstrate competence using the tools, commands, and BUS 310 Business Communication ...... 3 other features of a graphical user interface operating CISA 301 Intermed Word Processing ...... 1 system to run application software, research and receive CISA 310 Electronic Spreadsheets ...... 1 on-line and off-line help with the system or other software, CISA 320 Database Management ...... 1 DQGSHUIRUPÀOHPDQDJHPHQWKRXVHNHHSLQJWDVNV TOTAL UNITS REQUIRED ...... 16-18 Locate, identify, and change the settings within an operating system to provide more functionality for computer users. Upon completion of this program, the student will be able to: 'HVLJQRIÀFHDSSOLFDWLRQPDFURVWKDWUHGXFHUHGXQGDQF\ Create formal business documents such as letters of tasks and reports using appropriate business writing style, Prepare accurate spreadsheets that can gather data document appearance, grammar and mechanics. from other sources Compose and deliver effective oral and graphical Prepare database switchboards that allow non- presentations in an appropriate manner database users to enter, save, retrieve and print data 'HVFULEHWKHFKDUDFWHULVWLFVRIHIIHFWLYHÀOHPDQDJHPHQW with little training. SULQFLSOHV LQ VWRULQJ DQG UHWULHYLQJ ÀOHV ZKHQ XVLQJ D 6HHNHPSOR\PHQWDVDOHDGSHUVRQLQDQRIÀFHHQYLURQPHQW variety of computer applications. ZLWKDQLQGHSWKNQRZOHGJHRIFRPPRQRIÀFHFRPSXWHUL]HG 3UHSDUH DFFXUDWH VSUHDGVKHHWV HIÀFLHQWO\ E\ XVLQJ application software. appropriate formulas or functions and format those sheets in an attractive easy-to-understand manner. Analyze data needs and prepare tables, forms, queries and reports that display extracted data in an accurate, reliable and readable format. Folsom Lake College 2011-2012 Computer Information Science 115 CISA 311 INTERMEDIATE ELECTRONIC SPREADSHEETS 1 UNIT Computer Info Science - Apps (CISA) Prerequisite: CISA 310 with a grade of “C” or better Course Transferable to CSU CISA 299 EXPERIMENTAL OFFERING IN COMPUTER Hours: 18 hours LEC ; 18 hours LAB INFORMATION SCIENCE - APPLICATIONS .5-4 UNITS This course will extend the capabilities of students who have started to use Prerequisite: None electronic spreadsheet software. Topics and laboratory assignments will include Hours: 18 hours LEC ; 54 hours LAB using multiple worksheets and workbooks, web tools, scenario management, CISA 300 BEGINNING WORD PROCESSING 1 UNIT solver, imported data, the lookup function, and macros. Prerequisite: None. Advisory: BUSTEC 302 and CISC 300 CISA 320 INTRODUCTION TO DATABASE MANAGEMENT 1 UNIT Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 18 hours LAB Advisory: CISC 300 or 310 This course is designed to introduce students to the use of word processing Course Transferable to CSU programs. The course includes basic word processing operations: creating, Hours: 18 hours LEC ; 18 hours LAB editing, formatting, saving, retrieving, and printing text documents. This course introduces database management systems. Using Windows application programs, students will design and implement practical database CISA 301 INTERMEDIATE WORD PROCESSING 1 UNIT applications. Topics include database and reports design, data views and Prerequisite: CISA 300 with a grade of “C” or better queries, and data maintenance. Course Transferable to CSU Hours: 18 hours LEC ; 18 hours LAB CISA 321 INTERMEDIATE DATABASE MANAGEMENT 1 UNIT This course is designed to build upon previous training in the use of word Prerequisite: CISA 320 with a grade of “C” or better processing. The course covers intermediate to advanced word processing Course Transferable to CSU features, such as styles, macros, outlines, document notations, forms, charts, Hours: 18 hours LEC ; 18 hours LAB and mail merge. Also covered are integrating word processing with other 7KLVFRXUVHZLOOH[WHQGWKHFDSDELOLWLHVRIVWXGHQWVZKRKDYHFRPSOHWHGDÀUVW applications and creating documents for the use on the Internet, i.e. web pages course in database management. Students design and implement practical DQGHPDLODWWDFKPHQWV database applications, including relational database design to develop programming applications. CISA 308 EXPLORING WORD PROCESSING AND PRESENTATION SOFTWARE 1 UNIT CISA 330 DESKTOP PUBLISHING 2 UNITS Prerequisite: None. Prerequisite: None. Advisory: BUSTEC 302 and CISC 300 Advisory: BUSTEC 302, CISA 300, CISA 308, or CISC 300 Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 18 hours LAB Hours: 27 hours LEC ; 27 hours LAB This course introduces the student to word processing and presentation software. The course introduces desktop publishing through the use of a current desktop The basic features and skills of creating, editing, formatting, inserting tables and publishing application program. Material presented will include page layout graphics, and enhancing word processed documents and graphic presentations VNLOOVQHHGHGWRSURGXFHQHZVOHWWHUVEURFKXUHVÁ\HUVUHSRUWVDQGPDUNHWLQJ are covered. This one unit course is primarily designed to meet the requirements materials. Topics will include importing graphics and text, using palette menus, IRUWUDQVIHUWR6FKRRORI%XVLQHVV$GPLQLVWUDWLRQDW&686DV0,6& layers, master pages, styles, and working with graphic and text frames. Students may incur additional costs for storage media and printing. This course may be CISA 310 INTRODUCTION TO ELECTRONIC SPREADSHEETS 1 UNIT taken two times if using a different software package or software version. Prerequisite: None. Advisory: CISC 300 and MATH 20 Course Transferable to CSU Hours: 18 hours LEC ; 18 hours LAB This course is designed to introduce the student to the use of spreadsheet programs. The course will include designing a spreadsheet, developing formulas for accurate automatic calculations, using spreadsheet functions, producing FKDUWVGHYHORSLQJ´ZKDWLIµPRGHOVEDVHGXSRQUHODWLYHDQGDEVROXWHFHOO referencing. Students will be using mathematical concepts and skills. 116 Computer Information Science Folsom Lake College 2011-2012 CISA 340 PRESENTATION GRAPHICS 2 UNITS CISC 306 INTRODUCTION TO WEB PAGE CREATION 1 UNIT Prerequisite: None. Prerequisite: CISC 305 with a grade of “C” or better Advisory: CISA 300 and CISC 300 Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 18 hours LAB Hours: 27 hours LEC ; 27 hours LAB This course covers the production of web pages, including formatting, layout, 7KLVFRXUVHSUHVHQWVDQLQGHSWKORRNDWXVLQJFRPSXWHUVRIWZDUHGHYHORSRUDO construction, and presentation. A current markup language such as XHTML, ZULWWHQDQGRQVFUHHQSUHVHQWDWLRQV7RSLFVLQFOXGHV\VWHPUHTXLUHPHQWV is used to format web pages. Students may also use a web authoring tool to graphic software, elements of a good presentation, types of graphics, and create Web pages. using slide show techniques for visual presentations. Students will learn how to edit and format presentations, animation, organizational charts, and CISC 308 EXPLORING COMPUTER ENVIRONMENTS AND THE clips (graphics, sounds, or video. Linking presentations into word processing, INTERNET 1 UNIT VSUHDGVKHHWRUGDWDEDVHÀOHVZLOOEHLQWURGXFHG6WXGHQWVZLOOXVHDYDULHW\RI Prerequisite: None computer hardware and software to produce individual and/or group projects. Course Transferable to CSU This course may be taken twice if using different desktop publishing software Hours: 18 hours LEC ; 18 hours LAB RUDVLJQLÀFDQWO\GLIIHUHQWVRIWZDUHYHUVLRQ This course acquaints the student with the fundamentals of microcomputer hardware, software and computer networking. CISA 499 EXPERIMENTAL OFFERING IN COMPUTER INFORMATION SCIENCE - APPLICATIONS .5-4 UNITS CISC 310 INTRODUCTION TO COMPUTER INFORMATION SCIENCE Prerequisite: None 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB General Education: AA/AS Area II(b); AA/AS Area III(b) Course Transferable to UC/CSU Hours: 54 hours LEC Computer Info Science - Core (CISC) 7KLVFRXUVHLVDQLQWURGXFWLRQWRWKHFRPSXWHUÀHOGFRYHULQJWKHIXQFWLRQDQG concepts of hardware, computer programming, application and operating CISC 300 COMPUTER FAMILIARIZATION 1 UNIT software, data communications, the Internet, databases, employment Prerequisite: None. opportunities, and the social impact of the computer. Students will be reading General Education: AA/AS Area III(b) and interpreting written and oral instruction of a technical nature. Course Transferable to CSU Hours: 18 hours LEC ; 18 hours LAB CISC 320 OPERATING SYSTEMS 1 UNIT This is an introductory course to provide general knowledge on how computers Prerequisite: None work, computer terminology and the impact of computers on society and the Advisory: CISC 300 or 310. ZRUNHQYLURQPHQW%HJLQQLQJOHYHOKDQGVRQLQVWUXFWLRQXVLQJDQRSHUDWLQJ Course Transferable to CSU system, word processing software, spreadsheet software, and the Internet Hours: 18 hours LEC ; 18 hours LAB will be emphasized. Students will be reading and interpreting written and oral This course introduces the student to the concepts of an operating system (for instructions of a technical nature. example, Windows, AS 400, or UNIX). Students may receive one unit credit for HDFKWRSLFRIIHUHG&RQVXOWWKHFODVVVFKHGXOHIRUVSHFLÀFWRSLFV CISC 305 INTRODUCTION TO THE INTERNET 1 UNIT Prerequisite: CISC 300 or 310 with a grade of “C” or better CISC 321 INTERMEDIATE OPERATING SYSTEMS 1 UNIT Course Transferable to CSU Prerequisite: CISC 320. Grade of “C” or better required to meet prerequisite. Hours: 18 hours LEC ; 18 hours LAB Computer programing experience highly recommended. This course explains how the Internet works, how to connect, and how to use Course Transferable to CSU Internet services. Laws that guide the use of the Internet will be covered. Hours: 18 hours LEC ; 18 hours LAB 2WKHUWRSLFVLQFOXGH,QWHUQHWSURWRFROVHPDLOQHZVJURXSVGLVFXVVLRQOLVWV This course is intended to advance the student’s knowledge of operating connecting to a remote server, File Transfer Protocol (FTP), World Wide Web, systems, (for example, DOS, Windows or UNIX). The class covers the study and emerging technologies. RIDGYDQFHGFRPPDQGVHIIHFWLYHXWLOLW\XVHDGYDQFHGEDWFKÀOHVVFULSWÀOHV SURJUDPORJLFGLVNRUJDQL]DWLRQPDNLQJXVHUIULHQGO\V\VWHPVDQWLFLSDWLQJ and preventing system problems. The class may be taken more than once for credit, if the course covers a different operating system than that for which the student had previously received credit. Folsom Lake College 2011-2012 Computer Information Science 117 CISC 323 LINUX OPERATING SYSTEM 1 UNIT CISC 498 WORK EXPERIENCE IN COMPUTER INFORMATION Prerequisite: None. SCIENCE - CORE 1-4 UNITS Advisory: CISC 300 or 310 Prerequisite: None. Course Transferable to CSU Advisory: ENGWR 101 Hours: 18 hours LEC ; 18 hours LAB General Education: AA/AS Area III(b) This course introduces the Linux operating system for microcomputers. Concepts (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS LQFOXGHNHUQHOVÀOHVWUXFWXUHVGDHPRQVDQGVKHOOV7KHFRXUVHZLOODOVRLQFOXGH volunteer opportunity or job related to career goals. procedures for installing software, creation of user accounts, shell commands, Course Transferable to CSU VFULSWVDQGÀOHVHFXULW\ +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills CISC 324 INTERMEDIATE LINUX OPERATING SYSTEM 1 UNIT in preparation for employment or advancement within their current job. Course Prerequisite: CISC 323 with a grade of “C” or better content will include understanding the application of education to the workforce; Course Transferable to CSU completion of required forms, which document the student’s progress and hours Hours: 18 hours LEC ; 18 hours LAB spent at the work site; and developing workplace skills and competencies. This course is a continuation of CISC 323. It covers intermediate shell scripting 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU WRLQFOXGHGHFLVLRQPDNLQJORJLFORRSLQJQHVWLQJDQGRWKHUVFULSWLQJWRROV orientation and 75 hours of related paid work experience, or 60 hours of Students will write simple Perl scripts, C and C++ programs, and will develop unpaid work experience, for one unit. An additional 75 or 60 hours of related an interactive web page using the Common Gateway Interface. work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for CISC 325 ADV. LINUX OPERATING SYSTEM 1 UNIT a maximum of 16 units. Prerequisite: CISC 323 with a grade of “C” or better Advisory: CISC 324 CISC 499 EXPERIMENTAL OFFERING IN COMPUTER INFORMATION Course Transferable to CSU SCIENCE - CORE .5-4 UNITS Hours: 18 hours LEC ; 18 hours LAB Prerequisite: None This course is an extension of concepts learned in Intermediate Linux Operating Course Transferable to CSU System course. Concepts include system installation, administration, and Hours: 18 hours LEC ; 54 hours LAB security. The course will also cover network administration, package managers, DQG;:LQGRZV Computer Info Science - Programming CISC 495 INDEPENDENT STUDIES IN COMPUTER INFORMATION SCIENCE - CORE 1-3 UNITS (CISP) Prerequisite: None CISP 300 ALGORITHM DESIGN/PROBLEM SOLVING 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB Corequisite: CISC 310 Advisory: CISC 305 Course Transferable to UC/CSU Hours: 54 hours LEC This course introduces the Computer Science major to methods for solving classical computer problems through algorithm design. Topics covered include introduction to structured design, control structures, arrays, object oriented SURJUDPPLQJDQGÀOHSURFHVVLQJ6WXGHQWVZLOOOHDUQKRZWRDVVHVVDQGDQDO\]H FRPSXWHUSUREOHPVLQDWRSGRZQGLYLGHDQGFRQTXHUDSSURDFKWKDWOHDGVWRD programming solution. It also includes creating programming plans and detailed design documents from which source code versions of programs will be created. 118 Computer Information Science Folsom Lake College 2011-2012 CISP 310 ASSEMBLY LANGUAGE PROGRAMMING FOR CISP 354 INTRODUCTION TO RELATIONAL DATABASE MICROCOMPUTERS 4 UNITS ADMINISTRATION 3 UNITS Prerequisite: CISP 360 with a grade of “C” or better Prerequisite: None. Course Transferable to UC/CSU Advisory: CISP 352 Hours: 72 hours LEC Course Transferable to CSU This course is an introduction to computer architecture using assembly language Hours: 54 hours LEC programs. Topics include binary representation of data and instructions, memory This course is designed to introduce students to administering a relational addressing modes, subroutines and macros, operating system interrupts, database management system (RDBMS). Topics include managing users, processor architecture, and interfacing with high level languages. privileges, resources, and tablespaces creating an operational database, PDQDJLQJGDWDEDVHÀOHVKRZWRVWDUWXSDQGVKXWGRZQDQLQVWDQFHRUGDWDEDVH CISP 351 INTRODUCTION TO RELATIONAL DATABASE DESIGN the data dictionary, transaction processing, and backup and recovery issues. AND SQL 3 UNITS &RPSOHWLRQZLOOSURYLGHVWXGHQWVZLWKVXIÀFLHQWNQRZOHGJHIRUDQHQWU\OHYHO Prerequisite: None. database administrator (DBA) position in industry. Course Transferable to CSU Hours: 54 hours LEC CISP 360 INTRODUCTION TO STRUCTURED PROGRAMMING This course is designed to introduce relational database technology, 4 UNITS QRUPDOL]DWLRQHQWLW\UHODWLRQVKLSVORJLFDOPRGHOGHVLJQDQG,62$16,VWDQGDUG Prerequisite: CISP 300 with a grade of “C” or better Structured Query Language (SQL). Topics covered include: database design, basic General Education: AA/AS Area II(b) properties of a relational database such as relations, tables, primary keys, Course Transferable to UC/CSU foreign keys and principles of normalization, simple SQL select statements, Hours: 72 hours LEC sorting and grouping data, joining tables, subqueries and views. The database This course is an introduction to structured programming. The topics covered GHVLJQVHFWLRQIRFXVHVRQORJLFDOPRGHOGHVLJQDQGHQWLW\UHODWLRQVKLS (5 LQFOXGH WRSGRZQGHVLJQLQSXWRXWSXWFRQVLGHUDWLRQVFRQWUROVWUXFWXUHVDQG modeling. Students will leave the course with a good working knowledge of ÁRZFRQWUROYDULDEOHVFRQVWDQWVWKHXVHRIOLEUDULHVVLPSOHWRLQWHUPHGLDWH database technology. This course may be taken three times for credit using data structures, functions, and arguments. An introduction into objects will be different Relational Database Management System software such as Oracle, included. SQL Server or MySQL. CISP 365 WINDOWS API PROGRAMMING WITH C 4 UNITS CISP 352 INTERMEDIATE SQL 3 UNITS Prerequisite: CISP 360 or 405 with a grade of “C” or better Prerequisite: None. Course Transferable to CSU Advisory: CISP 351 Hours: 72 hours LEC Course Transferable to CSU This course is an introduction to writing Graphical User Interface (GUI) Hours: 54 hours LEC programs for the Windows operating system using the Windows Application This course builds upon the Introduction to Relational Databases and Structured Program Interface(API) and the C programming language. This course provides 4XHU\/DQJXDJH 64/ FRXUVHZLWKPRUHLQGHSWK64/FRQVWUXFWVFRPPRQWR the student with a fundamental understanding of the Windows API and the most commercial database products and extensions to the SQL language. Topics internal architecture of Windows GUI applications and their interaction with the include: complex joins including inner and outer joins, correlated subqueries, operating system. Topics to be covered include the architecture of a Windows FRPSOH[WDEOHGHÀQLWLRQDQGWDEOHDQGFROXPQFRQVWUDLQWVXQLRQLQWHUVHFWLRQ API application, creating a message pump, processing keyboard and mouse minus, triggers, procedures and functions. messages, window styles, dialog boxes, menus and other resources, bitmaps, multithreading, sound, and timers. CISP 353 APPLICATION DEVELOPMENT IN A CLIENT SERVER ENVIRONMENT 3 UNITS CISP 370 BEGINNING VISUAL BASIC 4 UNITS Prerequisite: None. Prerequisite: CISP 300 with a grade of “C” or better Advisory: CISP 352 Course Transferable to UC/CSU Course Transferable to CSU Hours: 72 hours LEC Hours: 54 hours LEC This course is an introduction to the Visual Basic programming language. This course is designed for the intermediate level Structured Query Language Students will design Console and Graphical User Interface programs for the (SQL) programmer to design, create and deploy Graphical User Interface(GUI) Windows environment. Topics include control structures such as simple sequence, applications that access relational database management systems. Topics decisions, and iteration, procedures events, properties, error handling, form include Graphical User Interface (GUI) design fundamentals, data control and handling, and the use of typical controls such as buttons, textboxes, checkboxes, access methods (remote and local), creating datasets, implementing joins, and listboxes. This course will provide students with a foundation in the use WUDQVDFWLRQSURFHVVLQJPXOWLXVHUGDWDDFFHVVUHFRUGORFNLQJDQGGHSOR\LQJ RIREMHFWVREMHFWOLEUDULHVDQGREMHFWRULHQWHGHYHQWGULYHQSURJUDPPLQJ and installing applications on client workstations. techniques. Folsom Lake College 2011-2012 Computer Information Science 119 CISP 371 INTERMEDIATE VISUAL BASIC 4 UNITS CISP 430 DATA STRUCTURES 4 UNITS Prerequisite: CISP 370 with a grade of “C” or better Prerequisite: CISP 360 Course Transferable to UC/CSU Advisory: CISP 400 Hours: 72 hours LEC Course Transferable to UC/CSU This is a second semester course in Visual Basic programming using Visual Studio. Hours: 72 hours LEC NET. Topics include the Visual Studio.NET Integrated Development Environment This is a course in data structures for computer science. Topics include time (IDE), object oriented programming concepts, and various .NET technologies. FRPSOH[LW\DQDO\VLVDQGELJ2QRWDWLRQUHFXUVLRQVHDUFKLQJDQGVRUWLQJOLQNHG Students will develop programs for the Windows desktop and Web browsers OLVWVVWDFNVTXHXHVSULRULW\TXHXHVELQDU\WUHHV%WUHHVJUDSKVKDVKLQJDQG (ASP.NET), as well explore other .NET technologies such as Web Services, Windows basic encryption algorithms. Services, and .NET Remoting. CISP 440 DISCRETE STRUCTURES FOR COMPUTER SCIENCE CISP 400 OBJECT ORIENTED PROGRAMMING WITH C++ 4 UNITS 3 UNITS Prerequisite: CISP 360 with a grade of “C” or better Prerequisite: MATH 370 with a grade of “C” or better General Education: AA/AS Area II(b) Corequisite: CISP 430 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 72 hours LEC Hours: 54 hours LEC This course is an introduction to the C++ programming language. Topics include This course is an introduction to the essential discrete structures used in classes, encapsulation, polymorphism, inheritance, overloading, overriding, Computer Science, with emphasis on their applications. Topics to be covered YLUWXDOIXQFWLRQVWHPSODWHVH[FHSWLRQKDQGOLQJVWUHDP,2ÀOHSURFHVVLQJ include: elementary formal logic and set theory, elementary combinatorics, and the Standard Template Library. Also covered are an introduction to GUI recursive programming and algorithm analysis, digital logic and switching, development using class libraries, and an introduction to object oriented combinational circuits, and computer arithmetic. design methodology. CISP 453 INTRODUCTION TO SYSTEMS PROGRAMMING IN UNIX CISP 401 OBJECT ORIENTED PROGRAMMING WITH JAVA 4 UNITS 4 UNITS Prerequisite: CISP 310 and 430 with grades of “C” or better Prerequisite: CISP 360 with a grade of “C” or better Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 72 hours DIS See UC Limitations & Counselor This course covers the features of the C language commonly used in systems Hours: 72 hours LEC programming, and the application of those features to systems programming This course is an introduction to Object Oriented Programming using the Java in a Linux/UNIX environment. Topics include C preprocessor macros, input/ language. Topics include: objects, classes, UML, function overloading, inheritance, RXWSXWELWPDQLSXODWLRQIDFLOLWLHVWLPHVKDULQJV\VWHPFRQFHSWVVKHOOVFULSW static and dynamic class relationships, polymorphism, components, graphical SURJUDPPLQJPDNHÀOHVDQGVRXUFHFRGHFRQWUROEDVLFV\VWHPFDOOVLQFOXGLQJ user interfaces, event driven programming, class associations, interfaces, error fork and exec, pointers and dynamic memory allocation, libraries, and relocation KDQGOLQJWKUHDGVÀOH,2WHVWLQJDQGGHEXJJLQJ and linking concepts including assembler handling of symbol tables. CISP 405 OBJECT ORIENTED PROGRAMMING USING C# ON CISP 499 EXPERIMENTAL OFFERING IN COMPUTER INFORMATION VISUAL STUDIO .NET 4 UNITS SCIENCE - PROGRAMMING .5-4 UNITS Prerequisite: CISP 360 or 370 with a grade of “C” or better Prerequisite: None Course Transferable to UC/CSU Course Transferable to CSU Hours: 72 hours LEC Hours: 18 hours LEC ; 54 hours LAB This course is an introduction to the C# programming language using Visual Studio.NET. Topics include the Visual Studio.NET Integrated Development Environment (IDE), object oriented programming concepts, and various .NET technologies. Students will develop programs for the Windows desktop and Web browsers (ASP.NET), as well explore other .NET technologies such as Web Services, Windows Services, and .NET Remoting. 120 Computer Information Science Folsom Lake College 2011-2012 CISW 350 IMAGING FOR THE WEB 1 UNIT Computer Info Science - Web (CISW) Prerequisite: None. Advisory: CISC 306 or CISW 300 CISW 300 WEB PUBLISHING 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 18 hours LAB Advisory: CISC 300 and 305 This course introduces techniques of assembling graphics for the web. Using Course Transferable to CSU industry standard graphic software, students will create original graphics as Hours: 54 hours LEC ZHOODVPDQLSXODWHIRXQGLPDJHU\7KURXJKOHFWXUHGHPRQVWUDWLRQDQGKDQGV This course is an introduction to publishing on the Internet’s World Wide Web on methods as well as class/instructor critiques, students will understand the (WWW), organizing a series of pages into a web site, and uploading web pages process for assembling graphics for use on the World Wide Web. Topics include to a server. The course makes extensive use of the techniques necessary developing graphic elements for a web site using a visual theme, creating to create HTML tags, create images, and view web documents. This course buttons and intuitive navigational elements, making background textures and prepares apprentice web designers and publishers to identify information and LPDJHVXQGHUVWDQGLQJZHEÀOHIRUPDWVVFDQQLQJDQGVLPSOHDQLPDWLRQVWKDW dissemination needs of a client, design and appropriate WWW solution and enhance a web site. Students may incur additional costs for storage media. implement it. CISW 400 CLIENT-SIDE WEB SCRIPTING 4 UNITS CISW 321 WEB SITE DEVELOPMENT USING DREAMWEAVER Prerequisite: CISW 300 with a grade of “C” or better 3 UNITS Advisory: CISC 310 and CISP 300 Prerequisite: None. Course Transferable to CSU Advisory: CISW 300 Hours: 72 hours LEC Course Transferable to CSU This course emphasizes the creation of dynamic and interactive Web sites using Hours: 54 hours LEC DFOLHQWVLGHVFULSWLQJODQJXDJHVXFKDV-DYD6FULSW7RSLFVLQFOXGHWKH'RFXPHQW 6WXGHQWVZLOOXVH'UHDPZHDYHUDYLVXDOZHEDXWKRULQJWRROWRGHYHORSDQG 2EMHFW0RGHO '20 WKDWGHÀQHVVWUXFWXUHG:HESDJHVFRUHIHDWXUHVRIWKH implement web sites. The topics covered include: creating web pages that FOLHQWVLGHVFULSWLQJODQJXDJHHYHQWKDQGOLQJFRQWURORIZLQGRZVDQGIUDPHV contain text, images, links, tables, frames, forms, Cascading Style Sheets and functions, and form validation. This course may be taken a second time with a LPDJHPDSVHQKDQFLQJZHESDJHVZLWK)ODVKWH[W)ODVKEXWWRQVDQGWKHEXLOW GLIIHUHQWFOLHQWVLGH:HEVFULSWLQJODQJXDJH in scripting language, developing effective web site structures, using web site management tools, web site documentation, making global updates to a web CISW 499 EXPERIMENTAL OFFERING IN COMPUTER INFORMATION site, and extending Dreamweaver. Students will work individually and as a SCIENCE-WEB .5-4 UNITS member of a team to plan, implement, test, and evaluate web sites. Prerequisite: None Course Transferable to CSU CISW 326 INTERMEDIATE WEB SITE DEVELOPMENT USING Hours: 18 hours LEC ; 54 hours LAB DREAMWEAVER 3 UNITS Prerequisite: CISW 321 with a grade of “C” or better Course Transferable to CSU Hours: 54 hours LEC This course will reinforce and deepen many Dreamweaver topics covered in the EHJLQQLQJFRXUVH&,6:XVLQJDPRUHLQGHSWKDSSURDFKWRWKRVHWRSLFV,Q addition the course will introduce the other Adobe components such as Flash, Flash Script, and content management using Contribute software. Other topics covered include the following: advanced page formatting using style sheets, ZHEVLWHEHKDYLRUVZRUNÁRZHQKDQFHPHQWWHPSODWHVOLEUDULHVG\QDPLFGDWD search functions, shopping cart functions, site security, user authentication, and other web services. Folsom Lake College 2011-2012 Construction Management Tech 121 Construction Management Tech (CMT) CMT 498 WORK EXPERIENCE IN CONSTRUCTION MANAGEMENT TECHNOLOGY 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity, or job related to career interests. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. 122 Early Childhood Education Folsom Lake College 2011-2012 Early Childhood Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Education COUNSELING Rancho Cordova Center - 916-255-0717 DEGREES A.A. - Early Childhood Education Elementary Teaching A.A. - Early Childhood Education, For the person interested in teaching in a self-contained Site Supervisor elementary school classroom, Folsom Lake College has courses leading toward a Liberal Studies major at CERTIFICATES OF ACHIEVEMENT California State University, Sacramento. Before selecting Early Childhood Education, classes, please check with your counselor to receive the Infant Specialist most up-to-date information. Early Childhood Education, Master Teacher Some career options may require more than two years of Early Childhood Education, college study. School Age Specialist Early Childhood Education, Secondary Teaching Site Supervisor In order for a student to prepare for a secondary teaching Early Childhood Education, credential, the student should complete the lower division Teacher requirements for the teaching major while completing the transfer general education requirements needed for CERTIFICATES OF RECOGNITION transfer. A counselor can assist the student in selecting Early Childhood Education, the appropriate courses. Assistant Teacher Early Childhood Education, Note: Students planning to enroll in Work Experience Associate Teacher or practicum classes (ECE 320, ECE 321, ECE 334, ECE Early Childhood Education, 350, and ECE 498) must show evidence of TB clearance Family Child Care before working with children. The Folsom Lake College program offers a hands-on Highlights approach to learning skills in working with young children 7ZR$$'HJUHHVDQGHLJKW&HUWLÀFDWHV IURPELUWKWKURXJKWKHDJHRI&HUWLÀFDWHVDQGGHJUHHV On-campus, off-campus, & online course offerings have been designed to prepare students for employment at the various levels within privately funded child care centers and publicly funded child development programs. The program meets the course requirements for teachers and directors of private child care programs licensed by the California State Department of Social Services (Title 22). In addition, the program meets the coursework requirements for the Child Development Permit issued by the California Commission on Teacher Credentialing. Early Childhood Career Options Preschool Teacher; Infant Care Teacher; School Age Teacher; Preschool Director; Infant Care Director; Site Supervisor of Preschool/School Age Programs; Family Child Care Provider; Public School Aide; Pediatric Nurse; Camp Counselor; Recreational Leader; Nanny; Elementary School Teaching Assistant; Parent Educator; Home Visitor Folsom Lake College 2011-2012 Early Childhood Education 123 A.A. DEGREES SILA 305, SILA 306, SOC 321, SPAN 101, SPAN 401, SPAN 7KH7HDFKHUDQG0DVWHU7HDFKHU&HUWLÀFDWHVDVZHOODV 402, SPAN 411, SPAN 412. the AA Degrees in Early Childhood Education and the Site Supervisor, are aligned with the Child Development Permits This A.A. degree may be obtained by completion of the issued by California’s Commission of Teacher Credentialing Required Program, plus General Education Requirements, (January 1997). California law requires that teachers in SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO state-funded child care and development programs possess a Child Development Permit. Upon completion of this program, the student will be able to: x Apply knowledge and understanding of how children DEGREE grow, develop and learn across the physical, psychosocial, A.A. — Early Childhood Education cognitive, language and aesthetic domains by creating and maintaining healthy, respectful, supportive and REQUIRED PROGRAM ...... Units challenging learning environments. ECE 300 Introduction to Principles and Practices in x Build family and community relationships by identifying Early Childhood Education ...... 3 family and community characteristics; the practice of ECE 312 Child Development or supporting and empowering families and communities PSYC 372 Child Development ...... 3 through respectful and reciprocal relationships; and ECE 314 The Child, the Family and the Community skillfully involving families and communities in children’s ...... 3 development and learning. ECE 320 Curriculum and Interactions in Early x Synthesize and apply multiple methods of documentation Childhood Education ...... 4 by designing, developing and implementing ethical ECE 321 Advanced Practicum in Early Childhood practices and procedures that provide evidence of Education ...... 4 developmental measures and outcomes. ECE 331 Education and Care of Infants in Group x Design and implement developmentally and culturally Settings ...... 3 appropriate curriculum, environments, and guidance ECE 410 Health and Safety in the Child Care techniques. Setting ...... 1 x 'HPRQVWUDWH SURIHVVLRQDOLVP LQ WKH ÀHOG RI (DUO\ ECE 420 Admin of Child Development Centers (3) Childhood Education by actively working as a voice or for children’s rights; researching and provisioning ECE 424 Adult Supervision: Mentoring in a resources on behalf of children, families and communities; Collaborative Learning Setting (2) ..2-3 practicing ethical standards with children, families and ECE 430 Culture and Diversity in Early Childhood communities; practicing professional work ethics; and Education ...... 3 participating in professional growth activities. A minimum of six (6) units from the following: ...... 6 x Design, develop, and operate programs for children ECE 304 Family to Family: Introduction to Family that adhere to Title 22 regulations mandated by the Child Care (1) California Department of Human Services, Community ECE 330 Infant Development (3) Care Licensing Division, in order to ensure children’s ECE 343 Language and Literacy Development in health and safety. Early Childhood Education (3) x Create and maintain policies that are developmentally ECE 356 Programs for the School-Age Child (3) and culturally appropriate; promote respectfully ECE 361 Introducing Young Children to Visual Arts (3) inclusive attitudes and environments; and value multiple ECE 404 Children with Special Needs (3) perspectives. ECE 415 Children’s Health, Safety and Nutrition (3) x Apply acquired knowledge, skills, and abilities toward TOTAL UNITS REQUIRED ...... 32-33 successful completion of coursework at transfer institutions. x Seek employment as a teacher in a private or public 6XJJHVWHG(OHFWLYHVIRUIXOÀOOLQJ*(RUXQLWGHJUHH early childhood educational setting. requirement: ANTH 310, ART 430, BIOL 307, BUS 310, COMM 301, DEGREE COMM 325, COMM 361, ECE 350, ECE 415, ECE 420, ECE A.A. — Early Childhood Education, Site Supervisor 422, ECE 424, ECE 498, ECON 302, ENGED 320, ENGLT 370, ENGWR 101, ENGWR 300, FCS 322, GEOG 306, REQUIRED PROGRAM ...... Units GEOL 305, HIST 307, HIST 308, MATH 120, MATH 310, ECE 300 Introduction to Principles and Practices in MUIVI 370, MUIVI 371, MUSM 370, NUTRI 300, PS 472, Early Childhood Education ...... 3 124 Early Childhood Education Folsom Lake College 2011-2012 ECE 312 Child Development or supporting and empowering families and communities PSYC 372 Child Development ...... 3 through respectful and reciprocal relationships; and ECE 314 The Child, the Family and the Community skillfully involving families and communities in children’s ...... 3 development and learning. ECE 320 Curriculum and Interactions in Early x Demonstrate the ability to synthesize and apply multiple Childhood Education ...... 4 methods of documentation by designing, developing ECE 321 Advanced Practicum in Early Childhood and implementing ethical practices and procedures Education ...... 4 that provide evidence of developmental measures ECE 330 Infant Development (3) or and outcomes. ECE 400 Children with Exceptional Needs (3) or x Demonstrate competence in effective teaching practices ECE 404 Children with Special Needs (3) ...... 3 by designing and implementing developmentally and ECE 411 Health and Safety in the Child Care culturally appropriate curriculum, environments, and Setting ...... 0.5 guidance techniques. ECE 412 Pediatric CPR ...... 0.25 x 'HPRQVWUDWH SURIHVVLRQDOLVP LQ WKH ÀHOG RI (DUO\ ECE 413 Pediatric First Aid in Child Care Settings Childhood Education by actively working as a voice ...... 0.25 for children’s rights; researching and provisioning ECE 420 Administration of Child Development resources on behalf of children, families and communities; Centers ...... 3 practicing ethical standards with children, families and ECE 422 Adv. Coord. & Supervision of Child Dev. communities; practicing professional work ethics; and Programs ...... 3 participating in professional growth activities. ECE 424 Adult Supervision: Mentoring in a x Demonstrate knowledge and application of Collaborative Learning Setting ...... 2 developmentally appropriate health and safety policies ECE 430 Culture and Diversity in Early Childhood and practices by designing, developing and operating Education ...... 3 programs for children that adhere to Title 22 regulations TOTAL UNITS REQUIRED ...... 32 mandated by the California Department of Human Services, Community Care Licensing Division, in order Suggested Electives: to ensure children’s health and safety. ACCT 101, ANTH 310, ART 430, BIOL 307, BUS 310, COMM x Demonstrate cultural competency by designing, 301, COMM 325, COMM 361, ECE 356, ECE 361, ECE 364, developing and operating programs according to ECE 415, ECE 498, ECON 302, ENGLT 370, ENGWR 101, policies that are developmentally and culturally ENGWR 300, FCS 322, GEOG 306, GEOL 305, HIST 307, appropriate; promote respectfully inclusive attitudes HIST 308, HUM 334, MATH 120, MATH 310, MUIVI 370, and environments; and value multiple perspectives. MUSM 370, NUTRI 300, SPAN 101, SPAN 401, SOC 321 x Demonstrate effective program and leadership development by designing, developing, and managing This A.A. degree may be obtained by completion of the high-quality early childhood programs based on the Required Program, plus General Education Requirements, National Association for the Education of Young Children’s SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO ethical code of conduct, guidelines for developmentally appropriate practice, and accreditation standards; To be eligible for the Child Development Permit (Site Harms, Clifford, and Cryer’s environmental rating Supervisor), complete AA degree in ECE. Students must scales; Title 22 regulations mandated by the California also complete experience requirements for the particular Department of Human Services, Community Care permit for which you are applying. See ECE Department Licensing Division to ensure children’s health and safety; for further information. and Title 5 legal and regulatory requirements contained in the California Education Code, California Code of Upon completion of this program, the student will be able to: Regulations for child development contractors, families, x Demonstrate knowledge and understanding of how and community members regarding child development children grow, develop and learn across the physical, programs funded by the state. psychosocial, cognitive, language and aesthetic domains x Apply acquired knowledge, skills, and abilities toward by creating and maintaining healthy, respectful, successful completion of coursework at transfer supportive and challenging learning environments. institutions. x Demonstrate knowledge and understanding of building x Seek employment as a site supervisor in a private or family and community relationships by identifying public early childhood educational setting. family and community characteristics; the practice of Folsom Lake College 2011-2012 Early Childhood Education 125 CERTIFICATES across the domains of development from the prenatal 8SRQFRPSOHWLRQRIRQHRIWKHIROORZLQJFHUWLÀFDWHVDQG period through adolescence. with appropriate documented experience, the student meets x Describe how theories, principles and foundations of child the minimum requirements for employment in a privately development inform and guide practical application. funded child care program or family day care program. x Recognize the influence of diverse socio-cultural &HUWLÀFDWHVDUHGHVLJQHGWRPHHWYDU\LQJHPSOR\PHQWOHYHOV factors on child development, child rearing, caring, and focused training with infants and school-age children. and education. These requirements are outlined in Title 22 (Department of x Identify components that are essential to the healthy Social Services) regulations for child care licensing. socialization of children with their families and the community and community resources available to CERTIFICATE OF RECOGNITION support families. Early Childhood Education, Assistant Teacher x Apply for an assistant teacher position in an early childhood educational setting. REQUIRED PROGRAM ...... Units ECE 300 Introduction to Principles and Practices in CERTIFICATE OF RECOGNITION Early Childhood Education (3) or Early Childhood Education, Associate Teacher ECE 314 The Child, The Family, and The Community ...... 3 REQUIRED PROGRAM ...... Units ECE 312 Child Development or ECE 300 Introduction to Principles and Practices in PSYC 372 Child Development ...... 3 Early Childhood Education ...... 3 TOTAL UNITS REQUIRED ...... 6 ECE 312 Child Development or PSYC 372 Child Development ...... 3 Students must take ECE 312 or PSYC 372 AND ECE 300 or ECE 314 The Child, the Family and the Community ECE 314. Upon successful completion of the Assistant Teacher ...... 3 &HUWLÀFDWHDVWXGHQWGHPRQVWUDWHVNQRZOHGJHSUHSDUDWLRQ ECE 320 Curriculum and Interactions in Early and competencies for an entry-level position in an early Childhood Education ...... 4 learning program. Additionally, the student is eligible to apply ECE 410 Health and Safety in Child Care Setting for the Assistant Teacher Child Development Permit issued by ...... 1 the California Commission on Teacher Credentialing. ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) and ECE 413 (.25 unit) Upon completion of ECE 300 and ECE 312, the student will TOTAL UNITS REQUIRED ...... 14 be able to: x Discriminate among philosophies of early childhood To be eligible for the Child Development Permit (Associate education in regards to assumptions about how young Teacher) students must also complete experience children learn and how early childhood teachers requirements for the particular permit for which they are should teach. applying. See ECE Department for further information. Upon x Define and identify the role of observation, VXFFHVVIXOFRPSOHWLRQRIDQ$VVRFLDWH7HDFKHU&HUWLÀFDWH documentation, and interpretation of children’s play as and with documented experience, the student demonstrates a tool for planning curriculum for young children and knowledge, preparation, and competencies to be a teacher assessing their learning. in a privately funded early learning program and as a x Analyze the developmental stages and growth processes teacher assistant in a publicly funded early learning program. across the domains of development from the prenatal $GGLWLRQDOO\ WKH FHUWLÀFDWH PHHWV PDQGDWHG OLFHQVLQJ period through adolescence. requirements for Title 22 of the Health and Safety Code of x Describe how theories, principles and foundations of child the Department of Social Services, Community Care Licensing development inform and guide practical application. Division and leads to the Associate Teacher Permit issued x Apply acquired knowledge, skills, and abilities of by the California Commission on Teacher Credentialing. FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRIDQ (DUO\&KLOGKRRG(GXFDWLRQ$VVRFLDWH7HDFKHU&HUWLÀFDWH Upon completion of this program, the student will be able to: x Apply for an assistant teacher position in an early x Plan and implement developmentally and culturally childhood educational setting. appropriate indoor and outdoor environments for young children that support play, exploration, problem solving Upon completion of ECE 312 and ECE 314, the student will and learning. be able to: x Design, implement, and evaluate developmentally and x Analyze the developmental stages and growth processes 126 Early Childhood Education Folsom Lake College 2011-2012 culturally appropriate learning activities for young x Demonstrate respectful interactions with children and children. their families. x Create an intellectually engaging, responsive x Describe the family child care licensing application environment to promote each child’s learning and process and licensing regulation highlights. development. x Identify needs of families and refer to community resources. x Make plans to enable children to attain key curriculum x $SSO\DFTXLUHGNQRZOHGJHVNLOOVDQGDELOLWLHVRIFHUWLÀFDWH goals across various disciplines, such as language arts, course work toward being a family childcare provider. mathematics, social studies, science, art, music, physical x Apply acquired knowledge, skills, and abilities of education, and health. FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRIDQ x Support children’s collaboration with interesting, (DUO\&KLOGKRRG(GXFDWLRQ$VVRFLDWH7HDFKHU&HUWLÀFDWH important enterprises. x Develop, refine and use a wide repertoire of CERTIFICATE OF ACHIEVEMENT teaching strategies to enhance children’s learning and Early Childhood Education, Infant Specialist development. (formerly ECE, Infant Care) x Support the development of responsibility and self- regulation in children. REQUIRED PROGRAM ...... Units x Distinguish and apply positive guidance and problem ECE 300 Introduction to Principles and Practices in solving strategies that teach children self-discipline and Early Childhood Education ...... 3 appropriate social skills within a diverse group of peers. ECE 312 Child Development or x Apply acquired knowledge, skills, and abilities of PSYC 372 Child Development ...... 3 FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRI ECE 314 The Child, the Family and the Community DQ(&(7HDFKHU&HUWLÀFDWH ...... 3 x Seek employment as an associate teacher in a private ECE 320 Curriculum and Interactions in Early early childhood educational setting. Childhood Education ...... 4 ECE 330 Infant Development ...... 3 CERTIFICATE OF RECOGNITION ECE 331 Education and Care of Infants in Group Early Childhood Education, Family Child Care Settings ...... 3 ECE 334 Laboratory with Infants and Toddlers ...1 REQUIRED PROGRAM ...... Units ECE 410 Health and Safety in Child Care Settings ECE 300 Introduction to Principles and Practices in ...... 1 Early Childhood Education ...... 3 ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) ECE 304 Introduction to Family Day Care ...... 1 and ECE 413 (.25 unit) ECE 312 Child Development or TOTAL UNITS REQUIRED ...... 21 PSYC 372 Child Development ...... 3 ECE 410 Health and Safety in Child Care Setting 8SRQVXFFHVVIXOFRPSOHWLRQRIDQ,QIDQW6SHFLDOLVW&HUWLÀFDWH ...... 1 and with appropriate documented experience, a student ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) demonstrates knowledge, preparation and competencies to and ECE 413 (.25 unit) be an infant and toddler teacher in an early learning program. ECE 498 Work Experience in ECE ...... 4 &HUWLÀFDWHFRPSOHWLRQH[FHHGVPLQLPXPUHTXLUHPHQWVIRUD Students must successfully complete documented teacher of infants and toddlers in privately funded early work experience in a licensed Family Child Care Home childhood education programs (as required by Title 22 of the TOTAL UNITS REQUIRED ...... 12 California Social Services Code of Regulations) and as an associate teacher of infants and toddlers in publicly funded Upon successful completion of the Family Child Care early learning programs (as required by Title 5 California &HUWLÀFDWHDVWXGHQWGHPRQVWUDWHVNQRZOHGJHSUHSDUDWLRQ Education Code of Regulations). A student who completes and competencies to be a family childcare provider. WKLVFHUWLÀFDWHDOVRSRVVHVVHVWKHFRXUVHZRUNUHTXLUHGIRU the Child Development Associate Teacher Permit issued by Upon completion of this program, the student will be able to: the California Commission on Teacher Credentialing. x (YDOXDWH FRPSRQHQWV DQG EHQHÀWV RI D KLJKTXDOLW\ family childcare program. Upon completion of this program, the student will be able to: x Describe and implement developmentally appropriate x Evaluate and apply knowledge of infant development activities for infants through school age children. DQGWKHPXOWLSOHLQÁXHQFHVRQHDUO\GHYHORSPHQWDQG x Apply health and safety practices for infants through learning to create infant and family programs that school age children in a home setting. Folsom Lake College 2011-2012 Early Childhood Education 127 are healthy, respectful, supportive, and challenging Upon successful completion of the School-Age Specialist IRUFKLOGUHQIURPWKHSUHQDWDOSHULRGWKURXJKWKHÀUVW &HUWLÀFDWHDQGZLWKDSSURSULDWHGRFXPHQWHGH[SHULHQFH three years after birth. a student demonstrates knowledge, preparation and x Design infant and toddler programs that build respectful, competencies to be a teacher of school-age children in a reciprocal family relationships that support optimal EHIRUHDQGDIWHUVFKRROFKLOGFDUHSURJUDP7KHFHUWLÀFDWH infant and toddler development and learning both at exceeds the minimum requirements for employment as a home and in group care settings. teacher in privately funded before and after school child x Incorporate systematic assessment strategies using learning programs as outlined in Title 22 Department of observation, documentation, and interpretation in order Social Services regulations for childcare licensing. to guide decisions about support for infant and toddler development and curriculum. Upon completion of this program, the student will be able to: x Design, implement, and evaluate developmentally x Design before- and after-school classroom communities effective curriculum and teaching plans that tie that build healthy, respectful, and reciprocal relationships knowledge of academic content to meaningful and that support and empower families, with the intention challenging learning environments for infants and to involve all families in their school age children’s toddlers in a collaborative effort with colleagues. development and learning. x Develop continuing professional growth plan and x Utilize systematic observations, documentation, and advocate public policy that supports infants, toddlers, their other effective assessment strategies in a responsible families and the profession of early childhood education. way in order to guide decisions about curriculum and x Apply acquired knowledge, skills, and abilities of teaching strategies as well as to support school age FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRI children’s development and learning. an A.A. degree in Early Childhood Education. x Examine, understand, and use positive relationships and x Seek employment as an infant or toddler teacher in a supportive interactions as the foundation for work with private or public early childhood educational setting. school age children. x Examine, understand, and use a wide array of effective CERTIFICATE OF ACHIEVEMENT approaches, strategies, and tools to support school age Early Childhood Education, School Age Specialist children’s development and learning. x Understand the importance of each content area in REQUIRED PROGRAM ...... Units school age children’s learning and know the essential ECE 300 Introduction to Principles and Practices in concepts, inquiry tools, and structure of content areas Early Childhood Education ...... 3 including academic subjects and identify resources to ECE 312 Child Development or deepen understanding. PSYC 372 Child Development ...... 3 x Design, implement and evaluate meaningful, challenging ECE 314 The Child, the Family and the Community curriculum that promotes comprehensive developmental ...... 3 and learning outcomes for school age children. ECE 320 Curriculum and Interactions in Early x Examine and use ethical guidelines and other professional Childhood Education ...... 4 standards related of early childhood practice. ECE 321 Advanced Practicum in Early Childhood x Develop continuing professional growth plan and Education ...... 4 advocate for public policy that supports children, families ECE 356 Programs for the School-Age Child .....3 and the profession of early childhood education. ECE 410 Health and Safety in Child Care Setting x Apply acquired knowledge, skills, and abilities of ...... 1 FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRI ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) an A.A. degree in Early Childhood Education. and ECE 413 (.25 unit) x Seek employment as a school-age teacher in a private ECE 430 Culture and Diversity in Early Childhood or public early childhood educational setting. Education ...... 3 ART 430 Art and Children (3) or CERTIFICATE OF ACHIEVEMENT ECE 364 Fundamentals of Movement and Rhythm in Early Childhood Education, Master Teacher Early Childhood Education (2) or ENGLT 370 Children and Literature (3) or REQUIRED PROGRAM ...... Units MUSM 370 Music for Children (3) ...... 2-3 Core Courses: TOTAL UNITS REQUIRED ...... 26-27 ECE 300 Introduction to Principles and Practices in Early Childhood Education ...... 3 128 Early Childhood Education Folsom Lake College 2011-2012 ECE 312 Child Development or Bilingual/Bicultural Development ...... 6 units PSYC 372 Child Development ...... 3 A minimum of three (3) units from the following: ECE 314 The Child, the Family and the Community ANTH 310 Cultural Anthropology ...... 3 BUS 330 Managing Diversity in the Workplace ECE 320 Curriculum and Interactions in Early COMM 325 Intercultural Communication Childhood Education ...... 4 SOC 321 Race, Ethnicity and Inequality in the U.S. (3) ECE 321 Advanced Practicum in Early Childhood And one of the following Foreign Language courses: Education ...... 4 French, Spanish or American Sign Language (3) ECE 330 Infant Development (3) or ECE 356 Programs for the School-Age Child (3) or Children with Exceptional Needs ...... 6 units ECE 404 Children with Special Needs (3) ...... 3 Choose one of the following: ECE 410 Health and Safety in the Child Care ECE 404 Children with Special Needs (3) Setting ...... 1 And a minimum of 3 units from the following: ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) ECE 498: Work Experience in Early Childhood Education, and ECE 413 (.25 unit) ZLWKÀHOGRUSUDFWLFXPSODFHPHQWLQDVSHFLDOQHHGV ECE 424 Adult Supervision: Mentoring in a classroom for young children (1-4) or Collaborative Learning Setting ...... 2 SILA 305: American Sign Language 1 (4) or SILA 305: ECE 430 Culture and Diversity in ECE ...... 3 American Sign Language 2 (4). TOTAL CORE UNITS REQUIRED ...... 26 MASTER TEACHER SPECIALIZATION OPTIONS To be eligible for the Child Development Permit (Master (see specialization list below) ...... 6 Teacher), students must complete 16 units in General GENERAL EDUCATION UNITS ...... 16 Education categories which meet graduation requirements TOTAL UNITS REQUIRED ...... 48 with at least one course in each of the following areas: English, Humanities, Social Science, Math/Science. Please refer to Master Teacher Specialization Options: the General Education Requirements for a list of acceptable Select one (1) six-unit option below. Note: Courses may not courses. Students must also complete experience requirements double count for core and specialization. for the particular permit for which they are applying. See ECE Department for further information. Upon successful Infant and Toddler Care ...... 6-7 units FRPSOHWLRQ RI WKH 0DVWHU 7HDFKHU &HUWLÀFDWH D VWXGHQW ECE 331: Education and Care of Infants in Group Settings (3) demonstrates knowledge, preparation and competencies to And a minimum of 3 units from the following: be a lead or supervising teacher in early learning programs ECE 330: Infant Development (3) or as well as serve as coordinator of curriculum and staff ECE 334: Laboratory with Infants and Toddlers (1) development. Applicants must verify required experience teaching children and supervising staff to be recommended Art with Children ...... 6 units to the California Commission on Teacher Credentialing for ECE 361 Introducing Young Children to Visual Arts (3) issuance of the Master Teacher Child Development Permit. And a minimum of three (3) units from the following: $GGLWLRQDOO\WKLVFHUWLÀFDWHUHTXLUHVDQDGGLWLRQDOXQLWV ART 320 Design Fundamentals (3) of specialized study. ART 430 Art and Children (3) ARTH 300 Introduction to Art (3) Upon completion of this program, the student will be able to: x Identify and apply an understanding of licensing and Music with Children ...... 6 units child care regulations. MUSM 370 Music for Children (3) x Incorporate professional issues and utilize professional MUFHL 330 World Music (3) or codes of ethics in educational practice. MUIVI 370 Beginning Guitar (2) x Develop an ability to advocate on behalf of children and families. Children’s Health, Safety and Nutrition ...... 6 units x Evaluate an environment that meets the needs of children, A minimum of six (6) units from the following: families and staff. ECE 415/NUTRI 320 Children’s Health, x Supervise both staff and classrooms and directly interact Safety & Nutrition (3) with children and families in a warm and positive manner. and NUTRI 300 Nutrition (3) x Choose and provide inclusive, developmentally and culturally appropriate practices and activities. Folsom Lake College 2011-2012 Early Childhood Education 129 x ,QWHJUDWHPHWKRGVRIFRQÁLFWPDQDJHPHQWDQGSUREOHP environment. solving strategies with children. x Appraise and implement quality care for young children x Integrate health, safety, and nutrition practices in an in early learning environments. early care and education program. x Describe the role, job dimension, and responsibilities of x Apply acquired knowledge, skills, and abilities of the early childhood site supervisor and program director. FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRI x Reference and implement licensing requirements for DQ(DUO\&KLOGKRRG(GXFDWLRQ6LWH6XSHUYLVRU&HUWLÀFDWH privately funded child development programs. x Apply area of specialization as a master teacher in a x Apply basic principles of child and program private or public early childhood educational setting. development, adult supervision and management, family and community partnerships, human resources CERTIFICATE OF ACHIEVEMENT DQGGHYHORSPHQWDQGEXVLQHVVÀVFDOPDQDJHPHQW Early Childhood Education, Site Supervisor x Manage respectful interactions between supervisors, teachers, children and parents. REQUIRED PROGRAM ...... Units x Interpret and apply a professional code of ethics. ECE 300 Introduction to Principles and Practices in x Create appropriate professional growth and advocacy Early Childhood Education ...... 3 activities for center teachers. ECE 312 Child Development or x Apply acquired knowledge, skills, and abilities of PSYC 372 Child Development ...... 3 FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRI ECE 314 The Child, the Family and the Community an A. A. degree in Early Childhood Education...... 3 x Seek employment as a site supervisor in a private or ECE 320 Curriculum and Interactions in Early public early childhood educational setting. Childhood Education ...... 4 ECE 321 Advanced Practicum in Early Childhood CERTIFICATE OF ACHIEVEMENT Education ...... 4 Early Childhood Education Teacher ECE 331 Education and Care of Infants in Group Settings ...... 3 REQUIRED PROGRAM ...... Units ECE 410 Health and Safety in Child Care Setting Core Courses: ...... 1 ECE 300 Introduction to Principles and Practices in ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) Early Childhood Education ...... 3 and ECE 413 (.25 unit) ECE 312 Child Development or ECE 420 Administration of Child Development PSYC 372 Child Development ...... 3 Centers ...... 3 ECE 314 The Child, the Family and the Community ECE 422 Advanced Coordination and Supervision ...... 3 of Child Development Programs ...... 3 ECE 320 Curriculum and Interactions in Early ECE 424 Adult Supervision: Mentoring in a Childhood Education ...... 4 Collaborative Learning Setting ...... 2 ECE 321 Advanced Practicum in Early Childhood ECE 430 Culture and Diversity in Early Childhood Education ...... 4 Education ...... 3 ECE 331 Education and Care of Infants in Group TOTAL UNITS REQUIRED ...... 32 Settings ...... 3 ECE 410 Health and Safety in the Child Care 8SRQVXFFHVVIXOFRPSOHWLRQRIWKH6LWH6XSHUYLVRU&HUWLÀFDWH Setting ...... 1 and with appropriate documented experience, a student ECE 410 OR ECE 411 (.5 unit) and ECE 412 (.25 unit) demonstrates knowledge, preparation and competencies and ECE 413 (.25 unit) to supervise single site early learning programs and to ECE 430 Culture and Diversity in ECE ...... 3 serve as coordinator of curriculum and staff development. TOTAL CORE UNITS REQUIRED ...... 24 &HUWLÀFDWHH[FHHGVWKHPLQLPXPHGXFDWLRQDOUHTXLUHPHQWVIRU GENERAL EDUCATION UNITS ...... 16 employment as a director/manager of a privately funded TOTAL UNITS REQUIRED ...... 40 early learning program as outlined in Title 22 Department of Social Services regulations for childcare licensing To be eligible for the Child Development Permit (Teacher), students must complete 16 units in general education Upon completion of this program, the student will be able to: categories which meet graduation requirements with at x Incorporate a personal philosophy of working with least one course in each of the following areas: English, children, families and staff in an early learning Humanities, Social Science, Math/Science. Please refer to 130 Early Childhood Education Folsom Lake College 2011-2012 the General Education Requirements for a list of acceptable courses. Students must also complete experience requirements Early Childhood Education (ECE) for the particular permit for which they are applying. See ECE Department for further information. Upon successful ECE 295 INDEPENDENT STUDIES IN EARLY CHILDHOOD FRPSOHWLRQRIWKH7HDFKHU&HUWLÀFDWHDVWXGHQWGHPRQVWUDWHV EDUCATION 1-3 UNITS knowledge, preparation and competencies for teaching Prerequisite: None in a publicly funded early learning program. Applicants Hours: 18 hours LEC ; 54 hours LAB must verify required experience teaching children to be ECE 299 EXPERIMENTAL OFFERING IN EARLY CHILDHOOD recommended to the Commission on Teacher Credentialing EDUCATION .5-4 UNITS for issuance of the Teacher Child Development Permit. Prerequisite: None $GGLWLRQDOO\WKLVFHUWLÀFDWHH[FHHGVWKHUHTXLUHPHQWVIRU Hours: 18 hours LEC ; 54 hours LAB teaching in a privately funded early learning program. ECE 300 INTRODUCTION TO PRINCIPLES AND PRACTICES IN Upon completion of this program, the student will be able to: EARLY CHILDHOOD EDUCATION 3 UNITS x Design early childhood classroom communities that Prerequisite: None. build healthy, respectful, and reciprocal relationships Course Transferable to CSU that support and empower families, with the intention Hours: 54 hours LEC to involve all families in their children’s development This course is an introduction to early childhood education, including an overview and learning. RIWKHKLVWRU\RIWKHÀHOGFXUUHQWFXUULFXOXPDSSURDFKHVDQGSURJUDPVVHUYLQJ x Analyze, synthesize, and evaluate systematic FKLOGUHQIURPLQIDQF\WKURXJKWKHVFKRRODJH\HDUV,WUHYLHZVWKHFXUUHQW observations, documentation, and other effective status of education of young children with a focus on integrated education. assessment strategies in a responsible way in order Opportunities to observe in a variety of early childhood education settings and to guide decisions about curriculum and teaching techniques for observing and interpreting children’s pursuits will be included. strategies as well as to support children’s development and learning. ECE 304 FAMILY TO FAMILY: INTRODUCTION TO FAMILY CHILD x Observe and evaluate positive relationships and CARE 1 UNIT supportive interactions as the foundation for work with Prerequisite: None. young children. Course Transferable to CSU x Analyze, synthesize, and evaluate a wide array of Hours: 18 hours LEC effective approaches, strategies, and tools to support This course is an orientation to family child care including local regulations, young children’s development and learning. health and safety, curriculum, behavior management, and business x Analyze, synthesize and evaluate young children’s UHTXLUHPHQWVRILQKRPHFKLOGFDUHVHUYLFHV learning in content areas and access resources to deepen ECE 312 CHILD DEVELOPMENT 3 UNITS children’s understanding. Same As: PSYC 372 x Design, implement and evaluate meaningful, challenging Prerequisite: None. curriculum that promotes comprehensive developmental Advisory: ENGWR 101 or 103; ESLL 310, ESLR 320, and ESLW 320. and learning outcomes for all young children. General Education: AA/AS Area V(b); AA/AS Area III(b); CSU Area D7; IGETC Area 4I x Analyze, synthesize, and evaluate ethical guidelines Course Transferable to UC/CSU and other professional standards related of early Hours: 54 hours LEC childhood practice. This course will examine the physical, cognitive, social and emotional x Develop continuing professional growth plan and development of the child from the prenatal period through adolescence. advocate for public policy that supports children, families Scientific findings from a range of disciplines will inform an integrated and the profession of early childhood education. examination of theory and practice during the childhood years. This course is x Apply acquired knowledge, skills, and abilities of GHVLJQHGWRIXOÀOO*HQHUDO(GXFDWLRQ(DUO\&KLOGKRRG(GXFDWLRQDQG3V\FKRORJ\ FHUWLÀFDWHFRXUVHZRUNWRZDUGVXFFHVVIXOFRPSOHWLRQRIDQ degree requirements. This course is not open to those who have previously (DUO\&KLOGKRRG(GXFDWLRQ0DVWHU7HDFKHU&HUWLÀFDWH taken PSYC 372 or FCS 312. x Seek employment as a teacher in a private or public early childhood educational setting. Folsom Lake College 2011-2012 Early Childhood Education 131 ECE 314 THE CHILD, THE FAMILY AND THE COMMUNITY 3 UNITS ECE 330 INFANT DEVELOPMENT 3 UNITS Prerequisite: None. Prerequisite: None. Advisory: ENGWR 101 or 103; or ESLL 320, ESLR 320, ESLW 320. Course Transferable to CSU General Education: AA/AS Area III(b); CSU Area D7; CSU Area E1 Hours: 54 hours LEC Course Transferable to UC/CSU This course is an examination of infant development, from conception to three Hours: 54 hours LEC \HDUVRIDJHSURYLGLQJDUHYLHZRIUHVHDUFKÀQGLQJVUHODWHGWRLQIDQF\DQG This is a fundamental course that examines the developmental processes of implications for infant care. WKHFKLOGZLWKLQWKHIDPLO\DQGWKHHQYLURQPHQWDOLQÁXHQFHVRQJURZWKDQG development; including gender, peers, schooling, the media, socioeconomic ECE 331 EDUCATION AND CARE OF INFANTS IN GROUP status, race, ethnicity, language, and developmental differences. Community SETTINGS 3 UNITS resources available to support family systems and dynamics will be examined. Prerequisite: None. Advisory: ECE 330, ENGRD 110, and ENGWR 101 ECE 320 CURRICULUM AND INTERACTIONS IN EARLY Course Transferable to CSU CHILDHOOD EDUCATION 4 UNITS Hours: 54 hours LEC Prerequisite: ECE 300 with a grade of “C” or better; AND either ECE 312 or PSYC This course applies current research in infant development to the teaching and 372 with a grade of “C” or better. care of infants in group settings. Emphasis is on early childhood education Enrollment Limitation: Current tuberculosis clearance. principles and practices when applied to the care and education of infants from Course Transferable to CSU birth to three years of age. It includes strategies for designing, implementing, Hours: 36 hours LEC ; 108 hours LAB and evaluating group care programs for infants. This course provides supervised experience working with children in an early childhood setting. Topics include principles of curriculum development, ECE 334 LABORATORY WITH INFANTS AND TODDLERS 1 UNIT classroom design, and child guidance, with opportunity to apply these key Prerequisite: None. teaching principles in practical situations. This course is approved as the required Corequisite: ECE 330 or 331 ; May be taken previously. SURJUDPVDQGFXUULFXOXPFRUHFRXUVHVSHFLÀHGLQ7LWOHRIWKH+HDOWKDQG Enrollment Limitation: Current Tuberculosis Clearance. Safety Code of the Department of Social Services, Community Care Licensing Course Transferable to CSU Division and Title 5 Department of Education regulations. Before beginning lab Hours: 54 hours LAB assignments, students must show proof of TB clearance. This class provides experience working with infants and toddlers in a group care program. It is designed as a laboratory for those who have completed or are ECE 321 ADVANCED PRACTICUM IN EARLY CHILDHOOD enrolled in ECE 330 or 331. The course requires participation for a designated EDUCATION 4 UNITS three hours per week with infants and/or toddlers in a supervised infant/toddler Prerequisite: ECE 320 with a grade of “C” or better setting. This course may be taken three times for credit, each time in a setting Enrollment Limitation: Current tuberculosis clearance. with a different age group or program type. Course Transferable to CSU Hours: 36 hours LEC ; 108 hours LAB ECE 342 CONSTRUCTIVE MATH AND SCIENCE IN EARLY This advanced course provides supervised experience as a teacher in an early CHILDHOOD EDUCATION 3 UNITS childhood education program. It is aimed at leadership in the areas of developing Prerequisite: None. environments for learning, child observation and assessment, documentation Advisory: ENGRD 310 and ENGWR 101 of children’s work, behavior guidance, group management, collaborative Course Transferable to CSU teaching, building relationships with families, and effective preparation and Hours: 54 hours LEC implementation of curriculum. Before beginning lab assignments, students 7KHFRXUVHLVDQLQWURGXFWLRQWRWKHFRQVWUXFWLYLVWDSSURDFKWRWHDFKLQJSUHPDWK must show proof of TB clearance. and science in early childhood education. The content and teaching techniques support the perspective that children construct knowledge through a dynamic, ECE 326 MAKING LEARNING VISIBLE THROUGH OBSERVATION interactive process that facilitates their development of working theories AND DOCUMENTATION 3 UNITS related to math and science. Topics include an overview of the role of the Prerequisite: None. teacher in developing appropriate experiences for children and a review of Advisory: ENGRD 110 or ENGWR 101 current standards and guidelines. Course Transferable to CSU Hours: 54 hours LEC 7KLVFRXUVHDSSOLHVFULWLFDODQGUHÁHFWLYHWKLQNLQJWRREVHUYDWLRQDQGDVVHVVPHQW of young children’s development. It prepares teachers of young children to use observation, documentation, and interpretation strategies to improve program quality in early childhood settings. Multiple forms of child assessment and early childhood program assessment are explored. 132 Early Childhood Education Folsom Lake College 2011-2012 ECE 343 LANGUAGE AND LITERACY DEVELOPMENT IN EARLY ECE 361 INTRODUCING YOUNG CHILDREN TO VISUAL ARTS CHILDHOOD 3 UNITS 3 UNITS Prerequisite: None Prerequisite: None. Advisory: Eligibility for ENGWR 100 or ENGRD 310. General Education: AA/AS Area I Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 54 hours LEC This course will prepare early childhood educators to recognize, understand and This course prepares teachers in early childhood education with strategies enhance the emergent language and literacy experiences and skills of young for introducing young children to the media and tools of drawing, painting, children. The knowledge of developmentally appropriate language and literacy sculpting, and other visual arts commonly used by young children to represent practices will improve early childhood educators’ abilities to support young and understand the world around them. The focus will be on observing children’s FKLOGUHQLQWKHHDUO\\HDUV ELUWKWRÀYH\HDUV WREXLOGDVWURQJIRXQGDWLRQIRU natural ways of exploring each medium and learning strategies to facilitate learning to read and write in the primary grades. and document children’s emerging skills and relationship with each medium. Included are strategies for designing early childhood environments that promote ECE 350 INTRODUCTION TO ELEMENTARY TEACHING WITH FKLOGUHQ·VH[SORUDWLRQRIYLVXDODUWV7KHFRXUVHLQFOXGHVREVHUYDWLRQVDQGÀHOG FIELD EXPERIENCE 3 UNITS trips. Lab fee is required. Prerequisite: None. Advisory: ECE 312 or PSYC 372 ECE 363 MUSIC AND MOVEMENT WITH YOUNG CHILDREN General Education: AA/AS Area III(b) 3 UNITS Enrollment Limitation: Current tuberculosis clearance is required. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 54 hours LEC 7KLVFRXUVHLVDFDUHHUH[SORUDWLRQFRXUVHZLWKDQHDUO\ÀHOGH[SHULHQFHIRU This course introduces students to theoretical principles and practical WKRVHVWXGHQWVFRQVLGHULQJWKHÀHOGRI.WHDFKLQJ,WLQFOXGHVDVXSHUYLVHG applications for integrating appropriate music and movement experiences in ÀHOGSODFHPHQWDQGIRXUKRXUVZHHNO\LQDORFDOHOHPHQWDU\VFKRROLQDGGLWLRQ early childhood settings. The course explores incorporating culturally diverse WRZHHNO\FODVVPHHWLQJVRQFDPSXV,WZLOODOVRIXOÀOORQHRIWKHHDUO\ÀHOG music and movement activities to support children’s understanding and experiences for the CSUS blended liberal studies major. Course content includes acceptance of differences. the profession and culture of teaching, observation skills, communication VNLOOVGLYHUVLW\DQGVRFLDOLVVXHVDPRQJRWKHUV6WXGHQWV·ÀHOGH[SHULHQFHV ECE 364 FUNDAMENTALS OF MOVEMENT AND RHYTHM IN will integrate and apply the course content. Students will complete a service EARLY CHILDHOOD EDUCATION 2 UNITS OHDUQLQJSURMHFWDWSDUWLFLSDWLQJVFKRROV%HIRUHEHJLQQLQJÀHOGSODFHPHQW Prerequisite: None. students must show proof of TB clearance. Fingerprint clearance may be Course Transferable to CSU required by elementary school. Hours: 18 hours LEC ; 54 hours LAB This course is designed for early childhood education, elementary education, ECE 356 PROGRAMS FOR THE SCHOOL-AGE CHILD 3 UNITS SK\VLFDOHGXFDWLRQDQGUHFUHDWLRQPDMRUV'HYHORSPHQWDOO\DSSURSULDWHOHDGXS Prerequisite: None. games for individual and team activities and culturally diverse music, movement Course Transferable to CSU and rhythm will be explored and practiced. Hours: 54 hours LEC This course covers the fundamentals of planning, implementing and evaluating ECE 400 CHILDREN WITH EXCEPTIONAL NEEDS 3 UNITS SURJUDPVIRUEHIRUHDQGDIWHUVFKRROFDUHRIVFKRRODJHFKLOGUHQ . Prerequisite: ECE 312 or PSYC 372 with a grade of “C” or better (PSKDVLVLVRQGHYHORSPHQWDOOHYHOVDJHDSSURSULDWHDFWLYLWLHVDQGGD\WRGD\ Course Transferable to CSU program operations. Hours: 54 hours LEC This course provides an overview of the developmental issues, characteristics, and learning differences of children from birth to adolescence with exceptional needs. An introduction to assessment techniques, curriculum design, advocacy, current issues and community resources for exceptional children will be included in the overview. Classroom observations of children may be required. Folsom Lake College 2011-2012 Early Childhood Education 133 ECE 404 CHILDREN WITH SPECIAL NEEDS 3 UNITS ECE 413 PEDIATRIC FIRST AID IN CHILD CARE SETTINGS .25 UNIT Prerequisite: ECE 312 or PSYC 372 with a grade of “C” or better Prerequisite: None Course Transferable to CSU Advisory: ENGRD 112 with a grade of “C” or better; OR placement through Hours: 54 hours LEC assessment process. This course is designed to provide a broad overview of the characteristics, Course Transferable to CSU assessment techniques, methods of intervention, natural environments, Hours: 4 hours LEC community and family resources, and current issues of young children from 7KLVFRXUVHFRYHUVSHGLDWULFÀUVWDLGLQFHQWHUDQGKRPHEDVHGHDUO\FDUHDQG birth to age eight with special needs. The focus is to increase the awareness HGXFDWLRQSURJUDPV6XFFHVVIXOVWXGHQWVHDUQ3HGLDWULF)LUVW$LGFHUWLÀFDWLRQ and understanding of children’s individual needs in an early childhood setting which must be renewed every two years to remain current. To receive American and to provide practical information to those currently involved with children 5HG&URVVFHUWLÀFDWLRQVWXGHQWVPXVWVXFFHVVIXOO\GHPRQVWUDWHFRPSHWHQF\DV with special needs. Observations in public and private children’s centers, schools ZHOODVSD\DGGLWLRQDOIHHVIRU$PHULFDQ5HG&URVVWH[WVDQGFHUWLÀFDWLRQFDUG and agencies may be required. 7KHFRXUVHIXOÀOOVWKHSHGLDWULFÀUVWDLGFRPSRQHQWRI&DOLIRUQLD'HSDUWPHQW of Social Services Health and Safety Title 22 requirements for staff and may ECE 410 HEALTH AND SAFETY IN CHILD CARE SETTINGS 1 UNIT be taken four times for credit. Prerequisite: None Course Transferable to CSU ECE 415 CHILDREN’S HEALTH, SAFETY AND NUTRITION 3 UNITS Hours: 18 hours LEC Same As: NUTRI 320 This course covers health and safety issues in child care centers and family Prerequisite: None. day care homes. It includes pediatric cardiopulmonary resuscitation, pediatric Advisory: NUTRI 300 ÀUVWDLGDQGSUHYHQWDWLYHKHDOWKSUDFWLFHV7RUHFHLYH$PHULFDQ5HG&URVV General Education: AA/AS Area III(b) FHUWLÀFDWLRQVWXGHQWVPXVWVXFFHVVIXOO\GHPRQVWUDWHFRPSHWHQF\DVZHOODV Course Transferable to CSU SD\DGGLWLRQDOIHHVIRU$PHULFDQ5HG&URVVWH[WVDQGFHUWLÀFDWLRQFDUGV7KLV Hours: 54 hours LEC FRXUVHIXOÀOOV&DOLIRUQLD'HSDUWPHQWRI6RFLDO6HUYLFHV+HDOWKDQG6DIHW\7LWOH This course examines basic nutrition, health, and safety needs of children from 22 requirements for staff and may be taken four times for credit. the prenatal period through school age. Students will identify the nutrients in foods as they affect a child’s physical and mental development. Course emphasis ECE 411 HEALTH AND SAFETY IN CHILD CARE SETTINGS .5 UNIT is placed on maintaining the optimal health, safety, and nutritional status of Prerequisite: None children at home and in group care. Projects relating to children’s nutrition, Course Transferable to CSU health, and safety are required as part of the course. Not open to students Hours: 8 hours LEC who have received credit for NUTRI 320. 7KLVFRXUVHFRYHUVKHDOWKDQGVDIHW\LVVXHVLQFHQWHUDQGKRPHEDVHGHDUO\FDUH education programs. Course content includes injury prevention and preventative ECE 420 ADMINISTRATION OF CHILD DEVELOPMENT CENTERS health care practices such as control of infectious diseases, nutrition issues, 3 UNITS sanitation, emergency preparedness and evacuation. This course taken along Prerequisite: ECE 300 and ECE 312 or PSYC 372 with a grade of “C” or better. with ECE 412 and ECE 413 meets the California Department of Social Services Advisory: ECE 320 Health and Safety Title 22 requirements for staff. Course Transferable to CSU Hours: 54 hours LEC ECE 412 PEDIATRIC CPR .25 UNIT This is an introductory course in the elements of program planning, budgeting, Prerequisite: None supervision and personnel administration for public and private centers and Course Transferable to CSU VFKRROVVHUYLQJFKLOGUHQDQGIDPLOLHV7KLVFRXUVHVDWLVÀHVWKHDGPLQLVWUDWLRQ Hours: 6 hours LEC UHTXLUHPHQWRIWKH&DOLIRUQLD7LWOH+HDOWKDQG6DIHW\&RGHDQGVDWLVÀHVWKUHH This course covers pediatric cardiopulmonary resuscitation (CPR). Successful of the six units of the administration requirement of the Title 5 Education code VWXGHQWVHDUQFHUWLÀFDWLRQZKLFKPXVWEHUHQHZHGHYHU\\HDUWRUHPDLQ and the California Commission for Teacher Credentialing. FXUUHQW7RUHFHLYH$PHULFDQ5HG&URVVFHUWLÀFDWLRQVWXGHQWVPXVWVXFFHVVIXOO\ demonstrate competency as well as pay additional fees for American Red Cross ECE 422 ADVANCED COORDINATION AND SUPERVISION OF WH[WVDQGFHUWLÀFDWLRQFDUG7KLVFRXUVHIXOÀOOVWKH&35FRPSRQHQWRI&DOLIRUQLD CHILD DEVELOPMENT PROGRAMS 3 UNITS Department of Social Services Health and Safety Title 22 requirements for staff Prerequisite: ECE 320, ECE 420, and FCS 312 with grades of “C” or better and may be taken four times for credit. Course Transferable to CSU Hours: 54 hours LEC 7KLVLVDQDGYDQFHGFRXUVHLQDGPLQLVWUDWLRQDQGFRRUGLQDWLRQRIPXOWLIDFHWHG FKLOGGHYHORSPHQWSURJUDPV7KHHPSKDVLVRIWKHFRXUVHLVRQSXEOLFO\IXQGHG programs and personnel management. This course meets the requirements of the Education Code under Title 5 and the Commission of Teacher Credentialing. 134 Early Childhood Education Folsom Lake College 2011-2012 ECE 424 ADULT SUPERVISION: MENTORING IN A ECE 495 INDEPENDENT STUDIES IN EARLY CHILDHOOD COLLABORATIVE LEARNING SETTING 2 UNITS EDUCATION 1-3 UNITS Prerequisite: None. Prerequisite: None Course Transferable to CSU Course Transferable to CSU Hours: 36 hours LEC Hours: 18 hours LEC ; 54 hours LAB This course is a study of the methods and principles of collaborative learning ECE 498 WORK EXPERIENCE IN EARLY CHILDHOOD EDUCATION with emphasis on supervising teachers in early childhood education. Emphasis 1-4 UNITS is placed on the role of a mentor who functions to guide the teaching team while Prerequisite: None. simultaneously addressing the needs of children, families,and staff. This course Advisory: ENGWR 101 VDWLVÀHVWKHDGXOWVXSHUYLVLRQUHTXLUHPHQWIRUUHFHLYLQJDVXSHUYLVLQJWHDFKHU General Education: AA/AS Area III(b) permit from the California Commission on Teacher Credentialing. (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS ECE 430 CULTURE AND DIVERSITY IN EARLY CHILDHOOD volunteer opportunity, or job related to early childhood education. Students are EDUCATION 3 UNITS advised to consult with the Early Childhood Education Department to review Prerequisite: None. VSHFLÀFFHUWLÀFDWHDQGGHJUHHZRUNH[SHULHQFHUHTXLUHPHQWV%HIRUHEHJLQQLQJ General Education: AA/AS Area VI ECE 498, students must show proof of TB clearance. Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC +RXUV KRXUV/$% This course examines the development of social identities in diverse societies This course provides students with opportunities to develop marketable skills including theoretical and practical implications of oppression and privilege as in preparation for employment or advancement within their current job. Course they apply to young children, families, programs, classrooms and teaching. content will include understanding the application of education to the workforce; Various classroom strategies will be explored emphasizing culturally and completion of required forms, which document the student’s progress and hours OLQJXLVWLFDOO\DSSURSULDWHDQWLELDVDSSURDFKHVVXSSRUWLQJDOOFKLOGUHQLQ spent at the work site; and developing workplace skills and competencies. EHFRPLQJFRPSHWHQWPHPEHUVRIDGLYHUVHVRFLHW\7KHFRXUVHLQFOXGHVVHOI 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU H[DPLQDWLRQDQGUHÁHFWLRQRQLVVXHVUHODWHGWRVRFLDOLGHQWLW\VWHUHRW\SHVDQG orientation and 75 hours of related paid work experience, or 60 hours of bias, social and educational access, media and schooling. unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken ECE 455 ENVIRONMENT RATING SCALES IN EARLY CHILDHOOD four times for credit, when there is new or expanded learning on the job, for PROGRAMS 1 UNIT a maximum of 16 units. Before beginning ECE 498, students must show proof Prerequisite: None. of TB clearance. Course Transferable to CSU Hours: 18 hours LEC ECE 499 EXPERIMENTAL OFFERING IN EARLY CHILDHOOD This course examines Environment Rating Scales (Infant/Toddler, Early Childhood, EDUCATION .5-4 UNITS School Age Programs and Family Child Care) as a tool for quality improvement Prerequisite: None in a variety of child development programs. Emphasis is given to theory and Course Transferable to CSU best practices in order to evaluate classrooms, materials, and interactions Hours: 18 hours LEC ; 54 hours LAB between adults and children. ECE 494 TOPICS IN EARLY CHILDHOOD EDUCATION .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Designed to give students an opportunity to study topics in Early Childhood Education which are not included in current course offerings. Topics may include, but are not limited to: Management of Family Day Care Homes; Guidance of the Special Child in Everyday Living; Behavior and Discipline; Children in Crisis; 7KH6LQJOH3DUHQW)DPLO\ DQG&URVV&XOWXUDO([SHULHQFHVZLWK&KLOGUHQDQG Families. May be repeated for credit providing there is no duplication of topics. Folsom Lake College 2011-2012 Economics 135 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Economics COUNSELING Rancho Cordova Center - 916-255-0717 ECON 304 PRINCIPLES OF MICROECONOMICS 3 UNITS This Folsom Lake College program studies how people Prerequisite: None. and societies produce various commodities and distribute Advisory: MATH 120 them for consumption, now or in the future. FLC’s Economics General Education: AA/AS Area V(b); CSU Area D2; IGETC Area 4B offerings include the study of the American economic Course Transferable to UC/CSU system, using techniques for the analysis of contemporary Hours: 54 hours LEC economic problems. This course is a graphical and functional analysis of the units (sectors) making up the economy. The focus is on the sectors choices and interactions, microeconomic Career Options JRDOV HIÀFLHQF\DQGHTXLW\ SUREOHPVDQGVROXWLRQV0DMRUWRSLFVLQFOXGH Accountant; Arbitrator; Attorney; Budget Analyst; basic principles of economics; basic economic analyses; demand, supply, Business Analyst; Business Conditions; Forecaster; and equilibrium in a market; markets and applications; costs and production; Commodity Economist; Commodity Price Forecaster; product and resources markets; and microeconomic problems (externalities, Development Economist; Economic Analyst; Economic public goods, and income inequality). Time permitting, related topics such as Forecaster; Industrial Relations Specialist; Investment international trade and health economics may also be discussed. Course work Analyst; Labor Economist; Macro Economist; Manpower includes doing arithmetic problems, solving algebraic equations, and graphing Economist; Natural Resource Economist; Operations straight and curvilinear lines. Research Analyst; Project Economist; Research Economist ECON 320 CONCEPTS IN PERSONAL FINANCE 3 UNITS Most career options require more than two years of study. Prerequisite: None. Advisory: BUS 105 Highlights General Education: AA/AS Area V(b) Knowledgeable instructors and professionals in Course Transferable to CSU WKHLUÀHOGV Hours: 54 hours LEC Good general overview and conceptual 7KLVFRXUVHLVGHVLJQHGWRDVVLVWLQGLYLGXDOVLQDQDO\]LQJWKHLUÀQDQFLDO framework of economic issues DIIDLUV(OHPHQWVDQGFRQFHSWXDOEDVLVRIÀQDQFLDOSODQQLQJDQDO\VLVDQG Opportunity to combine with business and other decision making in areas of budgeting, taxes, borrowing, money management, related areas of study for a more comprehensive insurance, investments, and retirement will be examined with an emphasis on education principles to develop students’ economic decision making. Students will be Transfer opportunities using mathematical concepts as well as reading and interpreting written and A lab with tutorial assistance oral instructions. This course is not open to students who have received credit for ECON 320. Economics (ECON) ECON 495 INDEPENDENT STUDIES IN ECONOMICS 1-3 UNITS Prerequisite: None ECON 302 PRINCIPLES OF MACROECONOMICS 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB Advisory: MATH 120 General Education: AA/AS Area V(b); CSU Area D2; IGETC Area 4B ECON 499 EXPERIMENTAL OFFERING IN ECONOMICS .5-4 UNITS Course Transferable to UC/CSU Prerequisite: None Hours: 54 hours LEC Course Transferable to CSU This course is a graphical and functional analysis of the economy as a whole. It Hours: 18 hours LEC ; 54 hours LAB IRFXVHVRQWKHHFRQRP\·VZHOOEHLQJSUREOHPVDQGSRVVLEOHVROXWLRQV0DMRU topics include: market demand and supply; macroeconomic sectors, goals, and SUREOHPV XQHPSOR\PHQWLQÁDWLRQEXVLQHVVF\FOHVDQGGHÀFLWV WKHHFRQRP\·V output and price level; aggregate demand, aggregate supply, and equilibrium; DQGPDFURHFRQRPLFSROLFLHV ÀVFDODQGPRQHWDU\ DLPHGDWVROYLQJSUREOHPVDQG stabilizing the economy. Related topics such as international trade, international ÀQDQFHDQGHFRQRPLFJURZWKDUHDOVRGLVFXVVHG&RXUVHZRUNLQFOXGHVVROYLQJ algebraic equations and graphing straight and curvilinear lines as taught in Intermediate Algebra. 136 Education/Teaching Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Education/Teaching COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE A.A. - Liberal Studies for Other Associate in Arts degree requirements: Elementary Education Physical Education - any activity course Complete 60 Units This major is designed for students who wish to be Students must meet the Reading Competency teachers in public and private elementary schools. Further requirement through either assessment, a class, or HGXFDWLRQDWWKHXQLYHUVLW\OHYHOZLOOEHUHTXLUHGWRIXOÀOO a college-level reading examination. all requirements for a teaching credential authorizing service in California public schools. 127( 3OHDVHFKHFNZLWKDFRXQVHORUÀUVWEHIRUHEHJLQQLQJ Career Options this program, as requirements are subject to change. Teacher, primary grades; teacher, intermediate grades; Instructional Assistant DEGREE A.A. — Liberal Studies for Elementary Education Classes beyond the associate degree may be required to IXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQIRUWUDQVIHU REQUIRED PROGRAM ...... Units to a university program. ART 430 Art and Children ...... 3 BIOL 307 Biology of Organisms ...... 4 Highlights COMM 361 The Communication Experience ...... 3 This major is especially designed for students who plan ECE 312/PSYC 372 Child Development (3) or to transfer into California State University, Sacramento’s FCS 324/PSYC 370 Human Development: Liberal Studies Program, which is a major for prospective A Life Span ...... 3 elementary school teachers. This A.A. degree program ECE 350 Intro to Elem Teaching with Field Exper .3 provides all of the lower division courses necessary ECON 302 Principles of Macroeconomics ...... 3 to gain admission to the university and the teacher ENGED 305 Structure of English ...... 3 credential program. ENGED 320 Tutoring Elem Children in Reading ...... 3 ENGWR 300 College Composition ...... 3 Other CSUS Requirements: ENGWR 302 Adv Composition & Critical Thinking .....3 Foreign Language: Students must complete the 2nd GEOL 305 Earth Science ...... 3 semester elementary level. For other exemptions, GEOL 306 Earth Science Laboratory ...... 1 see coordinator or a counselor. HIST 307 History of World Civ from 1500 ...... 3 Grade point average must be 2.67 in transferable HIST 308 History of World Civ 1500 to present .3 baccalaureate courses. HIST 312 History of U.S. to 1865...... 3 7KH :ULWLQJ 3URÀFLHQF\ ([DP :3( VKRXOG EH MATH 310 Mathematical Discovery ...... 3 taken at CSUS shortly after completing Critical POLS 301 Intro to Govt: United States ...... 3 Thinking (ENGWR 302/ENGWR 301). SOC 321 Race, Ethnicity & Inequality in the U.S. or The Intermediate Algebra Diagnostic exam should COMM 325 Intercultural Communication (3) ...... 3 be taken shortly after completing Intermediate TOTAL UNITS REQUIRED ...... 53 Algebra (MATH 120). It is recommended that the CBEST be taken anytime This A.A. degree may be obtained by completion of the after taking ENGWR 300, ENGWR 301 OR 302, Required Program, plus General Education Requirements, and MATH 310. SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Students should obtain a letter of recommendation from Upon completion of this program, the student will be able to: WKHLUÀHOGH[SHULHQFHFRRSHUDWLQJWHDFKHUDQGFKHFN Apply knowledge, skills, and abilities toward successful with their counselor for other CSUS application and completion of coursework at transfer institutions. admission requirements. Seek employment as an instructional or classroom aide in an elementary school. Develop a reasoned solution to a problem and defend it using appropriate language, methods, and/or notation. Folsom Lake College 2011-2012 Education/Teaching 137 Evaluate new and accepted ideas about the natural universe using testable methodology. Write and speak effectively, demonstrating the ability to evaluate audience and appeal to it persuasively. Conduct library research and compose research papers with a clear thesis, sound critical thinking, correct usage, and proper documentation. Apply knowledge of world history and cultures to identify the values of a culture and work with others of a diverse background. Analyze the Constitution of the United States and other founding documents. Describe the nature of government and compare and contrast political institutions. Apply basic economic concepts. Apply knowledge of child development theories to assess the characteristics of teaching practices and learning conditions. 138 Emergency Medical Technology Folsom Lake College 2011-2012 Emergency Medical Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Technology COUNSELING Rancho Cordova Center - 916-255-0717 EMT(1)s are the backbone of the Emergency Medical Services (EMS) system throughout the nation, helping Emergency Medical Technology to reduce injury severity and death at the scene of an (EMT) accident or sudden illness and during transportation to a medical facility. EMT 100 BASIC EMERGENCY MEDICAL CARE 6 UNITS Prerequisite: HEED 320 with a grade of “C” or better; or equivalent current Folsom Lake College’s Emergency Medical Technology certification (BLS for the Healthcare Provider from the American Heart 100 course is designed to provide the student with the Association or CPR for the Professional Rescuer from the American Red Cross). VNLOOVDQGNQRZOHGJHWRDSSO\IRUFHUWLÀFDWLRQDVDQ Advisory: AH 110 Emergency Medical Technician(1) and is approved by (QUROOPHQW/LPLWDWLRQ 1RWRSHQWRVWXGHQWVZLWKDFXUUHQW(07%DVLFFHUWLÀFDWH the Sacramento County Health Department, Division of Hours: 72 hours LEC ; 108 hours LAB Emergency Medical Services, the certifying agency for This course provides basic and level one instruction for an Emergency Medical 6DFUDPHQWR&RXQW\7KLVFHUWLÀFDWLRQLVPDQGDWRU\IRU Technician (EMT). Topics include skills necessary to provide emergency medical all personnel who wish to pursue a career working on an FDUHDWDEDVLFOLIHVXSSRUWOHYHOZLWKDÀUHDPEXODQFHRURWKHUVSHFLDOL]HG DPEXODQFH(07 FHUWLÀFDWLRQLVDOVRDSUHHPSOR\PHQW service. This Emergency Medical Technology 100 course is the primary step to UHTXLUHPHQWIRUPDQ\ÀUHGHSDUWPHQWV7RJHWKHUZLWK SURYLGHWKHVWXGHQWZLWKWKHVNLOOVDQGNQRZOHGJHWRDSSO\IRUFHUWLÀFDWLRQDV varying levels of actual on-the-job experience, it is often an Emergency Medical Technician (I) and is approved by both the Sacramento required for admission to Paramedic training programs County and El Dorado County Health Departments, Division of Emergency throughout the state. Medical Services, which are the certifying agencies for Sacramento Regions. 7KLVFHUWLÀFDWLRQLVPDQGDWRU\IRUDOOSHUVRQQHOZKRZLVKWRSXUVXHDFDUHHU FLC’s EMT students will gain actual experience by ZRUNLQJRQDQDPEXODQFH(07 , FHUWLÀFDWLRQLVDOVRDSUHHPSOR\PHQW spending eight hours off-campus in operating ambulance UHTXLUHPHQWIRUPRVWSDLGÀUHGHSDUWPHQWV7RJHWKHUZLWKYDU\LQJOHYHOVRI units and an additional eight hours in a hospital DFWXDORQWKHMREH[SHULHQFHLWLVUHTXLUHGIRUDGPLVVLRQWR3DUDPHGLFWUDLQLQJ emergency department. programs throughout the state and country. EMT students will gain actual clinical H[SHULHQFHE\VSHQGLQJWLPHRIIFDPSXVLQRSHUDWLQJDPEXODQFHXQLWVRULQ Career Options an emergency department of a hospital. Students will be required to complete EMT(1); Fire Service background checks, purchase uniforms, verify immunizations, TB clearance and other requirements for the clinical component of this course. This course is With additional training: FRQGXFWHGLQFRPSOLDQFHZLWKWKH&DOLIRUQLD&RGHRI5HJXODWLRQV$ÀQDOJUDGH $PEXODQFH 7HFKQLFLDQ )LUHÀJKWHU 5HVFXH :RUNHU ´%µRUEHWWHULVUHTXLUHGIRUDFRXUVHFRPSOHWLRQFHUWLÀFDWLRQLQWKLVFRXUVH,W Paramedic; Emergency Medical Dispatcher is recommended that students purchase a blood pressure cuff and stethoscope. Highlights Hands-on experience provided in administering proper emergency medical care 3UHSDUDWLRQIRUWKH(07 &HUWLÀFDWH 5HFHUWLÀFDWLRQ Hospital Emergency Room observation time and opportunities to “ride along” in ambulances Folsom Lake College 2011-2012 Emergency Medical Technology & Energy 139 EMT 102 EMERGENCY MEDICAL CARE REFRESHER 1.5 UNITS 3UHUHTXLVLWH &XUUHQWFHUWLÀFDWLRQDVDQ(PHUJHQF\0HGLFDO7HFKQLFLDQ , RU Energy (ENERGY) Basic. Hours: 23 hours LEC ; 12 hours LAB ENERGY 305 INTRODUCTION TO ENERGY EFFICIENCY AND 7KLVFRXUVHSURYLGHVFRQWLQXLQJHGXFDWLRQDQGVNLOOVYHULÀFDWLRQPRGXOHVIRU ALTERNATIVE ENERGY SYSTEMS 3 UNITS FXUUHQW(PHUJHQF\0HGLFDO7HFKQLFLDQV (07V FHUWLÀHGDWWKH%DVLF/LIH6XSSRUW Prerequisite: None. %/6 OHYHO,WVDWLVÀHVPRVWRIWKHUHIUHVKHUUHTXLUHPHQWVRIORFDOVWDWHDQG Advisory: GEOG 300 and MATH 30 national Emergency Medical Services (EMS) certifying organizations. EMS Course Transferable to CSU related topics include airway management and ventilation, cardiac care and Hours: 54 hours LEC resuscitation, patient assessment, injury management, legal and ethical issues, This course is an introduction to the science, technology, environmental impact, vital signs monitoring and assisting with medication administration. This course and economics of energy production and consumption. Topics include: the basic LVGHVLJQHGIRUFXUUHQWO\&DOLIRUQLD6WDWHFHUWLÀHG(07%DVLF , DQGPHHWVDOO physics of energy, current and alternative energy generation systems, energy VWDWHUHTXLUHPHQWVIRU(07 , UHFHUWLÀFDWLRQE\6DFUDPHQWR(PHUJHQF\0HGLFDO use in residential and commercial buildings, energy use in transportation Services Agency. BLS (CPR) cards are not issued upon completion of this course. systems, the economics of energy systems, and regulatory issues. Students 6WXGHQWVWKDWKDYHH[SLUHG(07 , FHUWLÀFDWLRQVKRXOGFRQWDFWWKHLQVWUXFWRU will exercise their ability to make personal and professional decisions regarding prior to signing up for EMT 102. This course does not provide preparation energy systems so as to reduce energy costs and pollution footprints. Students for the National Registry of Emergency Medical Technicians (NREMT) entry or PD\DOVREHH[SHFWHGWRDWWHQGDQGSDUWLFLSDWHLQDQRQVLWHYLVLWRIDQHQHUJ\ UHFHUWLÀFDWLRQH[DP7KLVFRXUVHPD\EHWDNHQIRXUWLPHVIRUFUHGLW industry organization. EMT 299 EXPERIMENTAL OFFERING IN EMERGENCY MEDICAL TECHNOLOGY .5-4 UNITS Prerequisite: None Hours: 18 hours LEC ; 54 hours LAB 140 Engineering Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Engineering COUNSELING Rancho Cordova Center - 916-255-0717 ENGR 303 INTRODUCTION TO LOGIC DESIGN 4 UNITS Folsom Lake College’s program provides the foundation Prerequisite: None. in mathematics, physics, and engineering necessary Advisory: MATH 120; Any previous or concurrent programming class. to transfer to a university and complete a bachelor’s Course Transferable to CSU degree in engineering. Engineering involves the Hours: 54 hours LEC ; 54 hours LAB DSSOLFDWLRQRIVFLHQWLÀFDQGPDWKHPDWLFDOSULQFLSOHV This is an introductory course in the fundamentals of designing digital computer needed to solve practical technical problems. Although hardware. This course covers: logic gates, binary number system, conversion WKH ÀUVW WZR \HDUV RI HQJLQHHULQJ FRXUVHV IRU DOO between number systems, Boolean algebra, Karnaugh maps, combinational engineering degrees are similar, students should consult ORJLFGLJLWDOORJLFGHVLJQÁLSÁRSVSURJUDPPDEOHORJLFGHYLFHV 3/'V FRXQWHUV the lower division requirements of the institution to which registers, memories, state machines, designing combinational logic and state they wish to transfer. machines into PLDs, and basic computer architecture. The lab is design oriented and emphasizes the use of software equation entry tools, schematic entry, Career Options and logic simulation tools. Lab assignments are design oriented. This course Aerospace Engineer; Architectural Engineer; Biomedical is required for Electrical/Electronics Engineering and Computer Engineering Engineer; Chemical Engineer; Civil Engineer; Computer majors at some universities. This course is also helpful for Computer Science Engineer; Electrical Engineer; Environmental Engineer; majors, electronics technicians, and for students wishing to sample computer Mechanical Engineer engineering. Most career options require a B.S. degree. ENGR 312 ENGINEERING GRAPHICS 3 UNITS Prerequisite: None. Highlights Advisory: MATH 110 Challenging and rewarding classes that transfer Course Transferable to UC/CSU to 4-year universities Hours: 36 hours LEC ; 72 hours LAB This course applies the graphical tools needed to analyze, interpret, and solve engineering problems. The engineering design process is taught using manual WRROVDQGFRPSXWHUDLGHGGHVLJQDQGGUDIWLQJ &$'' WRROVWRVROYHW\SLFDO Engineering (ENGR) engineering problems. Topics include descriptive geometry, vector graphics, orthogonal projection, primary and secondary auxiliary views, geometric ENGR 300 INTRODUCTION TO ENGINEERING 1 UNIT dimensioning and tolerancing (GD&T), 3D solid modeling, and an introduction Prerequisite: None. WRÀQLWHHOHPHQWDQDO\VLV )($ WRROV7KLVFRXUVHLVLQWHQGHGIRUPHFKDQLFDO Course Transferable to UC/CSU and civil engineering majors, but may also be required for other programs. Hours: 18 hours LEC This course will provide students with information to evaluate the engineering ENGR 400 INTRODUCTION TO ELECTRICAL CIRCUITS AND profession as a personal career choice. Students will explore the branches of DEVICES 3 UNITS engineering and the different types of work done by engineers. Participants Prerequisite: PHYS 421. Grade of “C” or better required to meet prerequisite. will investigate personal characteristics which contribute to being successful Course Transferable to UC/CSU engineers, and will examine their own traits. They will learn what preparation Hours: 54 hours LEC and strategies are needed for the successful completion of engineering training. This course will provide engineering students with circuit analysis concepts and Course participants will explore the role of engineers in society and understand DSSOLFDWLRQVWKDWZLOOEHRIYDOXHLQDQ\HQJLQHHULQJÀHOGDVZHOODVDVROLG the responsibilities of engineers in their service to society. foundation for electrical engineering and related majors. The course includes the analysis of circuits with resistors, inductors, capacitors, and independent and dependent voltage and current sources. Many analysis techniques will be DSSOLHGWR'&DQG$&FLUFXLWV'LIIHUHQWLDOHTXDWLRQVZLOOEHXVHGWRÀQGWKH transient response of circuits. Power calculations will be performed on both DC DQG$&FLUFXLWVLQFOXGLQJDQLQWURGXFWLRQWRWKUHHSKDVH$&SRZHU7KLVFRXUVH is required for most engineering Bachelors of Science degrees. Folsom Lake College 2011-2012 Engineering 141 ENGR 420 STATICS 3 UNITS Prerequisite: PHYS 411 and MATH 401. Grade of “C” or better required to meet prerequisite. Course Transferable to UC/CSU Hours: 54 hours LEC 7KLVLVWKHÀUVWFRXUVHLQHQJLQHHULQJPHFKDQLFV7RSLFVLQWKLVFRXUVHLQFOXGH two and three dimensional force system analysis using vector techniques, moments and couples in two and three dimensions, centroids and moment of inertia, friction, forces in beams, and truss analysis. This course is required for mechanical, civil, aeronautical engineering transfer students and by some electrical engineering programs. ENGR 495 INDEPENDENT STUDIES IN ENGINEERING 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB ENGR 499 EXPERIMENTAL OFFERING IN ENGINEERING .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 142 English Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 English COUNSELING Rancho Cordova Center - 916-255-0717 ENGED 320 Tutor Elem Students in Reading (3) DEGREE A.A. - English ENGLT 303 Introduction to the Short Story (3) ENGLT 345 Mythologies of the World (3) The Folsom Lake College English department offers broad ENGLT 360 Women in Literature (3) VWXG\RIWKHÀHOGVRIZULWWHQDQGVSRNHQODQJXDJH7KLV ENGLT 370 Children and Literature (3) study teaches skills that are essential to every other ENGLT 402 Intro to Shakespeare and Film (3) discipline. In particular, the ability to read effectively and TOTAL UNITS REQUIRED ...... 24 write expressively will prove invaluable to any student. This A.A. degree may be obtained by completion of the Career Options Required Program, plus General Education Requirements, Advertising; Business; Columnist/Journalist; Editor/ SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Evaluator; Lawyer; Legislative Assistant; Librarian; Manager; Methods Analyst; Novelist; Public Relations; The English major offers courses in literature, composition, Publisher; Researcher; Screenwriter; Speechwriter; and creative writing designed to enhance communication Teacher; Technical Writer; Writing Consultant skills, deepen cultural awareness, provide a breadth of knowledge appropriate for many degree and vocational Some career options may require more than two years programs, and prepare students for transfer to four-year of college study. institutions, and for a baccalaureate major in English or related majors. Highlights A variety of exciting literature courses Composition courses for all professions and ability Upon completion of this program, the student will be able to: levels Recognize the fundamental elements of poetry, drama, Creative writing classes and prose and apply appropriate criteria to evaluate Writing for publication works of literature. Exemplary faculty: creative, dedicated and Identify major literary developments and authors innovative in British and American literature and analyze their KLVWRULFDODQGFXOWXUDOVLJQLÀFDQFH Evaluate and respond critically to the arguments and DEGREE rhetoric of others. A.A. — English Compose academic essays which support an insightful thesis with appropriate evidence, analysis, and concern REQUIRED PROGRAM ...... Units for audience. Core Requirements-eighteen (18) units: Analyze, evaluate, and integrate print and electronic ENGLT 310 English Literature ...... 3 sources in their essays, applying current MLA standards ENGLT 311 English Literature ...... 3 of documentation. ENGLT 320 American Literature ...... 3 ENGLT 321 American Literature ...... 3 ENGWR 300 College Composition ...... 3 English - Creative Writing (ENGCW) ENGWR 301 College Composition & Literature or ENGCW 400 CREATIVE WRITING 3 UNITS ENGWR 302 Adv Comp & Critical Thinking .....3 Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through Electives - A minimum of 6 units from the following: ...... 6 the assessment process. ENGCW 400 Creative Writing (3) General Education: AA/AS Area II(b); CSU Area C2 ENGCW 410 Fiction Writing Workshop (3) Course Transferable to UC/CSU ENGCW 420 Poetry Writing Workshop (3) Hours: 54 hours LEC ENGCW 430 Creative Non-Fiction Writing This introductory creative writing course offers writing experience in three Workshop (3) RUIRXURIWKHIROORZLQJJHQUHV VKRUWVWRU\SRHWU\FUHDWLYHQRQÀFWLRQDQG ENGCW 452 College Literary Magazine (4) script writing. The course includes analysis of literary models, faculty and ENGED 305 Structure of English (3) class critiques of work, and discussion of literary techniques in each of the covered genres. Folsom Lake College 2011-2012 English 143 ENGCW 410 FICTION WRITING WORKSHOP 3 UNITS ENGCW 499 EXPERIMENTAL OFFERING IN ENGLISH - CREATIVE Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through WRITING .5-4 UNITS the assessment process. Prerequisite: None General Education: CSU Area C2 Course Transferable to CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC 7KLVFRXUVHLVIRFXVHGRQWKHFUDIWRIÀFWLRQZULWLQJZLWKDQHPSKDVLVRQVKRUW ÀFWLRQ6WXGHQWVZULWHVKRUWÀFWLRQDOSLHFHVUHFHLYHIHHGEDFNIURPWKHLUSHHUV English - Education (ENGED) DQGWKHLQVWUXFWRUDQGDQDO\]HÀFWLRQZULWWHQE\SURIHVVLRQDOZULWHUV ENGED 305 STRUCTURE OF ENGLISH 3 UNITS ENGCW 420 POETRY WRITING WORKSHOP 3 UNITS Prerequisite: ENGWR 300 with a grade of “C” or better Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through General Education: AA/AS Area II(a) the assessment process. Course Transferable to CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC Designed for prospective teachers or those entering professions requiring This course focuses on the craft of poetry writing. Students write a number strong written language skills, this course is a study of the structure of English of poems in a variety of forms, receive feedback on their poetry from their grammar systems, especially as they relate to writing (2000 word writing peers and the instructor, and analyze poetry written by professional writers. requirement). It includes the study and practice of traditional and modern grammars, with emphasis on the relationship of grammar to sentence structure. ENGCW 430 CREATIVE NON-FICTION WRITING WORKSHOP Students will have the opportunity to study the history of the English language, 3 UNITS instructional methodologies, and selected issues of language acquisition among Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through the culturally diverse population in California schools. This class meets the the assessment process. CSU, Sacramento, requirement for Liberal Studies majors and is on the list of Course Transferable to UC/CSU recommended courses for English majors. Hours: 54 hours LEC This is a creative writing course concentrating on the literary essay. Students ENGED 320 SERVICE LEARNING: TUTORING ELEMENTARY ZLOOZULWHDQGFULWLFDOO\H[DPLQHYDULRXVNLQGVRIFUHDWLYHQRQÀFWLRQVXFKDV STUDENTS IN READING 3 UNITS PHPRLUDXWRELRJUDSK\SURVHZLWKSRHWLFHOHPHQWV SURVHSRHWU\ DQGIDFW Prerequisite: None. EDVHGRUSKLORVRSKLFDOZULWLQJZLWKDGHÀQLWHOLWHUDU\VW\OLVWLFFRPSRQHQW,WDOVR General Education: AA/AS Area III(b); CSU Area E1 IRFXVHVRQFRQVWUXFWLYHLQFODVVDQDO\VLVRISHUVRQDOHVVD\VZULWWHQE\VWXGHQWV Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB ENGCW 452 COLLEGE LITERARY MAGAZINE 4 UNITS This class offers students an opportunity to learn and practice basic methods of Prerequisite: None tutoring elementary children in reading. Students will meet on campus for the Advisory: Eligibility for ENGWR 300. Grade of “C” or better required to meet ÀUVWSDUWRIWKHVHPHVWHUWREHJLQWUDLQLQJLQWXWRULQJUHDGLQJDQGWKHQZLOOEH prerequisite. assigned to a nearby elementary school or to a before or after school program Course Transferable to CSU ZKHUHWKH\ZLOOKDYHLQGHSWKSUDFWLFHWXWRULQJHOHPHQWDU\FKLOGUHQZKRDUH Hours: 54 hours LEC ; 54 hours LAB reading below grade level. Students will continue to attend the lecture portion This course provides instruction in techniques and experience in writing, editing, of the class throughout the semester in order to receive additional training and structuring the college literary magazine. Students will write, select, and and participate in workshops. This course, which may be offered in conjunction HGLWPDQXVFULSWVLQWKHJHQUHVRISRHWU\VKRUWÀFWLRQDQGFUHDWLYHQRQÀFWLRQ ZLWKDQRQSURÀWRUJDQL]DWLRQVXFKDVWKH%R\VDQG*LUOV&OXELVRQHRIWKH They will also assist in converting accepted manuscripts onto computer disks WZRUHTXLUHGÀHOGH[SHULHQFHFRXUVHVIRUWKH&686%OHQGHG7HDFKHU3UHSDUDWLRQ and in promoting the college literary magazine through various fundraising Program. Prior to beginning work in the schools, students may be required to and advertising activities. Access is provided to computers, laser printer, and EHÀQJHUSULQWHGDQGPXVWSDVVD7%WHVW other production equipment. A campus literary reading will be presented. May be taken two times for credit. ENGED 495 INDEPENDENT STUDIES IN ENGLISH - EDUCATION 1-3 UNITS ENGCW 495 INDEPENDENT STUDIES IN ENGLISH - CREATIVE Prerequisite: None WRITING 1-3 UNITS Course Transferable to CSU Prerequisite: None Hours: 18 hours LEC ; 54 hours LAB Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 144 English Folsom Lake College 2011-2012 ENGED 499 EXPERIMENTAL OFFERING IN ENGLISH - EDUCATION ENGLT 309 BOOK LENGTH LITERATURE FOR GROUP DISCUSSION .5-4 UNITS 1 UNIT Prerequisite: None Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 18 hours LEC Designed to introduce students to book length literature, this one unit class ZLOODOORZVWXGHQWVWRUHDGDQDO\]HDQGGLVFXVVERWKÀFWLRQDQGQRQÀFWLRQ English - Laboratory (ENGLB) works by a wide variety of authors. Using a seminar style, the class will meet DSSUR[LPDWHO\VL[WLPHVWRH[SORUHWKHERRNV7KHLQVWUXFWRUZLOOVHOHFWWKHÀUVW ENGLB 71 READING AND WRITING ACROSS THE CURRICULUM book, and students as a class will choose the remaining works for reading and .25-1 UNITS discussion from an instructor approved list. This course may be taken twice Prerequisite: None. for credit. +RXUV KRXUV/$% Students receive individualized assistance with their reading and writing ENGLT 310 ENGLISH LITERATURE 3 UNITS assignments across the disciplines. Students may enter the course at any Prerequisite: ENGWR 101 with a grade of “C” or better; or placement into ENGWR WLPHGXULQJWKHÀUVWZHHNVRIWKHVHPHVWHUDQGHDUQHLWKHURU 300 via the assessment process. unit. Students may repeat the course up to four times for credit. This course is General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B graded on a credit/no credit basis. Course Transferable to UC/CSU Hours: 54 hours LEC 7KLVFRXUVHLQYROYHVDFORVHVWXG\RIVLJQLÀFDQWZRUNVRIPDMRU%ULWLVKDXWKRUV English - Literature (ENGLT) from the Beowulf poet through Samuel Johnson, with consideration of the important aspects of British literary history. In this course, students will read ENGLT 303 INTRODUCTION TO THE SHORT STORY 3 UNITS and analyze numerous literary works relevant to literature as a whole and Prerequisite: Eligibility for ENGWR 300. to British culture in particular, making connections between various literary General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B periods. Course Transferable to UC/CSU Hours: 54 hours LEC This course introduces students to the short story genre, and involves a close study of this genre’s role in literary history. Students will read, analyze, and discuss short stories by predominantly American and British authors, but LQFOXGHDXWKRUVIURPRWKHUFRXQWULHVZKRKDYHEHHQVLJQLÀFDQWWRWKLVJHQUH Thematic emphasis will focus on the connections between literature, culture, and human experience. INDIVIDUALIZED ENGLISH INSTRUCTION AT THE FOLSOM CAMPUS AND EL DORADO CENTER You can improve your English skills in a comfortable, supportive environment. The Reading and Writing Center in Cypress Hall room FL2-239 at the Folsom campus (FLC) and the English Center in room C-213 at the El Dorado Center (EDC) in Placerville offer innovative and quality instruction for all reading and writing levels, from basic through advanced. Individualized instruction and self-paced programs in spelling, vocabulary, reading, and writing are available at both Centers; all classes DUHJUDGHG3DVV1R3DVV TO TAKE AN INDIVIDUALIZED CLASS: 6LJQXSIRUWKHFODVVHV\RXZDQWXVLQJWKHFRXUVHFRGHVIRUWKHVSHFLÀFORFDWLRQ 2. Go to the FLC Reading and Writing Center or the EDC English Center during their regularly scheduled semester hours, and see an English professor or instructional assistant for more information about getting started with your individualized instruction. THE FLC READING, WRITING, AND MATH CENTER THE EDC ENGLISH CENTER Call Tina Royer or Tracy Rauschkolb at 916-608-6517 Call Kathy Leland at 530-642-5686 Folsom Lake College 2011-2012 English 145 ENGLT 311 ENGLISH LITERATURE 3 UNITS ENGLT 321 AMERICAN LITERATURE 3 UNITS Prerequisite: ENGWR 101 with a grade of “C” or better; or placement into ENGWR Prerequisite: Eligibility for ENGWR 300. 300 via the assessment process. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course surveys representative American literature from approximately 7KLVFRXUVHVXUYH\VVLJQLÀFDQWZRUNVRI%ULWLVKDXWKRUVIURPWKHEHJLQQLQJRI WKHSRVW&LYLO:DUSHULRG WRWKHSUHVHQWZLWKFRQVLGHUDWLRQRILPSRUWDQW 5RPDQWLFLVPLQWKH(LJKWHHQWK&HQWXU\WRWKH0RGHUQVDQG3RVW0RGHUQVRI aspects of American literary history. It begins with the end of the Romantic the Twentieth Century, with consideration of the important aspects of English period and follows the rise of Realism and Modernism. The course may literary history. In this course, students will read and analyze numerous literary incorporate examples of local color, regionalism, social criticism, naturalism works relevant to literature as a whole and to British culture in particular, making and determinism, and/or works by “Lost Generation” or modernist writers as connections between various literary periods. well as contemporary authors and poets. ENGLT 319 INTRODUCTION TO ENGLISH EPIC POETRY 3 UNITS ENGLT 339 POSTMODERN AMERICAN FICTION 3 UNITS Prerequisite: ENGWR 101 (College Writing) with a grade of “C” or better; or Prerequisite: ENGWR 300 with a grade of “C” or better; or placement through placement through the assessment process. the assessment process. Advisory: ENGLT 310 (English Literature), 311 (English Literature), and 340 (World General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Literature) Course Transferable to UC/CSU Hours: 54 hours lecture Hours: 54 hours LEC This course involves a study of English Epic poetry, literature too long and too 7KLVFRXUVHDQDO\]HV$PHULFDQ)LFWLRQ WKDWGHSLFWVSRVWPRGHUQLVP complex to be covered in traditional English literature survey courses. This the radical cultural and intellectual shift that has profoundly altered Western course reviews the conventions of epic poetry (with a focus on the works by traditional thought and art. Students will gain a more critical awareness Homer and Virgil), explains the typical structure, devices, and concerns of the of the aesthetic, ideological, and philosophical issues of postmodernism, epic, and studies the particular development of the English epic with analysis DQGXQGHUVWDQGKRZWUDGLWLRQDODVVXPSWLRQVDERXWPHDQLQJPDNLQJZHUH of epic poetry by Spenser, Milton, and Wordsworth (or any other English epic undermined by doubts about knowledge, perception, and identity. Students like Beowulf or Tennyson’s Idylls of the King). Additionally, this course involves from various majors across the curriculum will have the opportunity to explore a study of the lives of the poets and of their times to understand themes in the important interconnections between literature, cultural studies, philosophy, their respective works, ultimately to put their poems in an historical context art, art history, architectural studies, anthropology, sociology, psychology, and DQGWRUHFRJQL]HWKHLULQÁXHQFHVRQOLWHUDWXUHDQGRQWKHZRUOGDVDZKROHDQG SK\VLFVDOORIZKLFKLQWHUVHFWLQSRVWPRGHUQWKRXJKWDQGÀFWLRQ to appreciate these poems individually as works of art. ENGLT 320 AMERICAN LITERATURE 3 UNITS ENGLT 340 WORLD LITERATURE 3 UNITS Prerequisite: ENGWR 101 with a grade of “C” or better; or placement into ENGWR Prerequisite: ENGWR 101 with a grade of “C” or better; or placement into ENGWR 300 via the assessment process. 300 via the assessment process. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B General Education: AA/AS Area I; AA/AS Area VI; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course surveys representative early American literature from 7KLVFRXUVHLQYROYHVDVXUYH\RIVLJQLÀFDQWPDVWHUSLHFHVRI&ODVVLFDO0HGLHYDO approximately 1620 to the Civil War period, approximately 1865. It begins with and Renaissance literature from the Hebrew Bible to John Milton’s Paradise Lost. DFRQVLGHUDWLRQRISUHFRORQLDO$PHULFDQLQÁXHQFHVVXFKDV1DWLYH$PHULFDQ Students will analyze numerous works of literature, comparing ideas across oral tradition and European exploration of the Americas, through Colonial time, place, and culture and making connections between different literary literature, to the emergence of a distinctive national literature, the “American works and between different literary periods. Renaissance,” “reformism,” and the diversity of voices that will continue into modern American literature. ENGLT 341 WORLD LITERATURE 3 UNITS Prerequisite: ENGWR 101 with a grade of “C” or better; or placement into ENGWR 300 via the assessment process. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Hours: 54 hours LEC 7KLVFRXUVHLQYROYHVDVXUYH\RIVLJQLÀFDQWPDVWHUSLHFHVRIPRGHUQOLWHUDWXUH from the middle of the seventeenth century to the present. Students will analyze numerous works of literature, comparing ideas across time, place, and culture and making connections between different literary works and between different literary periods. 146 English Folsom Lake College 2011-2012 ENGLT 345 MYTHOLOGIES OF THE WORLD 3 UNITS ENGLT 381 SHAKESPEARE: FROM THE PAGE TO THE STAGE Prerequisite: Eligibility for ENGWR 300. 1.5 UNITS General Education: AA/AS Area I; AA/AS Area VI; CSU Area C2; IGETC Area 3B Prerequisite: None Course Transferable to UC/CSU Advisory: ENGWR 300. Hours: 54 hours LEC Course Transferable to CSU This course examines some of the myths underlying the western world view, Hours: 27 hours LEC and recognizes diversity and commonality in myths from Middle Eastern, Students read and analyze two Shakespeare plays and then see those plays in Native North American, African, Asian, and South American cultures. Students repertory production at a Shakespeare festival. Class meets for four general compare and contrast myths from different cultures and analyze various themes, FODVVVHVVLRQVRYHURQHPRQWKDQGWKHQWUDYHOVWRWKHPXOWLGD\IHVWLYDOWR including: the goddess culture, the nature of creation, the dying and reviving YLHZWKHSOD\VLQSURGXFWLRQ)ROORZXSDFWLYLWLHVLQFOXGHEDFNVWDJHGLVFXVVLRQV JRGDQGWKHKHUR·VMRXUQH\,QDGGLWLRQVWXGHQWVZLOOLGHQWLI\-XGDHR&KULVWLDQ ZLWKWKHGLUHFWRUVDQGDFWRUVDQGSRVWSOD\GLVFXVVLRQVDQGFODVVPHHWLQJV themes in various myths and evaluate the myths’ psychological applications. Information about ticket purchase, transportation and lodging will be available From this process, they will gain an understanding of ethnocentrism, ethnicity DWWKHÀUVWFODVVPHHWLQJ and racism and the impact of these on the American experience. ENGLT 402 INTRODUCTION TO SHAKESPEARE AND FILM 3 UNITS ENGLT 360 WOMEN IN LITERATURE 3 UNITS Prerequisite: Eligibility for ENGWR 300. Prerequisite: ENGWR 101 with a grade of “C” or better; or eligibility for ENGWR General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B 300. Course Transferable to UC/CSU General Education: AA/AS Area I; AA/AS Area VI; CSU Area C2; IGETC Area 3B Hours: 54 hours LEC Course Transferable to UC/CSU (1*/7LVDQLQWHQVLYHXQLYHUVLW\OHYHOFRXUVHWUDQVIHUDEOHWRERWK8&DQG Hours: 54 hours LEC CSU. In this course, students will draw connections between traditional and This course is a survey of literature from the Middle Ages to the 21st Century, contemporary literary genres as they read William Shakespeare’s plays and designed for students who are interested in examining the writing of women FULWLFDOO\DQDO\]HÀOPYHUVLRQVRIWKHVHSOD\V6WXGHQWVZLOOUHDGDQGDQDO\]H and their roles in literature, both as writers and as protagonists. Emphasis a selection of Shakespeare’s histories, comedies, tragedies, and romances in will be placed on literature that develops protagonists and explores literary the context of Elizabethan drama. Then they will view a variety of cinematic WKHPHVIRXQGLQWKHVHZRUNVVXFKDV ZRPHQUHSUHVHQWDWLYHRIRULQFRQÁLFW interpretations of these plays and compare and contrast such elements as plot, with their societies; women and power; women as daughters, wives, mothers, character, setting, theme, staging, and critical and directorial interpretation. leaders; independence vs. dependence; women in relation to men and to each other. Over the course of the semester, students will also explore related ENGLT 495 INDEPENDENT STUDIES IN ENGLISH - LITERATURE issues as discovered in the readings, including ethnocentrism, racism, ageism, 1-3 UNITS classism, gender construction, gender inequity, and religious differences. The Prerequisite: None literary selections may include essays, biographies, short stories, novels, poems, Course Transferable to CSU and plays. These works will be considered in their historical contexts as well. Hours: 18 hours LEC ; 54 hours LAB This course transfers to both the UC and CSU systems and thus is taught at the ENGLT 499 EXPERIMENTAL OFFERING IN ENGLISH - LITERATURE university level. .5-4 UNITS Prerequisite: None ENGLT 370 CHILDREN AND LITERATURE 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB Advisory: ENGWR 101 General Education: AA/AS Area I; CSU Area C2 Course Transferable to CSU Hours: 54 hours LEC 7KLVFRXUVHLVDVXUYH\RIWKHEHVWOLWHUDWXUHSDVWDQGSUHVHQWFUHDWHGIRU children and of the criteria for selecting, evaluating, and discussing children’s literature. It includes discussion of the history of children’s literature and of current issues such as censorship, literacy, and multicultural diversity. The course LVLQWHQGHGIRUSURVSHFWLYH.WHDFKHUVSUHVFKRROWHDFKHUVHDUO\FKLOGKRRG education (ECE) majors, parents, and anyone who is or will be in frequent contact with children. It may include reading to children in a small group setting, which FRXOGLQFOXGHDQRIIFDPSXVORFDWLRQ Folsom Lake College 2011-2012 English 147 ENGRD 310 PROSE ANALYSIS AND INTERPRETATION 3 UNITS English - Reading (ENGRD) Prerequisite: ENGRD 110 or ESLR 320 with a grade of “C” or better; or placement through the assessment process. ENGRD 16 BASIC READING SKILLS 2 UNITS Advisory: ENGLB 71 or ENGRD 13 Prerequisite: None. General Education: AA/AS Area II(b) Hours: 36 hours LEC Course Transferable to CSU 7KLVFRXUVHLVWKHÀUVWVWHSHQWU\OHYHOFODVVLQWKH)/&5HDGLQJVHTXHQFHDQG Hours: 54 hours LEC is the prerequisite course for ENGRD 110. The class may be taught in traditional This course covers the theory and practice of critical and speed reading OHFWXUHIRUPDWRULQDQLQGLYLGXDOL]HGPRGXODUIRUPDWDOORZLQJIRUÁH[LEOH VNLOOVDQGVWUDWHJLHVUHTXLUHGIRUSURÀFLHQWDQGHIIHFWLYHUHDGLQJRIFROOHJH scheduling of the 36 required hours. It is designed to prepare students for level reading materials. The class focuses on the following skills: critical and the higher level reading skills required in college and in the workplace. Areas DQDO\WLFDOHYDOXDWLRQRIFROOHJHOHYHOHVVD\VYRFDEXODU\GHYHORSPHQWSURÀFLHQW of concentration include vocabulary development; comprehension skills such FRPSUHKHQVLRQVNLOOVGHYHORSPHQWRIÁH[LEOHUHDGLQJUDWHDQGVSHHGDQGWKH DVÀQGLQJWKHPDLQLGHDLGHQWLI\LQJPDMRUDQGPLQRUGHWDLOVDQGPDNLQJ DSSOLFDWLRQRIWKHVHVNLOOVLQUHDGLQJWH[WERRNVÀFWLRQDQGQRQÀFWLRQPDWHULDOV LQIHUHQFHV EDVLFWH[WERRNUHDGLQJWHFKQLTXHV DQGEHQHÀWVRIOLIHORQJUHDGLQJ One or more hours per week may be required in the Reading/Writing Center for enjoyment. The course is graded Pass/No Pass. Students may enroll during or English Center. WKHÀUVWWZRZHHNVRIWKHVHPHVWHU ENGRD 18 INDIVIDUALIZED READING SKILLS .5-2 UNITS Prerequisite: None. English - Writing (ENGWR) Hours: 36 hours LEC ENGWR 39 BASIC WRITING SKILL DEVELOPMENT 2 UNITS This course offers individualized reading instruction modules at a wide range Prerequisite: None. of skill levels, from basic to advanced, designed to help the student improve Hours: 36 hours LEC UHDGLQJVNLOOVLQVSHFLÀFDUHDV7KLVFRXUVHGRHVQRWPHHWDQ\SUHUHTXLVLWHV LWLV 7KLVFRXUVHLVWKHÀUVWVWHSHQWU\OHYHOFODVVLQWKH)/&:ULWLQJVHTXHQFH for personal enrichment. Modules assigned will vary according to the student’s and successful completion meets the prerequisite for ENGWR 41. The course QHHGVDQGDELOLW\OHYHO6SHFLÀFVNLOODUHDVFRXOGLQFOXGH FRPSUHKHQVLRQ VWDWHG provides instruction in improving basic writing skills and includes writing simple, and implied main idea, major and minor details, inferences, organization, fact compound and complex sentences as well as composing basic paragraphs. from opinion, tone, evaluating arguments), vocabulary development, speed 7KHFODVVLVWDXJKWLQDQLQGLYLGXDOL]HGPRGXODUIRUPDWDOORZLQJIRUÁH[LEOH reading, and textbook reading skills. This course is graded Pass / No Pass. scheduling of the 36 required hours. The course is graded on a Pass/No Pass Students may register up to the 10th week of the semester if the course is basis and students may enroll up to the fourth week of the semester. QRWIXOO6FKHGXOLQJLVÁH[LEOHEDVHGRQWKH5HDGLQJ:ULWLQJ0DWK&HQWHURU English Center’s hours of operation. ENGWR 41 WRITING SKILLS 4 UNITS Prerequisite: ENGWR 39; or placement through the assessment process. ENGRD 110 COMPREHENSION STRATEGIES AND VOCABULARY Hours: 72 hours LEC DEVELOPMENT FOR COLLEGE 3 UNITS 7KLVZULWLQJFRXUVHZLOOIRFXVRQVLQJOHDQGPXOWLSDUDJUDSKRUVKRUWHVVD\ Prerequisite: ENGRD 16; or placement through the assessment process. writing skills. Students will study and practice such things as the writing process, Advisory: ENGLB 71 topic sentences, critical thinking, critical reading, creating clear and correct Hours: 54 hours LEC sentences, and developing the skills necessary to write focused, developed, This course is designed to help students prepare for college level reading. organized paragraphs and short essays. Students will be responsible for Areas of concentration include vocabulary development, literal and inferential writing a total of 2750 words. This course is designed to prepare the student comprehension skills, textbook reading techniques, study skills, and reading for ENGWR 51. IRUSOHDVXUH6WXGHQWVZLOOEHFRPHPRUHHIÀFLHQWUHDGHUVE\OHDUQLQJWRYDU\ reading rate depending upon their purposes for reading. Enrollment in ENGLB ENGWR 42 SPELLING 1 UNIT 71 is recommended for additional individualized help. Prerequisite: None. Hours: 18 hours LEC ENGRD 299 EXPERIMENTAL OFFERING IN ENGLISH - READING This course offers individualized instruction modules suitable for a variety .5-4 UNITS of skill levels, from basic to advanced. Depending on student’s ability level, Prerequisite: None VSHFLÀFVNLOODUHDVFRXOGLQFOXGH SKRQLFVUHYLHZRIORQJDQGVKRUWYRZHOV Hours: 18 hours LEC ; 54 hours LAB SUHÀ[HVDQGVXIÀ[HVFRPPRQO\PLVVSHOOHGZRUGVV\QRQ\PVHIIHFWLYHXVHRI spell check, and basic spelling rules. This course is graded on a Pass/No Pass basis. Students may register through the 10th week of the semester. Scheduling LVÁH[LEOHEDVHGRQ)/&5HDGLQJDQG:ULWLQJ&HQWHURU('&(QJOLVK&HQWHU·V hours of operation. One unit of credit is awarded for 18 hours of instruction. 148 English Folsom Lake College 2011-2012 ENGWR 44 BASICS OF SENTENCE STRUCTURE 1.5 UNITS ENGWR 48 INDIVIDUALIZED VOCABULARY SKILLS 1.5 UNITS Prerequisite: None. Prerequisite: None. Hours: 27 hours LEC Hours: 27 hours LEC This course offers individualized writing instruction modules at a wide range of Individualized instruction modules at a wide range of skill levels designed to skill levels, from basic to advanced. Depending on student need, modules could help the student acquire and/or improve written vocabulary skills and usage. provide training in: grammar, punctuation, mechanics, sentence coordination Modules assigned will vary according to student’s needs and ability level. and subordination, topic sentence, paragraph and essay development and 6SHFLÀFVNLOODUHDVFRXOGLQFOXGH XVLQJZRUGVLQFRQWH[W HIIHFWLYHGLFWLRQDU\ organization, thesis statement and rhetorical modes, as well as information XVDJH SUHÀ[HVVXIÀ[HVDQGURRWV MREUHODWHGFROOHJHUHODWHGDQGRURWKHU on all other aspects of writing effective paragraphs and essays. This course is specialized vocabularies. This course is graded on a Pass/No Pass basis. Students graded on a Pass/No Pass basis. Students may register through the 10th week PD\UHJLVWHUWKURXJKWKHWKZHHNRIWKHVHPHVWHU6FKHGXOLQJLVÁH[LEOH RIWKHVHPHVWHU6FKHGXOLQJLVÁH[LEOHGHSHQGLQJRQ)/&5HDGLQJDQG:ULWLQJ based on the FLC Reading, Writing, Math Center or EDC English Center’s hours Center or EDC English Center hours of operation. 1.5 units of credit are awarded of operation. for 27 hours of instruction. ENGWR 51 DEVELOPMENTAL WRITING 4 UNITS ENGWR 45 BASICS OF VOCABULARY 1.5 UNITS Prerequisite: ENGWR 41 with a grade of “C” or better; or placement through Prerequisite: None. the assessment process. Hours: 27 hours LEC Hours: 72 hours LEC Individualized instruction modules at a wide range of skill levels from basic to This writing course, designed to prepare students for ENGWR 101, will focus on advanced are designed to help students acquire and improve written vocabulary short essay and paragraph writing, using related readings that help develop VNLOOV'HSHQGLQJRQVWXGHQW·VDELOLW\OHYHOVSHFLÀFVNLOODUHDVFRXOGLQFOXGH critical reading skills. Students will study and practice the writing process, learning to use words in context; effectively using a dictionary; employing critical reading and thinking skills, and creating clear and correct sentences SUHÀ[HVVXIÀ[HVDQGURRWV DQGOHDUQLQJDQGXVLQJMREUHODWHGFROOHJHUHODWHG as they develop skills necessary to write a variety of focused, developed, and/or other specialized vocabularies. Students may register through the 10th organized paragraphs and essays. Students will be responsible for writing at ZHHNRIWKHVHPHVWHU6FKHGXOLQJLVÁH[LEOHEDVHGRQ)/&5HDGLQJDQG:ULWLQJ OHDVWÀYHIXOOSURFHVVHVVD\V Center or EDC English Center’s hours of operation. 1.5 units of credit are awarded for 27 hours of instruction. ENGWR 101 COLLEGE WRITING 4 UNITS Prerequisite: ENGWR 51 or ESLW 320 with a grade of “C” or better; or placement ENGWR 46 INDIVIDUALIZED WRITING SKILLS 1.5 UNITS through the assessment process. Prerequisite: None. Hours: 72 hours LEC Hours: 27 hours LEC This writing course, designed to prepare the student for ENGWR 300, will focus on This class offers personalized writing instruction programs at a wide range of reading and writing as integrally related skills. Students will study and practice skill levels designed to help the student acquire or improve writing skills in such things as the writing process, summarizing, critical thinking, creating VSHFLÀFDUHDV3URJUDPVDVVLJQHGZLOOYDU\DFFRUGLQJWRWKHVWXGHQW·VQHHGV clear/varied correct sentences and incorporating sources as they develop the JRDOVDQGDELOLW\OHYHO6SHFLÀFVNLOODUHDVFRXOGLQFOXGH JUDPPDUSXQFWXDWLRQ skills necessary to write a variety of focused, developed, organized essays. and mechanics, sentence coordination and subordination, topic sentence, 6WXGHQWVZLOOEHUHVSRQVLEOHIRUZULWLQJDWOHDVWVL[IXOOSURFHVVHVVD\V paragraph and essay development and organization, thesis statement, and word minimum per essay). rhetorical modes. This course is graded on a Pass/ No Pass basis. Students PD\UHJLVWHUWKURXJKWKHWKZHHNRIWKHVHPHVWHU6FKHGXOLQJLVÁH[LEOH ENGWR 299 EXPERIMENTAL OFFERING IN ENGLISH - WRITING depending on FLC Reading, Writing, Math Center or EDC English Center hours .5-4 UNITS of operation. This course does not meet any prerequisites. Prerequisite: None Hours: 18 hours LEC ; 54 hours LAB ENGWR 47 INDIVIDUALIZED SPELLING SKILLS 1 UNIT ENGWR 300 COLLEGE COMPOSITION 3 UNITS Prerequisite: None. Prerequisite: ENGWR 101 with a grade of “C” or better; or placement through Hours: 18 hours LEC the assessment process. This course offers individualized instruction programs at a wide range of skill General Education: AA/AS Area II(a); CSU Area A2; IGETC Area 1A OHYHOVGHVLJQHGWRKHOSWKHVWXGHQWDFTXLUHRULPSURYHVSHFLÀFVSHOOLQJVNLOOV Course Transferable to UC/CSU 0RGXOHVDVVLJQHGZLOOYDU\DFFRUGLQJWRVWXGHQW·VQHHGVDQGDELOLW\OHYHO6SHFLÀF Hours: 54 hours LEC VNLOODUHDVFRXOGLQFOXGH SKRQLFVUHYLHZRIORQJDQGVKRUWYRZHOVSUHÀ[HVDQG This course offers instruction in critical thinking, reading and writing. The VXIÀ[HVFRPPRQO\PLVVSHOOHGZRUGVKRZWRSURRIUHDGDQGHIIHFWLYHO\XVHVSHOO course is designed to help the student demonstrate, in both argumentative FKHFNORRNDOLNHVRXQGDOLNHZRUGVEDVLFVSHOOLQJUXOHV7KLVFRXUVHLVJUDGHG and expository prose, critical thinking, clear organization, precise diction, on a Pass/ No Pass basis. Students may register through the 10th week of the DQGDSSURSULDWHVW\OH7KURXJKRXWWKHFRXUVHÁXHQF\DQGFRUUHFWQHVVDUH VHPHVWHU6FKHGXOLQJLVÁH[LEOHEDVHGRQWKH)/&5HDGLQJ:ULWLQJ0DWK&HQWHU emphasized. or EDC English Center’s hours of operation. Folsom Lake College 2011-2012 English 149 ENGWR 301 COLLEGE COMPOSITION AND LITERATURE 3 UNITS ENGWR 495 INDEPENDENT STUDIES IN ENGLISH - WRITING Prerequisite: ENGWR 300 with a grade of “C” or better 1-3 UNITS General Education: AA/AS Area I; CSU Area A3; CSU Area C2; IGETC Area 1B Prerequisite: None Course Transferable to UC/CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 18 hours LEC ; 54 hours LAB This course offers study and practice in critical reading of and analytical writing ENGWR 499 EXPERIMENTAL OFFERING IN ENGLISH - WRITING DERXWOLWHUDWXUH6WXGHQWVUHDGÀFWLRQSRHWU\GUDPDQRQÀFWLRQDQGFULWLFLVP .5-4 UNITS from diverse cultural sources and perspectives. With a minimum of six critical Prerequisite: None essays totaling 8000 words, and the use of relevant external sources, students Course Transferable to CSU analyze, criticize, advocate ideas, reason inductively and deductively, and reach Hours: 18 hours LEC ; 54 hours LAB evaluative conclusions based on evidence and sound inferences derived from their close readings of literary texts. ENGWR 302 ADVANCED COMPOSITION AND CRITICAL THINKING 3 UNITS Prerequisite: ENGWR 300 with a grade of “C” or better General Education: AA/AS Area II(b); CSU Area A3; IGETC Area 1B Course Transferable to UC/CSU Hours: 54 hours LEC This course is designed for students who have had ENGWR 300 and who desire further instruction in the techniques of effective critical thinking as expressed in written argument and by the major principles of advanced composition and rhetoric. ENGWR 330 WRITING FOR PUBLICATION 3 UNITS Prerequisite: ENGWR 300. Grade of “C” or better required to meet prerequisite. Course Transferable to CSU Hours: 54 hours LEC 7KLVLVDQLQWURGXFWRU\FRXUVHLQZULWLQJQRQÀFWLRQIRUSXEOLFDWLRQ(PSKDVLV ZLOOEHRQGHYHORSLQJDVDOHDEOHPDJD]LQHDUWLFOH ÀQGLQJLGHDV DQDO\]LQJ magazines; writing a query letter; researching and interviewing; organizing, writing and illustrating an article. Individual and class criticism of student work will be featured. ENGWR 331 WRITING FOR PUBLICATION 3 UNITS Prerequisite: ENGWR 300. Grade of “C” or better required to meet prerequisite. Advisory: ENGWR 330. Course Transferable to CSU Hours: 54 hours LEC 7KLVFRXUVHRIIHUVDPDUNHWLQJDSSURDFKWRVHOOLQJQRQÀFWLRQZULWLQJ7KHFRXUVH surveys consumer, general interest and specialty magazines, including trade journals, company publications, regional magazines and local markets. Activities will include the following: reporting on magazine categories; analysis of a variety of magazine article styles and types; writing and sending articles to the marketplace; individual and class criticism of student manuscripts. Emphasis will be placed on increasing freelance writing publication. The course may be taken two times for credit, with the understanding that many universities and IRXU\HDUFROOHJHVSODFHDQLQHXQLWOLPLWRQWUDQVIHUFUHGLWIURPDGYDQFHG composition courses (ENGWR 330, 331 and ENGCW 400). 150 English Folsom Lake College 2011-2012 Based on the results of my assessment, I place in the following classes: I NDIVIDUALIZED C OMPOSITION R EADING I NSTRUCTION ENGWR 39^ ENGWR 46 ENGRD 16^ Basic Writing Skill Development Individualized Writing Skills Basic Reading Skills ENGRD 18 ENGWR 41^ Individualized Reading Skills Writing Skills ENGRD 110^ Comprehension Strategies & Vocabulary ENGWR 48 Development for College Individualized Vocabulary Skills ENGWR 51^ Developmental Writing ENGWR 47 ENGRD 310^ Individualized Spelling Skills Prose Analysis and Interpretation ENGWR 101^ ENGLB 71 College Writing Reading & Writing Across the Curriculum (supplement to any English course) ENGWR 300^ College Composition Education Classes Classes transfer to CSU; check with a counselor for more information. ENGWR 301 AND ENGWR 302 College Comp. & Advanced Comp. & /OR ENGED 305 ENGED 320 Literature Critical Thinking Service Learning: Tutoring Elementary Structure of English Students in Reading Creative Writing Classes Literature Classes All classes transfer to CSU and/or UC; check with All classes transfer to CSU and/or UC; check with a counselor for more information. a counselor for more information. ENGCW 400 ENGCW 420 ENGLT 303 ENGLT 309 Creative Writing Poetry Writing Workshop Intro to the Short Story Lit for Group Discussion ENGCW 410 ENGCW 452 ENGLT 310/311 ENGLT 320/321 Fiction Writing Workshop College Literary Magazine English Lit American Lit ENGCW 430 ENGLT 345 ENGLT 339 Creative Non-Fiction Writing Workshop Postmodern American Myth of the World Fiction KEY: ENGLT 340/341 ^ = Eligibility is determined by Assessment process ENGLT 360 Women in Lit World Lit Speak with a Counselor for the latest transfer information All Creative Writing courses and Literature classes (except ENGLT 370) and ENGED 320 have eligibility for ENGWR 300 as a prerequisite. ENGLT 370 ENGLT 402 Children in Lit Intro to Shakespeare & Film ______Signature Date Student ID# NOTE: Current as of March 2011; subject to change Folsom Lake College 2011-2012 English as a Second Language 151 English as a Second ACADEMIC Folsom campus - 916-608-6510 El Dorado Center - 530-642-5645 COUNSELING Language Rancho Cordova Center - 916-255-0717 ESL 92 ESL CENTER: INTERMEDIATE INDEPENDENT LAB Folsom Lake College offers courses in ESL designed .5-1 UNITS to provide students with the command of the English Prerequisite: None. language necessary to pursue both transfer level and Hours: 54 hours LAB vocational courses. Students can enter with virtually 7KLVFRXUVHSURYLGHVLQGLYLGXDOL]HGVHOISDFHGDQGRUVPDOOJURXSLQVWUXFWLRQ no knowledge of English and progress to an extremely WRQRQQDWLYH(QJOLVKVSHDNHUVDWWKHLQWHUPHGLDWHOHYHOV$YDULHW\RIVHOI SURÀFLHQWOHYHO study materials are available on such topics as grammar, composition, reading, vocabulary, listening, pronunciation, study skills, and workplace skills to develop Career Options and reinforce the use of the English language. Students may register until the Command of the English language is critical in any end of the ninth week of the semester if space allows. This course is pass/ career choice no pass and is not a substitute for other ESL courses. Students must complete 27 hours of work to earn 0.5 units of credit. Students may earn up to one unit Highlights per semester. This course may be taken a maximum of four times for credit, Well-trained, dedicated staff for a maximum of 4 units. Wide range of practical course offerings designed to facilitate entry into other programs ESL 299 EXPERIMENTAL OFFERING IN ENGLISH AS A SECOND Curriculum of interest to international students LANGUAGE .5-4 UNITS Prerequisite: None Hours: 18 hours LEC ; 54 hours LAB English as a Second Language (ESL) ESL 90 LANGUAGE SKILLS LABORATORY .5-1 UNITS Prerequisite: None. ESL - Grammar (ESLG) Hours: 54 hours LAB ESLG 50 INTERMEDIATE-MID GRAMMAR 4 UNITS 7KLVLVDODERUDWRU\FRXUVHGHVLJQHGWRHQDEOHVWXGHQWVWRIRFXVRQVSHFLÀF Prerequisite: ESLW 40 with a grade of “C” or better; or placement through the English language skills through interaction with tutors, faculty, and computer assessment process. software programs. This class is recommended for ESL students at any level who Advisory: ESLR 50 and ESLW 50; or placement through the assessment QHHGIXUWKHUIRFXVHGDWWHQWLRQWRYHU\VSHFLÀFVNLOOVLQFOXGLQJEXWQRWOLPLWHG process. to pronunciation, grammar, vocabulary development and spelling. Students Hours: 72 hours LEC PD\HQWHUWKHFRXUVHDWDQ\WLPHGXULQJWKHÀUVW ZHHNVRIWKHVHPHVWHUDQG This course concentrates on the fundamental grammatical structures of English. HDUQHLWKHURUXQLW)RUHDFKVHPHVWHURIHQUROOPHQWDVSHFLÀFVWXG\SODFH Students will develop skill and accuracy in using grammatical structures in will be developed by faculty in consultation with the students. Students may appropriate contexts. There will be opportunity for oral and written practice repeat the course, earning a maximum of six (6) units. This course is graded with an emphasis on sentence structure and verb tenses. on a credit no credit basis. ESLG 86 VERB TENSE AND ASPECT 2 UNITS ESL 91 BEGINNING INDEPENDENT LAB .5-1 UNITS Prerequisite: ESLR 40 and ESLW 40 with grades of “C” or better; or placement Prerequisite: None. through the assessment process. Hours: 54 hours LAB Hours: 36 hours LEC 7KLVFRXUVHSURYLGHVLQGLYLGXDOL]HGVHOISDFHGDQGRUVPDOOJURXSLQVWUXFWLRQ 7KLVXQLWHOHFWLYHFRXUVHSURYLGHVDQRYHUYLHZRIWKH(QJOLVKYHUEV\VWHP WRQRQQDWLYH(QJOLVKVSHDNHUVDWWKHEHJLQQLQJOHYHOV$YDULHW\RIVHOIVWXG\ Students will learn the 12 active voice verb structures and their meanings. materials are available on such topics as grammar, composition, reading, Intensive practice will be given in choosing appropriate verb “tenses” for vocabulary, listening, pronunciation, study skills, and workplace skills to develop different purposes. Students will also learn how various kinds of verbs affect and reinforce the use of the English language. Students may register until the sentence structure. end of the ninth week of the semester if space allows. This course is pass/ no pass and is not a substitute for other ESL courses. Students must complete 27 hours of work to earn 0.5 units of credit. Students may earn up to one unit per semester. This course may be taken a maximum of four times for credit, for a maximum of 4 units. 152 English as a Second Language Folsom Lake College 2011-2012 ESLG 299 EXPERIMENTAL OFFERING IN ENGLISH AS A SECOND ESLL 40 INTERMEDIATE-LOW LISTENING AND SPEAKING 4 UNITS LANGUAGE - GRAMMAR .5-4 UNITS Prerequisite: ESLL 30 with a grade of “C” or better; or placement through the Prerequisite: None assessment process. Hours: 18 hours LEC ; 54 hours LAB Corequisite: ESL 92 Advisory: ESLR 40 and ESLW 40 ESLG 310 INTERMEDIATE-HIGH GRAMMAR 4 UNITS Hours: 72 hours LEC Prerequisite: ESLG 57 with a grade of “C” or better; or placement through the This is an intermediate level course in listening comprehension and conversation assessment process. IRUQRQQDWLYH(QJOLVKVSHDNHUV6WXGHQWVZLOOIRFXVRQGHYHORSLQJSKUDVHVDQG Advisory: ESLW 310, and ESLR 310, or other ESL courses at the appropriate sentences to communicate their ideas in familiar situations. The course includes level. group and individual listening and speaking activities, an overview of American Course Transferable to CSU English sounds, and practice in stress, rhythm, and intonation. Hours: 72 hours LEC This course focuses on further practice of the forms, meanings, and usage of ESLL 50 INTERMEDIATE-MID LISTENING AND SPEAKING 4 UNITS JUDPPDWLFDOVWUXFWXUHVRI(QJOLVKDWWKHLQWHUPHGLDWHKLJKOHYHO9HUEDOSUDFWLFH Prerequisite: ESLL 40 with a grade of “C” or better in class reinforces the structures studied. Corequisite: ESL 92 Advisory: ESLG 57, ESLR 50, and ESLW 50 Hours: 72 hours LEC ESL - Listening (ESLL) 7KLVLVDFRXUVHLQOLVWHQLQJFRPSUHKHQVLRQDQGFRQYHUVDWLRQIRUQRQQDWLYH English speakers at the intermediate level. Students will understand and ESLL 20 NOVICE LISTENING AND SPEAKING 4 UNITS be understood in both familiar and unfamiliar situations. Students will be Prerequisite: None. introduced to academic listening and speaking activities and will continue to Corequisite: ESL 91 work on pronunciation skills. This course may be taken once for credit. Advisory: ESLR 20 and ESLW 20 Hours: 72 hours LEC ESLL 299 EXPERIMENTAL OFFERING IN ENGLISH AS A SECOND 7KLVLVDFRXUVHLQOLVWHQLQJFRPSUHKHQVLRQDQGEDVLFFRQYHUVDWLRQIRUQRQ LANGUAGE - LISTENING .5-4 UNITS native English speakers at the novice level. Students will develop the skills Prerequisite: None required for basic communication, such as dates, time, weather, food, family etc. Hours: 18 hours LEC ; 54 hours LAB Students will learn the sounds of English and be introduced to the stress and intonation patterns of American English. Communication will be comprehensible ESLL 310 INTERMEDIATE-HIGH LISTENING AND SPEAKING WRDV\PSDWKHWLFOLVWHQHUDFFXVWRPHGWRLQWHUDFWLQJZLWKQRQQDWLYHVSHDNHUV 4 UNITS Prerequisite: ESLL 50 with a grade of “C” or better; or placement through the ESLL 30 NOVICE-HIGH LISTENING AND SPEAKING 4 UNITS assessment process. Prerequisite: ESLL 20 with a grade of “C” or better; or placement through the Advisory: Concurrent enrollment in an ESL Reading and Writing course at the assessment process. student’s assessed level. Corequisite: ESL 91 Course Transferable to CSU Advisory: ESLR 30 and ESLW 30 Hours: 72 hours LEC Hours: 72 hours LEC 7KLVLVDFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHLQWHUPHGLDWHKLJKOHYHO 7KLVLVDFRXUVHLQOLVWHQLQJFRPSUHKHQVLRQDQGSUDFWLFDOFRQYHUVDWLRQIRUQRQ designed to further practice and develop listening and speaking for academic native English speakers who plan to take college courses. Students will build SXUSRVHVLQFOXGLQJFRPSUHKHQVLRQRIOHFWXUHVQRWHWDNLQJDQGFODVVURRP on their basic communication skills exploring topics such as family, eudcation, discussion. This course covers a review of American English sounds with travel, health etc. They will learn to recognize and produce the sounds in emphasis on understanding and producing stress, rhythm, and intonation American English, stress, rhythm, and intonation patterns. patterns to communicate effectively. Folsom Lake College 2011-2012 English as a Second Language 153 ESLR 50 INTERMEDIATE-MID READING 4 UNITS ESL - Pronunciation (ESLP) Prerequisite: ESLR 40 with a grade of “C” or better; or placement through the assessment process. ESLP 85 PRONUNCIATION 2 UNITS Corequisite: ESL 92 Prerequisite: ESLL 40 with a grade of “C” or better; or placement through the Advisory: ESLG 57, ESLL 50, and ESLW 50 assessment process. Hours: 72 hours LEC Hours: 36 hours LEC 7KLVLVDUHDGLQJFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHLQWHUPHGLDWHPLG This elective course is designed for students who need to improve their level. This course focuses on the introduction of academic reading skills, with pronunciation. It offers intensive practice in the pronunciation and recognition an emphasis on vocabulary development, literal comprehension, and dictionary of American English sounds. Students will be introduced to intonation patterns skills. Students practice critical thinking skills to understand, analyze, discuss, of English, syllables, and stress. and write responses to ideas expressed in reading ESLR 310 INTERMEDIATE-HIGH READING 4 UNITS ESL - Reading (ESLR) Prerequisite: ESLR 50 with a grade of “C” or better; or placement through the assessment process. ESLR 20 NOVICE READING 4 UNITS Advisory: ESLG 310, ESLL 310, and ESLW 310 Prerequisite: None. Course Transferable to CSU Corequisite: ESL 91 Hours: 72 hours LEC Advisory: ESLL 20 and ESLW 20; Advise adult school before taking ESLR 20. 7KLVFRXUVHIRFXVHVRQGHYHORSLQJDFDGHPLFVNLOOVDWWKHLQWHUPHGLDWHKLJKOHYHO Hours: 72 hours LEC with emphasis on speed, vocabulary expansion, and comprehension of ideas. 7KLVLVDUHDGLQJFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHQRYLFHOHYHO,W This course also introduces students to library use. Students will use critical introduces students to reading words, phrases and short sentences in passages. thinking skills to understand, paraphrase, summarize, and respond orally, as Students will learn word forms, spelling rules, phonetics and basic grammar in ZHOODVLQZULWLQJWRLGHDVH[SUHVVHGLQÀFWLRQDQGQRQÀFWLRQUHDGLQJV the context of reading passages. They will work on vocabulary building, basic comprehension skills and reading speed. ESLR 320 ADVANCED-LOW READING 4 UNITS Prerequisite: ESLR 310 with a grade of “C” or better; or placement through ESLR 30 NOVICE-HIGH READING 4 UNITS the assessment process. Prerequisite: ESLR 20 with a grade of “C” or better; or placement through the Advisory: ESLG 320 and ESLW 320, or other ESL courses at the appropriate assessment process. level. Corequisite: ESL 91 Course Transferable to CSU Advisory: ESLL 30 and ESLW 30 Hours: 72 hours LEC Hours: 72 hours LEC 7KLVFRXUVHIRFXVHVRQUHÀQLQJDFDGHPLFUHDGLQJVNLOOVZLWKDQHPSKDVLVRQ (6/5LVDUHDGLQJFRXUVHIRUQRQQDWLYHVSHDNHUVDWWKHQRYLFHKLJKOHYHO speed, vocabulary development, and analytical comprehension. Students will This course focuses on reading words, phrases, and sentences in texts. Students practice research and synthesizing skills and do extensive writing based on will develop reading skills and strategies, increase their core vocabulary, study critical analysis of readings. spelling rules, phonetics, word forms and grammar necessary to understand short readings. ESLR 499 EXPERIMENTAL OFFERING IN ENGLISH AS A SECOND LANGUAGE - READING .5-4 UNITS ESLR 40 INTERMEDIATE-LOW READING 4 UNITS Prerequisite: None Prerequisite: ESLR 30 with a grade of “C” or better; or placement through the Course Transferable to CSU assessment process. Hours: 18 hours LEC ; 54 hours LAB Corequisite: ESL 92 Advisory: ESLL 40 and ESLW 40 Hours: 72 hours LEC 7KLVLVDIRXUXQLWFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHLQWHUPHGLDWHORZ level. This course focuses on developing reading skills with an emphasis on EXLOGLQJYRFDEXODU\OLWHUDOFRPSUHKHQVLRQDQGÁXHQF\6WXGHQWVZLOOGLVFXVV and write about readings. 154 English as a Second Language Folsom Lake College 2011-2012 ESLW 85 PARTS OF SPEECH 2 UNITS ESL - Writing (ESLW) Prerequisite: ESLR 40 and ESLW 40 with grades of “C” or better; or placement through the assessment process. ESLW 20 NOVICE WRITING 4 UNITS Hours: 36 hours LEC Prerequisite: None. This elective course covers the most important parts of speech in English. Corequisite: ESL 91 Students will learn to identify and use nouns, pronouns, adjectives, adverbs, Advisory: ESLL 20 and ESLR 20 verbs, prepositions, and conjunctions in basic sentences. Hours: 72 hours LEC (6/:LVDZULWLQJFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHQRYLFHOHYHO ESLW 86 SPELLING 2 UNITS This course is an introduction to writing in English. Students write about familiar Prerequisite: ESLR 40 and ESLW 40 with grades of “C” or better; or placement topics focusing on the structure of English sentences including parts of speech through the assessment process. and word order. Emphasis is on the production of clear, basic written sentences Hours: 36 hours LEC using common everyday vocabulary. Question formation is also demonstrated This elective course is designed for students who need to improve their spelling. and practiced. By the end of the semester, students will be able to write simple It includes an introduction to the basic spelling rules and patterns of English. sentences using correct grammar. 6WXGHQWVZLOODOVROHDUQWRUHFRJQL]HDQGGLIIHUHQWLDWHKRPRSKRQHVVXIÀ[HV and plurals. Students will develop competence in the ability to spell. ESLW 30 NOVICE-HIGH WRITING 4 UNITS Prerequisite: ESLW 20 with a grade of “C” or better; or placement through the ESLW 310 INTERMEDIATE-HIGH WRITING 4 UNITS assessment process. Prerequisite: ESLW 50 with a grade of “C” or better; or placement through the Corequisite: ESL 91 assessment process. Hours: 72 hours LEC Advisory: ESLG 310, ESLL 310, and ESLR 310 (6/:LVDFRXUVHIRUQRQQDWLYH(QJOLVKVSHDNHUVDWWKHQRYLFHKLJKOHYHO Course Transferable to CSU It will enable students to progress from writing simple sentences to writing Hours: 72 hours LEC narrative and descriptive paragraphs on topics related to their everyday life ,QWKLVFRXUVHVWXGHQWVDWWKHLQWHUPHGLDWHKLJKOHYHOZLOOGHYHORSWKHLUDELOLW\ and experience. to respond to a variety of essay assignments. They will use the writing process WRSURGXFHGHYHORSHGRUJDQL]HGDQGXQLÀHGHVVD\V7KH\ZLOOSUDFWLFHFULWLFDO ESLW 40 INTERMEDIATE-LOW WRITING 4 UNITS thinking skills through class discussion and written response to readings. They Prerequisite: ESLW 30 with a grade of “C” or better; or placement through the ZLOOUHÀQHWKHLUDELOLW\WRFRQWURODUDQJHRIJUDPPDWLFDOVWUXFWXUHV assessment process. Corequisite: ESL 92 ESLW 320 ADVANCED-LOW WRITING 4 UNITS Hours: 72 hours LEC Prerequisite: ESLW 310 with a grade of “C” or better; or placement through 7KLVLVDFRXUVHIRUQRQQDWLYHVSHDNHUVRI(QJOLVKDWWKHLQWHUPHGLDWHORZ the assessment process. level which focuses on writing paragraphs with a clear beginning, middle, and Course Transferable to CSU end while developing correct sentence structure. Students learn to use critical Hours: 72 hours LEC thinking skills and correct grammar in their writing. By the end of the semester, In this course, students will use critical thinking skills and the writing process students are able to write multiple paragraphs. to produce a variety of focused, developed, and organized essays. The course emphasizes sentence variety and the mechanics of English in the context of the ESLW 50 INTERMEDIATE-MID WRITING 4 UNITS essay. Essays will incorporate outside sources as well as personal experience. Prerequisite: ESLW 40 with a grade of “C” or better; or placement through the assessment process. ESLW 499 EXPERIMENTAL OFFERING IN ENGLISH AS A SECOND Corequisite: ESL 92 LANGUAGE - WRITING .5-4 UNITS Advisory: ESLG 57, ESLL 50, and ESLR 50 Prerequisite: None Hours: 72 hours LEC Course Transferable to CSU 7KLVLVDFRXUVHIRUQRQQDWLYHVSHDNHUVDWWKHLQWHUPHGLDWHPLGOHYHOZKLFK Hours: 18 hours LEC ; 54 hours LAB focuses on the development of paragraph writing in a variety of rhetorical modes through guided writing and practice. By the end of the semester, students ZLOOSURJUHVVWRZULWLQJPXOWLSDUDJUDSKHVVD\V6WXGHQWVZLOOOHDUQWHFKQLTXHV essential to essay writing. They will continue to develop sentence structure in longer pieces of writing. Folsom Lake College 2011-2012 English as a Second Language 155 Based on the results of my assessment, I place in the following classes: L ISTENING R EADING ESLL 20 ESLR 20 Novice Listening & Speaking Novice Reading [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] ESLR 30^ ESLL 30^ See a Novice-High Reading Novice-High Listening & Speaking [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] Counselor ESLR 40^ Intermediate-Low Reading ESLL 40^ [non-degree applicable / non-transferable] Intermediate-Low Listening & Speaking [non-degree applicable / non-transferable] ESLR 50^ Intermediate-Mid Reading ESLL 50^ [non-degree applicable / non-transferable] Intermediate-Mid Listening & Speaking PRONUNCIATION [non-degree applicable / non-transferable] ESLR 310^ Intermediate-High Reading [CSU]* ESLL 310^ ESLP 85^ Intermediate-High Pronunciation ESLR 320^ Listening & Speaking [non-degree applicable / Advanced-Low Reading [CSU]* non-transferable] [CSU]* GRAMMAR W RITING LAB ESLG 50 ESLW 20 ESL 90 Intermediate-Mid Grammar Novice Writing Language Skills Lab [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] ESLW 30^ ESL 91 Novice-High Writing Beginning Independent Lab ESLG 310^ [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] Intermediate-High Grammar [CSU]* ESLW 40^ ESL 92 Intermediate-Low Writing ESL Center: Intermediate Independent Lab [non-degree applicable / non-transferable] [non-degree applicable / non-transferable] ESLG 86^ ESLW 50^ ESLW 85^ ESLW 86^ Verb Tense & Aspect Intermediate-Mid Writing Parts of Speech Spelling [non-degree applicable / [non-degree applicable / non-transferable] [non-degree applicable / [non-degree applicable / non-transferable] non-transferable] non-transferable] ESLW 310^ Intermediate-High Writing KEY: [CSU]* * = Speak with a Counselor for Transfer Information ^ = Eligibility can be determined by ESLW 320^ Assessment Process Advanced-Low Writing [CSU]* ______Signature Date Student ID# NOTE: Current as of March 2010; subject to change 156 Environmental Technology Folsom Lake College 2011-2012 Environmental Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Technology COUNSELING Rancho Cordova Center - 916-255-0717 Folsom Lake College offers limited coursework in Environmental Technology (ENVT) Environmental Technology (ENVT). These courses are designed to provide basic information to students ENVT 304 ENVIRONMENTAL BIOLOGY 3 UNITS interested in environmental protection, regulatory Same As: BIOL 350 compliance and workplace safety and health Prerequisite: None. applications. Students may also transfer to Cosumnes General Education: AA/AS Area IV; CSU Area B2 River College to earn a degree in Environmental Course Transferable to UC/CSU Technology. Graduates may be employed by businesses Hours: 54 hours LEC and governmental agencies that require a knowledge of This course provides an overview of ecosystems and natural resources. Major techniques for storage, treatment, transport and disposal topics covered include ecological principles, ecosystem functioning, conservation of hazardous materials, a basic understanding of the biology, resource use (including historical and cultural values) and management, chemical and biological phenomena which underlie SROOXWLRQDQGRWKHUKXPDQFDXVHGHQYLURQPHQWDOLPSDFWV7KLVFRXUVHSURYLGHV environmental protection, and an understanding of the background needed to understand major global and regional issues such environmental health and safety. Technicians may be as acid rain, global climate change, hazardous waste disposal, deforestation, employed in remediation, monitoring, compliance or ecological sustainability and endangered species recovery. ENVT 304 is environmental information applications. especially useful for Environmental Technology, Environmental Sciences, Ecology, Recreation, Education and Political Science majors. This course is the same as Career Options BIOL 350. You cannot enroll in theis course if you have already passed BIOL Engineering/Consulting Firms; Governmental 350. Field trips, attendance at public meetings and/or a semester project may &RPSOLDQFH $JHQFLHV 6ROLG :DVWH 'LVSRVDO /DQGÀOOV be required. Agricultural Chemical Manufacture & Application Firms; Analytical Laboratories; Treatment, Storage, ENVT 350 WATER RESOURCES 4 UNITS Disposal Facilities; Warehouse-Transportation Systems; Prerequisite: None Electronics Semiconductor Industry; Workplace Health and Course Transferable to CSU Safety Support; Energy & Environmental Audit/Inventories Hours: 54 hours LEC ; 54 hours LAB This course provides an overview of water resources including aspects of the Many career options require a B.S. degree. Classes chemistry, geography, and biology of aquatic systems. Water laws and the EH\RQGWKHDVVRFLDWHGHJUHHPD\EHUHTXLUHGWRIXOÀOO ecotoxicology of water resources will also be discussed. Students will learn to some career options or for preparation for transfer to a use basic sampling and analysis methods to assess water resources. Students university program. will be expected to conduct lab work, some of which may be outdoors. The class is useful for students interested in Environment Science, Environmental Highlights Technology, Geography, Natural Resource Management, and Biology. This class $´KDQGVRQµSURJUDPSURYLGLQJDÀUPIRXQGDWLRQ is not intended for students training as water treatment plant operators. in all areas of hazardous materials handling %URDGEDVHGÀHOGZLWKDSSOLFDWLRQVUDQJLQJIURP ENVT 350.1 FUNDAMENTALS OF WATER RESOURCES 1 UNIT recordkeeping to pollution cleanup to emergency Prerequisite: None response Course Transferable to CSU Hours: 18 hours LEC NOTE This course provides an overview of water resources including aspects of the For information on the Waste Water Management chemistry, geography, and biology of aquatic systems. Topics include hydrologic DQG:DWHU0DQDJHPHQWFHUWLÀFDWHSURJUDPVVHH cycle, ocean resources, freshwater systems, and groundwater. Water laws and those sections of the catalog. regulations are also discussed. The class is useful for students interested in Environmental Science, Environmental Technology, Geography, Natural Resource Management, and Biology. (The class is not intended for students training as water treatment plant operators.) Folsom Lake College 2011-2012 Environmental Technology 157 ENVT 350.2 GROUNDWATER RESOURCES 1.5 UNITS ENVT 352 WATER RESOURCE MANAGEMENT 1.5 UNITS Prerequisite: None Prerequisite: None Advisory: ENVT 350.1. Advisory: ENVT 350.1. Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 27 hours LAB Hours: 18 hours LEC ; 27 hours LAB This course provides an overview of groundwater resources. The structure This course provides an overview of managing potable and waste water supply RIDTXLIHUVLQFOXGLQJJURXQGZDWHUUHFKDUJHVWRUDJHDQGÁRZLVGLVFXVVHG with respect to use. Topics include water resource demand, the soil/water Students will analyze the impacts of groundwater withdrawal and contamination. relationship and water quality. Water treatment laws and regulation will also Students will learn to use basic sampling and analysis methods used to assess be discussed. Students learn the basic sampling and analysis methods to assess groundwater systems. The remediation of contaminated groundwater will be quality and application issues. Students are expected to conduct lab work, discussed. Students will be expected to conduct lab work; some of this may be some of which will be outdoors. This class is useful for students interested outdoors. The class is useful for students interested in Environmental Science, in Environmental Science or Technology, Natural Resource Management and Environmental Technology, Geography, Natural Resource Management, and Biology. This class is not intended for students training as water treatment Biology. A basic knowledge of water resources is assumed before beginning plant operators. the course. The class is not intended for students training as water treatment plant operators. ENVT 353 SCIENCE FOR WATER AND WASTEWATER OPERATORS 4 UNITS ENVT 350.3 SURFACE FRESHWATER RESOURCES 1.5 UNITS Prerequisite: None. Prerequisite: None Advisory: ENVT 351 Advisory: ENVT 350.1. Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC ; 54 hours LAB Hours: 18 hours LEC ; 27 hours LAB This course will cover three topic areas, Biology, Chemistry, and Physics as they This course provides an overview of surface water resources including lakes, apply to operation, maintenance, and management of water and wastewater streams, and wetlands. The general characteristics of these ecosystems will facilities. The course is intended to provide the student with a fundamental be discussed with an emphasis on the biology of these systems. Students will understanding of the sciences underlying studies of water and wastewater learn to use basic sampling and analysis methods used to assess freshwater conveyance and treatment. Field trips may be required. systems. The ecotoxicology and clean up of contaminated surface water will be discussed. Students will be expected to conduct lab work, some of which ENVT 354 WASTE WATER MANAGEMENT: BASIC may be outdoors. The class is useful for students interested in Environmental INSTRUMENTATION AND ELECTRICAL CONTROLS 4 UNITS Science, Environmental Technology, Geography, Natural Resource Management, Prerequisite: None. and Biology. A basic knowledge of water resources is assumed before beginning Course Transferable to CSU the course. The class is not intended for students training as water treatment Hours: 54 hours LEC ; 54 hours LAB plant operators. This course is an introduction to power and control circuits and devices used with water and wastewater distribution and treatment systems. Units of instruction ENVT 351 MATH FOR WATER AND WASTEWATER OPERATORS include a study of electron theory, magnetism, induction, alternating current, 3 UNITS direct current, resistance and capacitance. Practice using electrical meters and Prerequisite: None. test instruments in laboratory classes along with related safety practices will Advisory: CHEM 305 and MATH 120 also be covered. Field trips may be required. Course Transferable to CSU Hours: 54 hours LEC ENVT 355 INTRODUCTION TO WATER, WASTEWATER AND This course provides an introduction to wastewater and water mathematic RECYCLED WATER MANAGEMENT 3 UNITS IXQFWLRQV7RSLFVFRYHUHGLQFOXGHJHQHUDOPDWKLQFOXGLQJVLJQLÀFDQWÀJXUHVDQG Prerequisite: None. proper rounding, applicable algebraic and geometry equations, unit analysis, Course Transferable to CSU YROXPHVÁRZVSUHVVXUHVFRQYHUVLRQVVROXWLRQVWUHQJWKVDQGDSSOLFDEOH Hours: 54 hours LEC laboratory and chemistry equations used in water and wastewater treatment This course provides an introduction to water, wastewater and recycled water operations. Field trips may be required. management. Topics covered include history of water supply and treatment, wastewater collection and treatment, and recycling water in the world and in the United States; and an overview of the State and federal regulations governing water supply, wastewater treatment and recycled water use, LQFOXGLQJSHUPLWWLQJUHTXLUHPHQWVDQGRSHUDWRUFHUWLÀFDWLRQSURJUDP7KLV course provides an introduction to managing water and wastewater systems. Field trips may be required. 158 Environmental Technology Folsom Lake College 2011-2012 ENVT 356 WASTEWATER OPERATIONS AND MAINTENANCE I ENVT 359 WATER TREATMENT OPERATION AND MAINTENANCE 3 UNITS II 3 UNITS Prerequisite: None. Prerequisite: ENVT 358 with a grade of “C” or better Advisory: ENVT 351 Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 54 hours LEC This course provides an advanced level understanding of drinking water This course provides an introduction of wastewater operations and maintenance. treatment. Topics covered include drinking water regulations, laboratory Topics covered include responsibilities of the plant operator, water treatment SURFHGXUHVLURQDQGPDQJDQHVHFRQWUROÁXRULGDWLRQZDWHUWUHDWPHQWSODQW and wastes, wastewater treatment facilities, preliminary treatment operations design, advanced treatment process and technologies such as softening, and maintenance including racks, screen, grit removal, sedimentation and membrane filtration and demineralization, instrumentation and control, ÁRWDWLRQWULFNOLQJÀOWHUVURWDWLQJELRORJLFDOFRQWUDFWRUVDFWLYDWHGVOXGJHZDVWH advance plant maintenance and plant administration. This course provides the treatment ponds, disinfection and chlorination. This course provides the student background into the importance of advanced water treatment, its functionality, ZLWKDQHQWU\OHYHOEDFNJURXQGLQWRWKHÀHOGRIRSHUDWLRQVDQGPDLQWHQDQFHRI past and present technology and the future of drinking water. Field trips and/ wastewater. Field trips and/or a semester project may be required. or a semester project may be required. This course meets the initial education UHTXLUHPHQWVIRUWUHDWPHQWRSHUDWRUFHUWLÀFDWLRQH[DP)LHOGWULSVPD\EH ENVT 357 WASTEWATER OPERATIONS AND MAINTENANCE II required. 3 UNITS Prerequisite: ENVT 356 with a grade of “C” or better ENVT 360 WATER DISTRIBUTION OPERATION AND MAINTENANCE Course Transferable to CSU 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course provides an advanced level of understanding of wastewater Course Transferable to CSU operations and maintenance. Topics covered include activated sludge, sludge Hours: 54 hours LEC digestion and solids handling, effluent disposal, plant safety and good This course provides an understanding of drinking water distribution systems housekeeping, maintenance, basic laboratory procedures, application of operation and maintenance. Topics covered include: design criteria, storage, computers for plant operations and maintenance, analysis and presentation SXPSLQJÁRZFRQWUROFRQVWUXFWLRQPHWKRGVGLVLQIHFWLRQFRQWURORIZDWHU of data, records and report writing. Field trips may be required. quality in a water distribution system, federal and state drinking water regulations, maintenance and administration of a water distribution system. ENVT 358 WATER TREATMENT OPERATION AND MAINTENANCE Field trips and/or a semester project may be required. This course meets the I 3 UNITS LQLWLDOHGXFDWLRQDOUHTXLUHPHQWVIRUDGLVWULEXWLRQRSHUDWRUFHUWLÀFDWLRQH[DP Prerequisite: None. Advisory: ENVT 351 and 355 ENVT 361 WASTEWATER COLLECTION SYSTEMS OPERATION Course Transferable to CSU AND MAINTENANCE 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course provides an entry level understanding of drinking water treatment. Course Transferable to CSU Topics covered include history of water treatment, responsibilities of the Hours: 54 hours LEC plant operator, reasons for treating water, source water management, water This course provides a basic level of understanding of proper installation, treatment facilities, treatment process and technologies, disinfection and inspections, operations, maintenance and repair of wastewater collection plant maintenance. This course provides the background into the importance systems. Topics covered include the wastewater collection operator, wastewater of treating water, its functionality, past and present technology and the future collection systems, safe procedures, inspecting and testing collections systems, of drinking water. Field trips may be required. pipeline cleaning and maintenance methods, and underground repairs. Field trips and/or a semester project may be required. ENVT 495 INDEPENDENT STUDIES IN ENVIRONMENTAL TECHNOLOGY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Environmental Technology 159 ENVT 498 WORK EXPERIENCE IN ENVIRONMENTAL TECHNOLOGY 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity or job related to career goals. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. ENVT 499 EXPERIMENTAL OFFERING IN ENVIRONMENTAL TECHNOLOGY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 160 Family and Consumer Science Folsom Lake College 2011-2012 Family and Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Consumer Science COUNSELING Rancho Cordova Center - 916-255-0717 FCS 324 HUMAN DEVELOPMENT: A LIFE SPAN 3 UNITS Folsom Lake College course offerings in Family & Same As: PSYC 370 Consumer Science are designed primarily to provide Prerequisite: None. knowledge and skills in the areas of child development Advisory: ENGWR 101 and 103 and family development. Students planning to transfer General Education: CSU Area D9; CSU Area E1; IGETC Area 4I VKRXOGFRQVXOWZLWKDFRXQVHORUDQGRUVSHFLÀFFROOHJH Course Transferable to UC/CSU catalog for transfer, major and general education course Hours: 54 hours LEC work. This course will provide an overview of the physical, cognitive, social, and emotional development from conception through the end of life. Emphasis Career Options ZLOOEHRQH[DPLQDWLRQRIWKHRUHWLFDODGYDQFHVDQGHYLGHQFHEDVHGSULQFLSOHV Early Care and Education; Education; Pediatric; applicable to biosocial, psychosocial and cognitive development throughout the Instructional Assistant; Counseling; Child Psychology; OLIHVSDQ6FLHQWLÀFÀQGLQJVIURPDUDQJHRIGLVFLSOLQHVZLOOLQIRUPDQLQWHJUDWHG Social Work H[DPLQDWLRQRIWKHRU\DQGSUDFWLFHZLWKORQJWHUPLPSOLFDWLRQVLQPLQG7KLV FRXUVHLVGHVLJQHGWRIXOÀOO*HQHUDO(GXFDWLRQ1XUVLQJDQG3V\FKRORJ\GHJUHH Some career options may require more than two years of requirements. This course is not open to those who have previously completed college study. PSYC 370. Highlights FCS 494 TOPICS IN FAMILY AND CONSUMER SCIENCE .5-4 UNITS Strong support for the Early Childhood Education Prerequisite: None program Course Transferable to CSU Opportunities for transfer level instruction Hours: 18 hours LEC Professional and innovative staff 7KLVFRXUVHSUHVHQWVLQGHSWKGLVFXVVLRQVRIFRQWHPSRUDU\LVVXHVLQWKH)DPLO\ and Consumer Sciences. Topics will be selected according to current interest, such as: Microwave Cooking; Protein Alternatives; Realities of Aging; Parenting the Young Child. Students may receive one unit of credit for each topic area. Family and Consumer Science (FCS) &RQVXOWFODVVVFKHGXOHIRUVSHFLÀFDUHDVRIIHUHG FCS 322 FAMILY DEVELOPMENT 3 UNITS Same As: PSYC 354 FCS 495 INDEPENDENT STUDIES IN FAMILY AND CONSUMER Prerequisite: None. SCIENCE 1-3 UNITS General Education: AA/AS Area III(b); CSU Area E1 Prerequisite: None Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 18 hours LEC ; 54 hours LAB A functional study of marriage and the family in light of today’s societal FCS 499 EXPERIMENTAL OFFERING IN FAMILY AND CONSUMER changes. An evaluation of traditional and current attitudes toward roles, life SCIENCE .5-4 UNITS styles and relationships of men and women. Not open to students who have Prerequisite: None received credit for PSYC 354. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Fire Technology 161 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Fire Technology COUNSELING Rancho Cordova Center - 916-255-0717 FT 498 Work Experience in Fire Technology (1 - 4) DEGREE A.S. - Fire Technology EMT 100 Basic Emergency Medical Care (5) TOTAL UNITS REQUIRED ...... 30 CERTIFICATE OF ACHIEVEMENT Fire Technology This A.A. degree may be obtained by completion of the Required Program, plus General Education Requirements, 7KHÀUHVHUYLFHLVRQHRIWKHPRVWG\QDPLFHPSOR\HUVLQWKH SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO country. The course at Folsom Lake College complements the American River College and Cosumnes River College This program is designed for students interested in careers programs, which are designed to provide the student with LQVWDWHFRXQW\RUPXQLFLSDOÀUHVHUYLFHRUJDQL]DWLRQV7KH updated skills and knowledge necessary to complete and curriculum focuses on various competency areas for those VXFFHVVIXOO\DSSO\IRUÀUHVHUYLFHSRVLWLRQV ZLVKLQJHLWKHUWRHQWHUWKHÀUHVHUYLFHLQGXVWU\RUHQKDQFH their existing abilities. Career Options Firefighter; Inspector; Investigator; Plan Checker; Upon completion of this program, the student will be able to: Supervisor; Manager Evaluate employment opportunities and successfully SODFHVWXGHQWVDVÀUHÀJKWHUVZLWKORFDOÀUHDJHQFLHV Some career options may require more than two years of (YDOXDWH SURDFWLYH SUHYHQWLRQ DQG ÀUH SURWHFWLRQ college study. Classes beyond the associate degree may be programs as they pertains to life and property within UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ WKHÀUHVHUYLFH for transfer to a university program. Apply personal safety practices which demonstrate and understanding of personal safety practices in the Highlights ÀUHÀJKWLQJLQGXVWU\ Up-to-date technical information ,GHQWLI\ DQG GHVFULEH WKH SK\VLFDO SURFHVVHV RI ÀUH )LHOGWULSVWRDYDULHW\RIÀUHVHUYLFHORFDWLRQV and combustion. 1HWZRUNLQJZLWKRWKHUÀUHVHUYLFHPHPEHUV 3UDFWLFHZLOGODQGÀUHÀJKWLQJVNLOOVDQGWHFKQLTXHVDVWKH\ Fire Technology work experience internships pertain to wildland and urban interface in California. (Fire Technology 498 for on-the-job experience) CERTIFICATE OF ACHIEVEMENT DEGREE Fire Technology A.S. — Fire Technology REQUIRED PROGRAM ...... Units FT 192 Wildland Fire Control ...... 3 REQUIRED PROGRAM ...... Units FT 300 Fire Protection Organization ...... 3 Core Requirements-eighteen (18) units: FT 301 Fire Prevention Technology ...... 3 FT 192 Wildland Fire Control ...... 3 FT 302 Fire Protection Equipment & Systems ....3 FT 300 Fire Protection Organization ...... 3 FT 303 Building Construction for Fire Protection ..3 FT 301 Fire Prevention Technology ...... 3 FT 304 Fire Behavior & Combustion ...... 3 FT 302 Fire Protection Equipment & Systems ....3 TOTAL UNITS REQUIRED ...... 18 FT 303 Building Construction for Fire Protection ..3 FT 304 Fire Behavior & Combustion ...... 3 This program is designed for students interested in careers LQVWDWHFRXQW\RUPXQLFLSDOÀUHVHUYLFHRUJDQL]DWLRQV7KH A minimum of 12 units from the following: ...... 12 curriculum focuses on various competency areas for those FT 110 Fire Apparatus (3) ZLVKLQJHLWKHUWRHQWHUWKHÀUHVHUYLFHLQGXVWU\RUHQKDQFH FT 132 Fire Service Records and Reports (3) their existing abilities. FT 170 Fire Investigation (3) FT 180 Rescue Practices (3) FT 190 Fire Tactics and Strategy (3) FT 310 Fire Service Hydraulics (3) 162 Fire Technology Folsom Lake College 2011-2012 Upon completion of this program, the student will be able to: FT 190 FIRE TACTICS AND STRATEGY 3 UNITS Evaluate employment opportunities and successfully Prerequisite: None. SODFHVWXGHQWVDVÀUHÀJKWHUVZLWKORFDOÀUHDJHQFLHV Hours: 54 hours LEC (YDOXDWH SURDFWLYH SUHYHQWLRQ DQG ÀUH SURWHFWLRQ This course introduces the relationship between tactics and strategies on programs as they pertains to life and property within WKHÀUHJURXQGDQGHPHUJHQF\VFHQH7RSLFVLQFOXGHSULQFLSOHVRIÀUHFRQWURO WKHÀUHVHUYLFH through the utilization of manpower, equipment, and extinguishing agents on Apply personal safety practices which demonstrate an WKHÀUHJURXQG7KHFRXUVHZLOOWDNHDQDOOULVNDSSURDFKWRPXOWLSOHW\SHVRI XQGHUVWDQGLQJRISHUVRQDOVDIHW\SUDFWLFHVLQWKHÀUH target hazards and approaches. ÀJKWLQJLQGXVWU\ ,GHQWLI\ DQG GHVFULEH WKH SK\VLFDO SURFHVVHV RI ÀUH FT 192 WILDLAND FIRE CONTROL 3 UNITS and combustion. Prerequisite: None. 3UDFWLFHZLOGODQGÀUHÀJKWLQJVNLOOVDQGWHFKQLTXHVDVWKH\ Hours: 54 hours LEC pertain to wildland and urban interface in California. 7KLVFRXUVHFRYHUVIXQGDPHQWDOFRPSRQHQWVRIZLOGODQGÀUHÀJKWLQJ7RSLFV LQFOXGHÀUHÀJKWHUVDIHW\DQGVXUYLYDOLQWKHZLOGODQGHQYLURQPHQWIXQGDPHQWDO ZLOGODQGÀUHEHKDYLRUDVLWUHODWHVWRZHDWKHUIXHODQGWRSRJUDSK\DQGZLOGODQG Fire Technology (FT) ÀUHÀJKWLQJWDFWLFVDQGVWUDWHJLHV FT 110 FIRE APPARATUS 3 UNITS FT 300 FIRE PROTECTION ORGANIZATION 3 UNITS Prerequisite: None. Prerequisite: None. Hours: 54 hours LEC Course Transferable to CSU 7KLVFRXUVHLQWURGXFHVVWXGHQWVWRPDQ\DVSHFWVRIÀUHDSSDUDWXV6WXGHQWVDUH Hours: 54 hours LEC DFTXDLQWHGZLWKDSSDUDWXVGHVLJQVSHFLÀFDWLRQVDQGSHUIRUPDQFHFDSDELOLWLHV 7KLVFRXUVHSURYLGHVDQLQWURGXFWLRQWRÀUHSURWHFWLRQFDUHHURSSRUWXQLWLHV (PSKDVLVLQFOXGHVHIIHFWLYHXVHRIÀUHDSSDUDWXVGXULQJÀUHHPHUJHQFLHV DQGUHODWHGÀUHVHUYLFHÀHOGV7RSLFVLQFOXGHSKLORVRSK\DQGKLVWRU\RIÀUH SURWHFWLRQÀUHORVVDQDO\VLVRUJDQL]DWLRQDQGIXQFWLRQRISXEOLFDQGSULYDWH FT 132 FIRE SERVICE RECORDS AND REPORTS 3 UNITS ÀUHSURWHFWLRQVHUYLFHVDQGÀUHGHSDUWPHQWVDVDSDUWRIWKHORFDOJRYHUQPHQW Prerequisite: None. $GGLWLRQDOWRSLFVLQFOXGHODZVDQGUHJXODWLRQVDIIHFWLQJWKHÀUHVHUYLFHÀUH Advisory: FT 300 VHUYLFHQRPHQFODWXUHVSHFLÀFÀUHSURWHFWLRQIXQFWLRQVDQGEDVLFÀUHFKHPLVWU\ Hours: 54 hours LEC DQGSK\VLFV7KLVFRXUVHLVDQLQWURGXFWLRQWRÀUHVWUDWHJ\DQGWDFWLFVDQGÀUH 7KLVFRXUVHLVIRUDOOPHPEHUVRIWKHÀUHVHUYLFHLQWKHXVHRIW\SLFDOUHFRUGV protection systems. and report systems. The course expands knowledge and understanding of the ÀUHGHSDUWPHQWUHFRUGVV\VWHPVSULQFLSOHVRIUHSRUWZULWLQJ,WDOVRFRYHUV FT 301 FIRE PREVENTION TECHNOLOGY 3 UNITS DSSOLFDWLRQVLQSUHÀUHVXUYH\SRVWÀUHUHSRUWLQJUHVHDUFKDQGSODQQLQJ Prerequisite: None. Course Transferable to CSU FT 170 FIRE INVESTIGATION 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course provides fundamental information regarding the history, philosophy, Advisory: FT 300 DQGWKHJRDOVRIÀUHSUHYHQWLRQ7RSLFVLQFOXGHWKHRUJDQL]DWLRQDQGRSHUDWLRQ Hours: 54 hours LEC RIDÀUHSUHYHQWLRQEXUHDXXVHRIÀUHDQGEXLOGLQJFRGHVÀUHLQYHVWLJDWLRQDQG This course introduces students to the implications of accidental, suspicious, and LGHQWLÀFDWLRQDQGFRUUHFWLRQRIÀUHKD]DUGV$GGLWLRQDOWRSLFVLQFOXGHH[SORULQJ LQFHQGLDU\FDXVHVRIÀUHDQGH[DPLQHVDUVRQDVDFULPH6WXGHQWVZLOODQDO\]H the process of reviewing a building plan, report and record keeping, and the the methods used in gathering evidence at a crime scene, the developments of GXWLHVDQGUHVSRQVLELOLWLHVRIDÀUHSUHYHQWLRQRIÀFHU court procedures, the techniques of interviewing witnesses and suspects, and detention procedures for adults and juveniles. FT 302 FIRE PROTECTION EQUIPMENT AND SYSTEMS 3 UNITS Prerequisite: None. FT 180 RESCUE PRACTICES 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Hours: 54 hours LEC This course provides information relating to sprinkler design and the operation 7KLVFRXUVHIRFXVHVRQWKHLGHQWLÀFDWLRQDQGPDQDJHPHQWRIUHVFXHVLWXDWLRQV RIÀUHGHWHFWLRQDQGDODUPV\VWHPV7RSLFVLQFOXGHÀUHFDXVHDQGHIIHFWKHDW such as proper utilization and awareness of equipment, tools, and techniques and smoke control systems, special protection and sprinkler systems, water to handle various rescue situations. Topics include vehicle extrication, water VXSSO\IRUÀUHSURWHFWLRQVWDQGSLSHV\VWHPVDQGSRUWDEOHÀUHH[WLQJXLVKHUV rescue, vertical rescue, building collapse, radiation hazards, hazardous materials )RXUORFDODUHDÀHOGWULSVDUHUHTXLUHG UHVFXHÀUHVLWXDWLRQVLQFOXGLQJUDSLGLQWHUYHQWLRQDZDUHQHVVDQGRWKHU emergency situations. Folsom Lake College 2011-2012 Fire Technology 163 FT 303 BUILDING CONSTRUCTION FOR FIRE PROTECTION 3 UNITS FT 498 WORK EXPERIENCE IN FIRE TECHNOLOGY 1-4 UNITS Prerequisite: None. Prerequisite: None. Course Transferable to CSU Advisory: ENGWR 101 Hours: 54 hours LEC General Education: AA/AS Area III(b) This course addresses the components of building construction that relate to (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS WKHÀUHVHUYLFH6SHFLÀFIRFXVLVRQHOHPHQWVRIFRQVWUXFWLRQDQGWKHGHVLJQ YROXQWHHURSSRUWXQLW\RUMREUHODWHGWRÀUHWHFKQRORJ\6WXGHQWVDUHDGYLVHG of structures that are shown to be key factors when inspecting buildings, WRFRQVXOWZLWKWKH)LUH7HFKQRORJ\IDFXOW\WRUHYLHZVSHFLÀFFHUWLÀFDWHDQG SUHSODQQLQJÀUHRSHUDWLRQVDQGHPHUJHQF\RSHUDWLRQVDWÀUHV7RSLFVLQFOXGH degree work experience requirements. ZRRGPDVRQU\VWHHODQGFRQFUHWHFRQVWUXFWLRQSULQFLSOHVRIÀUHDQGVPRNH Course Transferable to CSU JURZWKDQGÀUHUHVLVWDQFHFRQVWUXFWLRQWKHUHODWLRQVKLSEHWZHHQEXLOGLQJ +RXUV KRXUV/$% types and Urban Search & Rescue Team capacity and Wildland/Urban Interface This course provides students with opportunities to develop marketable skills building requirements. in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; FT 304 FIRE BEHAVIOR AND COMBUSTION 3 UNITS completion of required forms, which document the student’s progress and hours Prerequisite: None. spent at the work site; and developing workplace skills and competencies. Course Transferable to CSU 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODQKRXU Hours: 54 hours LEC orientation and 75 hours of related paid work experience, or 60 hours of unpaid 7KLVFRXUVHH[SORUHVWKHWKHRULHVDQGIXQGDPHQWDOVRIKRZDQGZK\ÀUHVVWDUW work experience for one unit. An additional 75 or 60 hours of related work VSUHDGDQGDUHFRQWUROOHG7RSLFVLQFOXGHÀUHFKHPLVWU\DQGSK\VLFVFRPEXVWLRQ experience is required for each additional unit. The course may be taken again SURFHVVHVH[WLQJXLVKLQJDJHQWVKD]DUGRXVPDWHULDOVDQGÀUHFRQWUROVWUDWHJLHV when there is new or expanded learning on the job for a maximum of 16 units. and tactics in various environments. FT 310 FIRE SERVICE HYDRAULICS 3 UNITS Prerequisite: None. Advisory: FT 300 and MATH 30 Course Transferable to CSU Hours: 54 hours LEC This course covers the theory of water hydraulics, hydraulic distribution systems, K\GUDXOLFSUDFWLFHVDQGH[WLQJXLVKLQJDJHQWVXVHGZLWKÀUHVHUYLFHK\GUDXOLFV Additional topics include: the properties of water in rest and motion, water YHORFLW\DQGGLVFKDUJHGLVWULEXWLRQV\VWHPVÀUHVHUYLFHSXPSVIULFWLRQORVV FDOFXODWLRQVHQJLQHDQGQR]]OHSUHVVXUHVDQGÀUHVWUHDPV2WKHUWRSLFVZLOO focus on standpipe systems, automatic sprinkler systems, and foam systems. 7KLVFRXUVHLVDSDUWRIWKH)LUH7HFKQRORJ\FHUWLÀFDWH 164 French Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 French COUNSELING Rancho Cordova Center - 916-255-0717 Folsom Lake College offers the basic grammar and French (FREN) conversation courses in French. Students will be able to understand the spoken language, to speak with FREN 101 CONVERSATIONAL FRENCH, ELEMENTARY 3 UNITS UHDVRQDEOHÁXHQF\DQGWRZULWHDWWKHLUVSHDNLQJOHYHO Prerequisite: None Students will acquire a knowledge about geography, Hours: 36 hours LEC ; 54 hours LAB culture and people of regions where French is spoken. 7KLVLVDÀUVWVHPHVWHULQWURGXFWLRQWRWKH)UHQFKODQJXDJH,WLVGHVLJQHGIRU beginning students with little or no previous exposure to the language. It is Career Options characterized by an emerging ability to understand and produce appropriate Airlines/Travel; Banking; Bilingual Education/Teacher’s UHVSRQVHVLQKLJKIUHTXHQF\VLWXDWLRQVXWLOL]LQJOHDUQHGPDWHULDOV6SHDNLQJ Aide; Bilingual Telecommunications; Emergency Services; and writing will be comprehensible to a sympathetic listener. Verbal and Fashion and design; Foreign Language Teacher; Foreign written expression is limited to short, culturally appropriate communication. Service; Import & Export; Intelligence/Military Service; Students will acquire a knowledge of the geography, culture and people of International Business; International Law; IRS/State UHJLRQVZKHUH)UHQFKLVVSRNHQDQGRI)UHQFKVSHDNHUV·FRQWULEXWLRQVWR1RUWK Franchise Tax Board; Homeland Security; Overseas American and world cultures. This class consists of two hours lecture and one Employment: Business & Commerce; Pharmaceutical; hour of laboratory work conducted in the classroom each week and two hours 6RFLDO6HFXULW\2IÀFHU 6RFLDO6HUYLFH 6RIWZDUHDQG of laboratory work conducted in the Language Laboratory each week. computer science; Translating & Interpreting; Tourism FREN 102 CONVERSATIONAL FRENCH, ELEMENTARY 3 UNITS Some career options may require more than two years Prerequisite: FREN 101. Grade of “C” or better required to meet prerequisite. of college study. Hours: 36 hours LEC ; 54 hours LAB This is second semester Elementary French. It is designed for students who have Highlights FRPSOHWHG)5(1RUWZR\HDUVRIKLJKVFKRRO)UHQFK,WSURYLGHVUHÀQHPHQW Multimedia, interactive language lab with Internet of skills begun in 401. Students will gain increased accuracy and ability to capabilities understand and produce appropriate responses in high frequency situations Internationally trained faculty and staff utilizing learned materials. Speaking and writing will be comprehensible to a Native speaker faculty sympathetic listener. Verbal and written expression will be limited to short, culturally appropriate communication on a broader scale than at the 401 level. Native speakers who have high-school-equivalent Students will acquire a knowledge of the geography, culture and people of reading and writing skills in their native language should UHJLRQVZKHUH)UHQFKLVVSRNHQDQGRI)UHQFKVSHDNHUV·FRQWULEXWLRQVWR1RUWK enroll in the 411 level course (or above) of their native American and world cultures. This class will consist of two hours of lecture language. and one hour of laboratory work conducted in the classroom and two hours of laboratory work conducted in the Language Laboratory each week. Folsom Lake College 2011-2012 French 165 FREN 311 CONVERSATIONAL FRENCH, INTERMEDIATE 2 UNITS FREN 402 ELEMENTARY FRENCH 4 UNITS Prerequisite: None. Prerequisite: FREN 401 (with a grade of ‘C’ or better) or two years of high school General Education: CSU Area C2 French (with a grade of ‘C’ or better). Course Transferable to CSU General Education: AA/AS Area I; CSU Area C2; IGETC Area 6 Hours: 18 hours LEC ; 54 hours LAB Course Transferable to UC/CSU 7KLVFRXUVHSURYLGHVUHÀQHPHQWRIVNLOOVDWWDLQHGLQ6WXGHQWVZLOOZRUN Hours: 54 hours LEC ; 54 hours LAB toward the ability to create with the language without relying on learned 7KLVLVWKHVHFRQGVHPHVWHURIHOHPHQWDU\)UHQFK,WSURYLGHVUHÀQHPHQWRI responses, to understand main ideas in routine speech and to understand main skills introduced in FREN 401. It is characterized by increased grammatical ideas in written texts. Listening and reading comprehension continue to develop; accuracy and ability to understand and produce appropriate responses in speaking and writing will be comprehensible to a somewhat sympathetic KLJKIUHTXHQF\VLWXDWLRQVXWLOL]LQJOHDUQHGPDWHULDO6SHDNLQJDQGZULWLQJ native speaker. Students will develop the ability to respond in an unrehearsed will be comprehensible to a sympathetic listener used to communicating with manner to concrete topics in known situations. Written expression will meet QRQQDWLYHVSHDNHUV limited personal needs in culturally appropriate language at a fairly high level of accuracy, higher than found in 402. Students will continue acquisition of FREN 411 INTERMEDIATE FRENCH 4 UNITS knowledge of geography, culture and people of regions where French is spoken Prerequisite: FREN 402. Grade of “C” or better required to meet prerequisite. DQGRI)UHQFKVSHDNHUV·FRQWULEXWLRQVWR1RUWK$PHULFDQDQGZRUOGFXOWXUHV General Education: CSU Area C2; IGETC Area 3B; IGETC Area 6 This course will consist of one hour of lecture and two hours of laboratory Course Transferable to UC/CSU work conducted in the classroom each week and one hour of laboratory work Hours: 54 hours LEC ; 54 hours LAB conducted in the Language Laboratory each week. 7KLVLVÀUVWVHPHVWHU,QWHUPHGLDWH)UHQFK,WLVGHVLJQHGIRUVWXGHQWVZKRKDYH FRPSOHWHG)5(1RUWKUHH\HDUVRIKLJKVFKRRO)UHQFK,WSURYLGHVUHÀQHPHQW FREN 312 CONVERSATIONAL FRENCH, INTERMEDIATE 2 UNITS of skills attained in 402. Students will work toward the ability to create with Prerequisite: FREN 311 and 411. Grades of “C” or better required to meet the language without relying on learned responses, to understand main ideas prerequisite. in routine speech and to understand main ideas in written texts. Listening General Education: CSU Area C2 and reading comprehension continue to develop; speaking and writing will Course Transferable to CSU be comprehensible to a somewhat sympathetic native speaker. Students will Hours: 18 hours LEC ; 54 hours LAB develop the ability to respond in an unrehearsed manner on concrete topics This is second semester Intermediate French. It is designed for students who in known situations. Written expression will meet limited personal needs in have completed French 311 or four years of high school French. It provides culturally appropriate language at a higher level of accuracy than found in continued development of skills attained in 311. The focus will be on culturally 402. Students will continue acquisition of knowledge of geography, culture and authentic reading and writing through the introduction of basic literary analysis. SHRSOHRIUHJLRQVZKHUH)UHQFKLVVSRNHQDQGRI)UHQFKVSHDNHUV·FRQWULEXWLRQV Students will develop the ability to handle complicated situations using past to North American and world cultures. and future time frames. Students will continue acquisition of knowledge of JHRJUDSK\FXOWXUHDQGSHRSOHRIUHJLRQVZKHUH)UHQFKLVVSRNHQDQGRI)UHQFK FREN 412 INTERMEDIATE FRENCH 4 UNITS speakers’ contributions to North American and world cultures. This course will Prerequisite: FREN 411. Grade of “C” or better required to meet prerequisite. consist of one hour of lecture and two hours of laboratory work conducted in General Education: CSU Area C2; IGETC Area 3B; IGETC Area 6 the classroom each week and one hour of laboratory work conducted in the Course Transferable to UC/CSU Language Laboratory each week. Hours: 54 hours LEC ; 54 hours LAB This is second semester Intermediate French. It is designed for students who FREN 401 ELEMENTARY FRENCH 4 UNITS have completed FREN 411 or four years of high school French. It provides Prerequisite: None. continued development of skills attained in 411. The focus will be the General Education: AA/AS Area I; CSU Area C2; IGETC Area 6 development of written narratives and expository prose combined with Course Transferable to UC/CSU increased cultural awareness. Emphasis will be on culturally authentic reading Hours: 54 hours LEC ; 54 hours LAB and writing through the introduction of basic literary analysis. Students will 7KLVLVWKHÀUVWVHPHVWHULQWURGXFWLRQWRWKH)UHQFKODQJXDJH,WLVGHVLJQHGIRU develop the ability to handle complicated situations using past and future beginning students with little or no previous exposure to the language. It is time frames. Students will continue acquisition of knowledge of geography, characterized by the ability to understand and produce appropriate responses FXOWXUHDQGSHRSOHRIUHJLRQVZKHUH)UHQFKLVVSRNHQDQGRI)UHQFKVSHDNHUV· LQKLJKIUHTXHQF\VLWXDWLRQVXWLOL]LQJOHDUQHGPDWHULDO6SHDNLQJDQGZULWLQJ contributions to North American and world cultures. will be comprehensible to a sympathetic listener used to communicating with QRQQDWLYHVSHDNHUV 166 French Folsom Lake College 2011-2012 FREN 495 INDEPENDENT STUDIES IN FRENCH 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB FREN 499 EXPERIMENTAL OFFERING IN FRENCH .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 General Education Transfer 167 General Education ACADEMIC Folsom campus - 916-608-6510 El Dorado Center - 530-642-5645 Transfer COUNSELING Rancho Cordova Center - 916-255-0717 Gather and assess information from a variety of sources CERTIFICATES OF CSU General Education to inform decision-making in personal, social, academic, ACHIEVEMENT Intersegmental General or professional contexts. Education Transfer Curriculum (IGETC) CERTIFICATE OF ACHIEVEMENT Intersegmental General Education Transfer Curriculum CERTIFICATE OF ACHIEVEMENT ,*(7& &HUWLÀFDWH &68*HQHUDO(GXFDWLRQ&HUWLÀFDWH REQUIRED PROGRAM REQUIRED PROGRAM Students must complete a minimum of 34 units used to satisfy Students must complete a minimum of 39 units used to satisfy WKH,*(7&FHUWLÀFDWLRQUHTXLUHPHQWVZKLFKDUHOLVWHGLQWKH the CSU General Education requirements, which are listed in Folsom Lake College catalog. Students are encouraged to the Folsom Lake College catalog. Students are encouraged FRQVXOWZLWKDFRXQVHORULQVHOHFWLQJFRXUVHVXVHGWRIXOÀOO to consult with a counselor in choosing the courses used to the required program. IXOÀOOWKHUHTXLUHGSURJUDP 7KLV &HUWLÀFDWH RI $FKLHYHPHQW LV GHVLJQHG IRU VWXGHQWV 7KLV &HUWLÀFDWH RI $FKLHYHPHQW LV GHVLJQHG IRU VWXGHQWV planning to transfer to either a California State University planning to transfer to a California State University (CSU) or a University of California (UC) campus. Completion &68 FDPSXV&RPSOHWLRQRIWKLVFHUWLÀFDWHHQVXUHVWKDW RIWKLVFHUWLÀFDWHHQVXUHVWKDWDVWXGHQWKDVPHWWKHORZHU the student has met the lower division General Education division General Education/Breadth requirements for requirements for all CSU campuses. Please note that although all CSU and UC campuses. Please note that although REWDLQLQJWKLVFHUWLÀFDWHZLOOHQVXUHWKDWWKHUHTXLUHPHQWV REWDLQLQJWKLVFHUWLÀFDWHZLOOHQVXUHWKDWWKHUHTXLUHPHQWV IRU*(FHUWLÀFDWLRQDUHPHWVWXGHQWVQHHGLQJRIÀFLDO*( IRU*(FHUWLÀFDWLRQDUHPHWVWXGHQWVQHHGLQJRIÀFLDO*( FHUWLÀFDWLRQZLOOQHHGWRZRUNZLWKDFRXQVHORUWRFRPSOHWH FHUWLÀFDWLRQZLOOQHHGWRZRUNZLWKDFRXQVHORUWRFRPSOHWH the appropriate form. the appropriate form. Upon completion of this program, the student will be able to: Upon completion of this program, the student will be able to: Make sound decisions to improve personal and Make sound decisions to improve personal and environmental well-being through the analysis of HQYLURQPHQWDOZHOOEHLQJWKURXJKWKHDQDO\VLVRIVFLHQWLÀF VFLHQWLÀFLQIRUPDWLRQ information. Implement appropriate method of inquiry used by social Implement appropriate method of inquiry used by social and behavioral sciences. and behavioral sciences. Demonstrate civic responsibility as an informed citizen Demonstrate civic responsibility as an informed citizen knowledgeable about historical events, current issues, knowledgeable about historical events, current issues, and government structures relevant to community, state, and government structures relevant to community, state, national and global issues. national and global issues. Demonstrate an appreciation for and understanding Demonstrate an appreciation for and understanding of the complexity of artistic and cultural expression of the complexity of artistic and cultural expression through the ages by supporting the arts to enhance through the ages by supporting the arts to enhance our community. our community. Apply systematic methods of problem-solving, Apply systematic methods of problem-solving, comparative analysis, and creative decision-making in comparative analysis, and creative decision-making in RUGHUWRFRPPXQLFDWHHIIHFWLYHO\DQGHIÀFLHQWO\LQD RUGHUWRFRPPXQLFDWHHIIHFWLYHO\DQGHIÀFLHQWO\LQD variety of oral and written contexts. variety of oral and written contexts. 168 General Education Transfer Folsom Lake College 2011-2012 Requirements for the Associate in Arts for Requirements transfer (AA-T) or Associate in Science for The following is required for all AA-T or AS-T degrees: transfer (AS-T) 1. Minimum of 60 CSU-transferable semester units. The Student Transfer Achievement Reform Act (Senate Bill 2. Minimum grade point average (GPA) of at least 2.0 in QRZFRGLÀHGLQ&DOLIRUQLD(GXFDWLRQ&RGHVHFWLRQV all CSU-transferable coursework. While a minimum of 66746-66749) guarantees admission to a California 2.0 is required for admission, some majors may require State University (CSU) campus for any community college a higher GPA. Please consult with a counselor for more student who completes an “associate degree for transfer”, information. a newly established variation of the associate degrees 3. Completion of a minimum of 18 semester units in an traditionally offered at a California community college. “AA-T” or “AS-T” major will be detailed in the Courses, The Associate in Arts for Transfer (AA-T) or the Associate 'HJUHH DQG &HUWLÀFDWHV VHFWLRQ RI WKH FDWDORJ $OO in Science for Transfer (AS-T) is intended for students who courses in the major must be completed with a grade of plan to complete a bachelor’s degree in a similar major at C or better or a “P” if the course is taken on a “pass-no a CSU campus. Students completing these degrees (AA-T pass” basis (title 5 § 55063). or AS-T) are guaranteed admission to the CSU system, but not to a particular campus or major. In order to earn one 4. &HUWLÀHGFRPSOHWLRQRIWKH&DOLIRUQLD6WDWH8QLYHUVLW\ of these degrees, students must complete a minimum of 60 General Education-Breadth pattern (CSU GE required semester units of CSU-transferable coursework Breadth) (see page 32 for more information); OR the with a minimum GPA of 2.0. Students transferring to a CSU Intersegmental General Education Transfer Curriculum campus that does accept the AA-T or AS-T will be required (IGETC) pattern (see page 33 for more information). to complete no more than 60 units after transfer to earn a bachelor’s degree (unless the major is a designated “high- unit” major). This degree may not be the best option for students intending to transfer to a particular CSU campus or to a university or college that is not part of the CSU system. Students should consult with a counselor when planning to complete the degree for more information on university admission and transfer requirements. At the time of catalog publication, no FLC majors for the AA-T or AS-T have been approved. Majors are under development. For more information, please see a counselor DQGZZZÁFORVULRVHGXIRUPRUHLQIRUPDWLRQ Folsom Lake College 2011-2012 Geography 169 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Geography COUNSELING Rancho Cordova Center - 916-255-0717 Geography is the science of place and space. Geography (GEOG) Geographers study the relationships among geographic places, natural systems, society, cultural activities, and GEOG 300 PHYSICAL GEOGRAPHY: EXPLORING EARTH’S the interdependence of all these over space. ENVIRONMENTAL SYSTEMS 3 UNITS Prerequisite: None. There are two main branches of geography: human General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A geography and physical geography. Human geography Course Transferable to UC/CSU is concerned with the spatial aspects of human existence Hours: 54 hours LEC – how people and their activities are distributed in This course investigates the interrelationships between Earth and humans, with space, how people use and perceive space, and how an emphasis on natural systems (solar energy balance, weather and climate, people create and sustain the places that make up water resources, landforms, natural hazards, vegetation, and soil). Relevant Earth’s surface. Physical geographers study the physical application of these elements to today’s world is stressed to help students elements and spatial processes that make up and shape EHWWHUXQGHUVWDQG(DUWK·VSK\VLFDOHQYLURQPHQWDVZHOODVKXPDQHQYLURQPHQW the environment, including energy, air, water, weather, LQWHUDFWLRQ$ÀHOGWULSPD\EHUHTXLUHGWRUHODWHFODVVGLVFXVVLRQVWRWKHUHDO climate, landforms, soils, animals, plants, etc. world. Geographers also study the linkages between human GEOG 301 PHYSICAL GEOGRAPHY LABORATORY 1 UNIT activity and natural systems. Geographers were, in fact, Prerequisite: None. DPRQJWKHÀUVWVFLHQWLVWVWRVRXQGWKHDODUPWKDWKXPDQ Corequisite: GEOG 300 induced changes to the environment were beginning to General Education: CSU Area B3; IGETC Area 5A threaten the balance of life itself. Geographers today Course Transferable to UC/CSU DUHDFWLYHLQWKHVWXG\RIJOREDOZDUPLQJGHVHUWLÀFDWLRQ Hours: 54 hours LAB deforestation, loss of biodiversity, groundwater pollution, 7KLVFRXUVHSURYLGHV´KDQGVRQµVWXG\RIWKHEDVLFSULQFLSOHVDQGFRQFHSWV ÁRRGLQJDQGPRUH involved in understanding Earth’s physical environment. Lab topics include observation, measurement and analysis of Earth’s energy balance, weather The Folsom Lake College Geography program offers and climate, vegetation, landforms, and natural hazards, as well as topographic courses that satisfy lower division General Education map reading, interpretation, and navigation skills. requirements in both the physical and social sciences. Students planning to transfer to a four-year school with GEOG 306 WEATHER AND CLIMATE 3 UNITS a major in Geography should consult the lower division Prerequisite: None. requirements at the university they plan to attend. General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A Course Transferable to UC/CSU Career Options Hours: 54 hours LEC International Development; Natural Resource Management; This course is an introduction to atmospheric processes including energy and Environmental Consultant; Urban and regional moisture exchanges, atmospheric pressure, winds, and global circulation. Severe planning; Educator (elementary through University); weather conditions such as hurricanes and tornadoes are also studied. World, Tourism; Cartographer; Climatologist; Park Ranger; regional, and local climates are investigated. Student work will include weather Transportation Specialist; Real Estate Analyst; International observations and analysis of atmospheric data using charts, weather maps and Business; Marketing Analyst; Land Surveyor; Research radar and satellite imagery from the Internet and other sources. Because this Scientist; Remote Sensing Specialist and Demographer. course involves the use of some quantitative concepts, students are encouraged to have fundamental algebraic skills prior to enrolling in the course. Some career options may require more than two years of college study. Highlights Comprehensive course offerings including a Physical Laboratory. Field study courses to Yosemite, Pt. Reyes, Monterey/Big Sur, and the Mt. Diablo area. 170 Geography Folsom Lake College 2011-2012 GEOG 310 HUMAN GEOGRAPHY: EXPLORING EARTH’S GEOG 390 FIELD STUDIES IN GEOGRAPHY .5-4 UNITS CULTURAL LANDSCAPES 3 UNITS Prerequisite: None. Prerequisite: None. Advisory: GEOG 300 General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D5; IGETC Area 4E Course Transferable to CSU Course Transferable to UC/CSU Hours: 24 hours LEC ; 144 hours LAB Hours: 54 hours LEC 7KLVFRXUVHFRYHUVWKHÀHOGVWXG\RIJHRJUDSKLFSULQFLSOHVDQGSURFHVVHVRI This course investigates the diverse patterns of human settlement, VSHFLÀFDUHDV PRXQWDLQVGHVHUWVVHDVKRUHHWF &RXUVHFRQWHQWZLOOYDU\ development, and movement on earth, which evolved as a result of cultural and by destination. Topics may include physical geography, human geography, environmental factors. Emphasis is placed on understanding global population and/or geographic techniques such as the application of tools and techniques and migration patterns, language, religion, ethnicity, political and economic XVHGIRUJHRJUDSKLFÀHOGUHVHDUFK HJPDSDQGFRPSDVVXVHWKH*OREDO systems, development issues, agriculture and urbanization. Positioning System (GPS), Geographic Information Systems (GIS), etc.). Field WULS V DUHUHTXLUHG)RUVSHFLÀFGHWDLOVVHHWKHFRXUVHGHVFULSWLRQOLVWHGLQ GEOG 330 INTRODUCTION TO GEOGRAPHIC INFORMATION the schedule. Students will be responsible for providing their own lodging (or SYSTEMS 3 UNITS camping equipment) and meals. At a minimum it is recommended that students Prerequisite: None. EHSUHSDUHGWRVSHQGDIXOOGD\LQWKHÀHOG7KLVPD\UHTXLUHDGD\SDFNZDWHU Advisory: CISC 300 FRQWDLQHU V IRRGIRXOZHDWKHUJHDUÀHOGQRWHERRNFOLSERDUGZKLVWOHDQG General Education: AA/AS Area II(b) personal safety gear (warm clothing, medications, cell phone, GPS, sunscreen, Course Transferable to UC/CSU sunglasses, hiking shoes, and a hat). Hours: 54 hours LEC $*HRJUDSKLF,QIRUPDWLRQ6\VWHP *,6 LVDFRPSXWHUEDVHGGDWDSURFHVVLQJWRRO GEOG 495 INDEPENDENT STUDIES IN GEOGRAPHY 1-3 UNITS used to manage and analyze spatial information. Applications of GIS include Prerequisite: None environmental assessment, analysis of natural hazards, management of Course Transferable to CSU municipal networks, business and industry site analysis, resource management Hours: 18 hours LEC ; 54 hours LAB DQGODQGXVHSODQQLQJ7KLVFRXUVHLQWURGXFHVWKHFRQFHSWVWHFKQLTXHVDQG GEOG 499 EXPERIMENTAL OFFERING IN GEOGRAPHY .5-4 UNITS tools of GIS including spatial data capture, management and analysis, as well Prerequisite: None DVFDUWRJUDSKLFRXWSXWWKURXJKKDQGVRQH[SHULHQFHXVLQJ*,6VRIWZDUH Course Transferable to CSU GEOG 332.1 INTRODUCTION TO DESKTOP GIS 1.5 UNITS Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None. Course Transferable to CSU Hours: 27 hours LEC This course introduces students to Geographic Information Systems (GIS) which are systems of computers and people used to integrate spatial data in order to make a decision. Topics may include analysis of environmental, economic, political, social, health care, and transportation data. Using desktop GIS software (such as ArcView) students will learn GIS skills including identifying zones, measuring distances, calculating areas, integrating spatial data and displaying output. This course will also cover basic software functionality, database FRQVWUXFWLRQDQGPDQDJHPHQW7KLVFRXUVHLVWKHÀUVWRIDWZRSDUWVHULHV This course may be taken four times on a different software package or version. GEOG 332.2 INTERMEDIATE DESKTOP GIS 1.5 UNITS Prerequisite: GEOG 332.1 with a grade of “C” or better Advisory: CISC 300 Course Transferable to CSU Hours: 27 hours LEC *HRJUDSKLF,QIRUPDWLRQ6\VWHPV *,6 DUHFRPSXWHUEDVHGPDSSLQJSURJUDPV that analyze spatial data. This course builds on the conceptual and practical foundations covered in GEOG 332.1 by further exploring the capabilities and functionality of desktop GIS software. Emphasis will be placed on GIS software functionality, address geocoding, beginning spatial database construction, spatial data management, spatial analysis, and cartographic presentation. This course may be taken four times on a different software package or version. Folsom Lake College 2011-2012 Geology 171 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Geology COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE DEGREE A.S. - Geology A.S. — Geology Geology is the study of the origin and evolution of the REQUIRED PROGRAM ...... Units earth, utilizing the principles of mathematics, chemistry, CHEM 400 General Chemistry ...... 5 physics and biology. The concept of geologic time and CHEM 401 General Chemistry ...... 5 the principles of uniformitarianism help geologists to GEOL 300 Physical Geology ...... 3 understand the processes that shape the earth and its GEOL 301 Physical Geology Laboratory ...... 1 environments. Geologists study rocks, minerals and fossils GEOL 310 Historical Geology ...... 3 in an effort to draw conclusions about both the earth’s GEOL 311 Historical Geology Laboratory ...... 1 observable surface processes that meet the eye, and MATH 400 Calculus I ...... 5 the earth’s interior. MATH 401 Calculus II ...... 5 TOTAL UNITS REQUIRED ...... 28 Many of the Folsom Lake College Geology courses satisfy lower division General Education requirements This A.S. degree may be obtained by completion of the for the A.A., A.S., B.A., and B.S. degrees. Geology majors Required Program, plus General Education Requirements, planning to Transfer to four-year institutions should see SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO a counselor. This degree is designed to meet common lower division Career Options requirements for a major in geology. Geologist (for private industry or the government); Environmental planner or consultant; Earth Science Upon completion of this program, the student will be able to: Educator (middle school through university); Paleontologist; 'HPRQVWUDWHXQGHUVWDQGLQJRIWKHVFLHQWLÀFPHWKRGE\ Petrologist; Natural Resource Management; GHVLJQLQJDYDOLGVFLHQWLÀFLQTXLU\ Cartographer/Stratigrapher; Park Naturalist 'LIIHUHQWLDWHEHWZHHQVFLHQWLÀFDOO\GHULYHGNQRZOHGJH myth, and conjecture in professional or everyday Some career options may require more than two years encounters with information. of college study. Apply acquired knowledge, skills, and abilities toward successful completion of geology coursework at transfer Highlights institutions. Lower division course offerings, including a Physical Observe and accurately interpret the mechanics, rate Laboratory, Mineral Laboratory and Field Courses and scale of simple geologic processes. Dynamic geologic environment near the Sierra Clearly communicate geologic information, both orally Nevada, San Andreas Fault, Mono Lake, Death and in written form, to diverse audiences. Valley, and Central California Coastal areas Evaluate and analyze contemporary geologic problems including the implications of human activities on geologic resources. Accurately employ geologic terminology, earth development theories and techniques as a foundation IRULQYHVWLJDWLQJPRUHFRPSOH[VFLHQWLÀFPDWWHUV 172 Geology Folsom Lake College 2011-2012 GEOL 306 EARTH SCIENCE LABORATORY 1 UNIT Geology (GEOL) Prerequisite: None. Corequisite: GEOL 305; (or may be taken previously) GEOL 299 EXPERIMENTAL OFFERING IN GEOLOGY .5-4 UNITS General Education: CSU Area B3; IGETC Area 5A Prerequisite: None Course Transferable to UC/CSU Hours: 54 hours LEC ; 108 hours LAB Hours: 54 hours LAB GEOL 300 PHYSICAL GEOLOGY 3 UNITS 7KLVFRXUVHHPSKDVL]HVWKHVFLHQWLÀFPHWKRGVDQGV\VWHPDWLFODERUDWRU\ Prerequisite: None. procedures of Earth sciences. Topics include weather analysis, rock and Advisory: GEOL 301; (or concurrent enrollment in GEOL 301) PLQHUDOLGHQWLÀFDWLRQVWXG\RIJHRORJLFFRQFHSWVE\PHDQVRIWRSRJUDSKLF General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A maps, astronomical observation and ocean dynamics. A field trip or an Course Transferable to UC/CSU appropriate alternative activity will be required as an introduction to geological Hours: 54 hours LEC HQYLURQPHQWVDQGÀHOGPHWKRGVLQJHRORJ\1RWRSHQWRVWXGHQWVZKRKDYH Physical geology is an introduction to the composition and dynamics of the received credit for GEOL 300 or GEOL 301. Earth from the atomic scale of minerals to the global scale of plate tectonics. Topics include the composition of minerals and rock, volcanism, earth structures, GEOL 310 HISTORICAL GEOLOGY 3 UNITS earthquakes, erosion and surface processes, geologic time, geologic hazards, Prerequisite: None. and plate tectonics. In this course, attention will focus on the rocks, landscapes, Advisory: An introductory geology or earth science course. and scenic areas of the American West. Emphasis is placed on how humans General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A affect the environment. Successful completion of physical geology prepares the Course Transferable to UC/CSU student to recognize, understand, and appreciate processes which continually Hours: 54 hours LEC change our Earth. This course covers the origin and geologic history of the Earth and the evolution of its plant and animal inhabitants. Plate tectonic theory is used GEOL 301 PHYSICAL GEOLOGY LABORATORY 1 UNIT to explain changes in composition and structure of rocks of the Earth’s crust Prerequisite: None. from the formation of the Earth to the present. Emphasis is placed on the Corequisite: GEOL 300; (or may be taken previously) formation of sedimentary rocks for the purpose of understanding how they General Education: CSU Area B3; IGETC Area 5A and the fossils contained within them record changes in earth environment Course Transferable to UC/CSU and processes. Evolution and extinction are studied to understand how they Hours: 54 hours LAB UHÁHFWHQYLURQPHQWDOFKDQJHVLQWKHHDUWK·VRFHDQDWPRVSKHUHDQGVXUIDFH This course provides laboratory experience with the tools and skills discussed in 3K\VLFDO*HRORJ\ *(2/ /DEWRSLFVLQFOXGHPLQHUDODQGURFNLGHQWLÀFDWLRQ GEOL 311 HISTORICAL GEOLOGY LABORATORY 1 UNIT PDSDQGDLUSKRWRJUDSKLQWHUSUHWDWLRQDQGODQGIRUPLGHQWLÀFDWLRQDQGWKH Prerequisite: None. VWXG\DQGLQWHUSUHWDWLRQRIJHRORJLFPDSVDQGFURVVVHFWLRQV Corequisite: GEOL 310 (may be taken previously). Advisory: GEOL 300 GEOL 305 EARTH SCIENCE 3 UNITS General Education: CSU Area B3; IGETC Area 5A Prerequisite: None. Course Transferable to UC/CSU Corequisite: GEOL 306 Hours: 54 hours LAB General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A Laboratory studies will accompany and complement GEOL 310, Historical Course Transferable to UC/CSU Geology. Use of sedimentary rocks, fossils, geologic maps, and cross sections Hours: 54 hours LEC will aid in interpreting ancient environments, tectonic settings, and geologic This course is an introductory course covering major topics in geology, history. Other concepts addressed include age relations and correlation of rock RFHDQRJUDSK\PHWHURORJ\DVWURQRP\VFLHQWLÀFPHWKRGDQGSKLORVRSK\RI DQGWLPHXQLWVDQGLQWURGXFWLRQWRIRVVLOLGHQWLÀFDWLRQDQGELRVWUDWLJUDSK\$W VFLHQFH7KLVFRXUVHLVGHVLJQHGIRUQRQVFLHQFHPDMRUV1RWRSHQWRVWXGHQWV OHDVWRQHÀHOGWULSRUDQDSSURSULDWHDOWHUQDWLYHDFWLYLW\ZLOOEHUHTXLUHGDV who have received credit for GEOL 300 or GEOL 310. DQLQWURGXFWLRQWRVHGLPHQWDU\HQYLURQPHQWVDQGÀHOGPHWKRGVLQJHRORJ\ Folsom Lake College 2011-2012 Geology 173 GEOL 330 INTRODUCTION TO OCEANOGRAPHY 3 UNITS GEOL 351 INTRODUCTION TO MINERALOGY 3 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A Advisory: An introductory geology course and an elementary chemistry Course Transferable to UC/CSU course. Hours: 54 hours LEC General Education: AA/AS Area IV; CSU Area B1; CSU Area B3 The course will provide an introduction to the basic principles and practices Course Transferable to CSU of oceanography. Topics will be presented in terms of the applications of Hours: 36 hours LEC ; 54 hours LAB physics, geology, chemistry, and biology to a study of the world’s oceans. The properties, relationships and origins of minerals, crystallography and 6SHFLÀFWRSLFVZLOOLQFOXGHSODQHWDU\VFLHQFHDQGHDUWKRULJLQWKHJHRORJLF determinative mineralogy; economic importance of minerals in California and timescale, geography and location systems, matter, marine provinces, sediments, RQDZRUOGZLGHEDVLV seismology, plate tectonics, seawater composition, geochemical distributions, deep ocean circulations, winds and surface circulation, waves, tides, estuarine GEOL 390 FIELD STUDIES IN GEOLOGY .5-4 UNITS environment, biological production, necton, plankton, and benthic organisms. Prerequisite: GEOL 300 with a grade of “C” or better Field trips may be required. Course Transferable to UC/CSU Hours: 40 hours LEC ; 100 hours LAB GEOL 342 GEOLOGY OF THE NATIONAL PARKS 3 UNITS 7KLVFRXUVHLQYROYHVWKHVWXG\RIJHRORJLFSULQFLSOHVDQGSURFHVVHVRIVSHFLÀF Prerequisite: None. regions (mountains, deserts, great valley, coastal region, etc.). Course content General Education: AA/AS Area IV; CSU Area B1 YDULHVDFFRUGLQJWRÀHOGWULSGHVWLQDWLRQEXWPD\LQFOXGHWRSLFVLQSK\VLFDO Course Transferable to UC/CSU geology, environmental geology, economic geology, and/or introduction to Hours: 54 hours LEC WRROVDQGWHFKQLTXHVXVHGIRU*HRVFLHQFHÀHOGUHVHDUFK HJPDSDQGFRPSDVV This course introduces students to Earth’s geologic story as revealed by the Global Positioning System (GPS), Geographic Information Systems (GIS), etc.). For rocks and landscapes in our State and National parklands. Attention will focus VSHFLÀFGHWDLOVVHHWKHFRXUVHWRSLFGHVFULSWLRQ V OLVWHGLQWKHVFKHGXOH)LHOG on how natural Earth processes have formed our State and National parklands. excursions are required and students will be responsible for providing their This course addresses surface shaping processes such as volcanism, plutonism, own lodging (or camping equipment) and meals. This course may be repeated GHIRUPDWLRQVHGLPHQWDWLRQJODFLDWLRQDQGÁXYLDODFWLYLW\DVGLVSOD\HGLQRXU up to four times under a new topic or destination. parks and monuments. GEOL 495 INDEPENDENT STUDIES IN GEOLOGY 1-3 UNITS GEOL 345 GEOLOGY OF CALIFORNIA 3 UNITS Prerequisite: None Prerequisite: None. Course Transferable to CSU General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A Hours: 18 hours LEC ; 54 hours LAB Course Transferable to UC/CSU GEOL 499 EXPERIMENTAL OFFERING IN GEOLOGY .5-4 UNITS Hours: 54 hours LEC Prerequisite: None This course provides a survey of the physical and historical aspects of California Course Transferable to CSU geology, emphasizing the linkage of geology and people through economic Hours: 18 hours LEC ; 54 hours LAB DQGVRFLDOLPSDFWV7KLVFRXUVHLVUHFRPPHQGHGIRUQRQPDMRUVDQGPDMRUV in geology and is of particular value to science, engineering, environmental studies, education, and economics majors. Field trips will be combined with lectures. GEOL 347 GEOLOGIC MINING HISTORY OF THE MOTHER LODE 3 UNITS Prerequisite: None. Advisory: GEOL 300 Course Transferable to CSU Hours: 54 hours LEC This is an introductory course covering the mining and geologic history of California’s Mother Lode region. Emphasis is on understanding the formation of the area’s gold deposits, understanding past and present mining methods, and understanding the legacy left by the early miners. 174 Graphic Communication Folsom Lake College 2011-2012 Graphic ACADEMIC Folsom campus - 916-608-6510 El Dorado Center - 530-642-5645 COUNSELING Communication Rancho Cordova Center - 916-255-0717 Upon completion of this program, the student will be able to: CERTIFICATE OF RECOGNITION Apply a variety of design principles and elements of Web/Graphics Production art by using various art materials and techniques to complete class projects and compositions. The Folsom Lake College Graphic Communication Critically evaluate historical and contemporary art work program combines artistic and design principles with and create a portfolio based on class projects both for technical knowledge, and provides students with instruction print and for the Web. in computer graphic and Web design skills. Students Create images for print and the Web using good learn concepts and principles of information design and visual design concepts and manipulate those images delivery, as well as graphic design and production, using using standard techniques for selecting, compositing, industry-standard software programs and practices, and transforming; painting, masking, blending, shading, employ these skills and concepts in the development and ÀOWHULQJOD\HULQJDQGLQFRUSRUDWLQJWH[W production of content for print and the Web. /LVWDQGGHVFULEHYDULRXVJUDSKLFDQGGLJLWDOÀOHIRUPDWV Create and save images for print or the Web; upload Career Options web pages to a web server. The Graphic Communication program will prepare students for an entry-level position working as a web designer, production artist, or web author in a variety RIÀHOGV Graphic Communication (GCOM) GCOM 330 DIGITAL IMAGING 1 3 UNITS Prerequisite: None. CERTIFICATE OF RECOGNITION Advisory: CISC 300 Web/Graphics Production Course Transferable to CSU Hours: 45 hours LEC ; 27 hours LAB REQUIRED PROGRAM ...... Units %HJLQQLQJ3KRWRVKRSLVGHVLJQHGIRUÀUVWWLPHXVHUVRI$GREH3KRWRVKRS ART 320 Design: Fundamentals ...... 3 Photoshop is an image editing program that allows the student to create original GCOM 330 Beginning Photoshop ...... 3 artwork and to enhance or change digital photographs and scanned artwork. GCOM 361 Creative Web Design ...... 3 Topics include the Photoshop interface, using the toolbox and palettes, image A minimum of 3 units from the following: HGLWLQJSKRWRUHWRXFKLQJDQGZRUNLQJZLWKOD\HUVPDVNVDQGÀOWHUV7KLVFRXUVH CISW 300 Web Publishing (3) can be taken twice for credit on new versions of the software. GCOM 340 Beginning Adobe Illustrator (3) TOTAL UNITS REQUIRED ...... 12 GCOM 340 DIGITAL ILLUSTRATION FOR GRAPHIC DESIGN 1 3 UNITS Web/Graphics Production involves the production of graphics Prerequisite: CISC 300 or 308 with a grade of “C” or better for print and the web. Students in the program learn industry- Advisory: CISA 308 VWDQGDUGWRROVXVHGLQWKH:HEDQG*UDSKLF'HVLJQÀHOGV Course Transferable to CSU and gain an understanding of the techniques, principles, Hours: 45 hours LEC ; 27 hours LAB and technical issues related to the production of graphics In this course, students are introduced to Illustrator’s drawing tools and how DQGZHEFRQWHQW7KHFHUWLÀFDWHVKRXOGSUHSDUHVWXGHQWVIRU to effectively use them for graphic design, print and web applications. Topics an entry-level position working as a production artist or a include the Illustrator work area, making selections, creating basic shapes, JUDSKLFDVVLVWDQWLQDJUDSKLFGHVLJQRUZHEUHODWHGÀHOG painting, drawing straight lines, drawing curves, live tracing over a placed image, creating symmetrical drawings, working with layers and working with type. This course also provides professional tips and techniques in Illustrator. Students are exposed to a variety of different illustrations styles and learn about the current trends. Folsom Lake College 2011-2012 Graphic Communication 175 GCOM 361 BEGINNING CREATIVE WEB DESIGN 3 UNITS Prerequisite: GCOM 330 or 340 with a grade of “C” or better Course Transferable to CSU Hours: 36 hours LEC In this course, students will explore a range of approaches in designing for WKH:RUOG:LGH:HEZKLOHLQWURGXFLQJVWXGHQWVWRDQLQGXVWU\VWDQGDUG:HE authoring tool. Through a series of incremental assignments, students will H[SORUHIXQGDPHQWDO:HEGHVLJQFRQFHSWVZLWKLQDQRQVWDWLFQRQOLQHDU environment, culminating in the development of a live and functioning website. $GGLWLRQDOO\WKLVFRXUVHSURYLGHVDQRYHUYLHZRIVWDQGDUGVFRPSOLDQW+70/ CSS, techniques for adding interactivity, accessibility, and support in preparing graphics for Web use and for prototyping site designs. GCOM 363 ADVANCED CREATIVE WEB DESIGN (ADOBE FLASH) 3 UNITS Prerequisite: None. Course Transferable to CSU Hours: 54 hours LEC 7KLVLVDQLQGHSWKFRXUVHFRYHULQJDGYDQFHGZHESDJHGHVLJQDQGDQLPDWLRQ using Adobe Flash. It is designed for students to enhance their web page building WHFKQLTXHV7RSLFVLQFOXGHRYHUYLHZRIZHEDQLPDWLRQJUDSKLFGHVLJQIUDPHE\ frame animations, motion and shape tweening, controlling animations through EDVLFVFULSWLQJODQJXDJHSHUIRUPDQFHFURVVSODWIRUPDQGGHVLJQLVVXHV 176 Health Education Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Health Education COUNSELING Rancho Cordova Center - 916-255-0717 HEED 314 COMMUNITY FIRST AID AND SAFETY 2 UNITS The Health Education Program at Folsom Lake College Prerequisite: None. KDVEHHQGHYHORSHGZLWKWZRJRDOVLQPLQG7KHÀUVWLV General Education: AA/AS Area III(b) to identify the health education needs of local businesses, Course Transferable to UC/CSU organizations, and individuals in the community. The Hours: 36 hours LEC second is to develop the innovative and informative 7KLVFRXUVHLQFOXGHVSURFHGXUHVLQDGXOWLQIDQWDQGFKLOG&35 &DUGLRSXOPRQDU\ courses that are necessary to meet the diverse Health UHVXVFLWDWLRQ $OVRLQFOXGHGDUHFKRNHUHVFXHDQGKRZWRUHFRJQL]HV\PSWRPV Education needs of the community. of a heart attack. Students will learn how to safely operate an AED (Automated ([WHUQDO'HÀEULOODWRU $OVRFRYHUHGZLOOEHSURFHGXUHVLQ)LUVW$LGVXFKDVKRZ +HDOWK6FLHQFH +((' IXOÀOOVDSRUWLRQRIWKH*HQHUDO to deal with cuts, bruises, bone/muscle injuries, shock, bleeding and other Education graduation requirement for Living Skills and ÀUVWDLGHPHUJHQFLHV7KHVHLQVWUXFWLRQDOPHWKRGVDQGWHFKQLTXHVPHHWWKH is transferable to all four-year colleges and universities. UHTXLUHPHQWVIURPWKH$PHULFDQ5HG&URVVIRUFHUWLÀFDWLRQLQDGXOWLQIDQWDQG Students who successfully complete HEED 314 or 320 child CPR, AED operation, and Standard First Aid. Students must purchase face ZLOOHDUQ$PHULFDQ5HG&URVVFHUWLÀFDWHVLQDUHDVVXFK masks for work on mannequins. This course is recommended for lifeguards, ski as Standard First Aid, or adult, child, and infant CPR. patrol, recreation workers, and teachers. Students successfully completing the HEED 350 was developed to give the student the tools FRXUVHDQGTXDOLI\LQJWHVWVDUHLVVXHG$PHULFDQ5HG&URVVFHUWLÀFDWHVLQDGXOW needed to develop personal wellness programs that FKLOGDQGLQIDQW&35$('DQG6WDQGDUG)LUVW$LG7KLVFHUWLÀFDWLRQLVYDOLGIRURQH will help address any physical or psychological health year after the completion date. This course may be taken four times for credit. concerns individuals may have. HEED 320 CPR: BLS FOR THE PROFESSIONAL RESCUER 2 UNITS The Health Education program at Folsom Lake College is Prerequisite: None. a diverse and constantly evolving program, designed to Course Transferable to CSU keep pace with an equally diverse and growing community. Hours: 36 hours LEC &DUGLR3XOPRQDU\5HVXVFLWDWLRQ &35 %DVLF/LIH6XSSRUW %/6 IRUWKH Professional Rescuer is designed to meet the special needs of the people who are expected to respond in emergency situations. Included are methods for Health Education (HEED) DGXOWFKLOGDQGLQIDQW&35DVZHOODVSHUIRUPLQJWZRUHVFXHU&35RSHUDWLQJ DQDXWRPDWHGH[WHUQDOGHÀEULOODWRU $(' DQGXVLQJUHVFXHEUHDWKLQJGHYLFHV HEED 300 HEALTH SCIENCE 3 UNITS Students will learn the skills a professional rescuer needs to act as a crucial link Prerequisite: None. in the emergency medical services (EMS) system. Satisfactory completion of this General Education: AA/AS Area III(b); CSU Area E1 FRXUVHUHVXOWVLQDQ$PHULFDQ5HG&URVV&HUWLÀFDWHLQ&35IRUWKH3URIHVVLRQDO Course Transferable to UC/CSU Rescuer. This course may be taken four times for credit. Hours: 54 hours LEC This course is designed to help students achieve a high level of health and HEED 350 PERSONAL WELLNESS 3 UNITS prevent disease by assisting them to maximize both their personal lifestyles Prerequisite: None. and their environments. This course will help students identify various factors General Education: AA/AS Area III(b); CSU Area E1 LQÁXHQFLQJFXUUHQWDQGIXWXUHOHYHOVRIKHDOWK$GGLWLRQDOLQIRUPDWLRQLQFOXGHV Course Transferable to CSU PHQWDOKHDOWKVWUHVVPDQDJHPHQWQXWULWLRQZHLJKWFRQWUROÀWQHVVVH[XDOLW\ Hours: 54 hours LEC addictive substances, and disease. This course takes a personal approach to lifetime healthy habits. Students ZLOOUHODWHWKHLURZQOLYHVWRWRSLFVWKDWLQFOXGH ÀWQHVVZHLJKWPDQDJHPHQW relationships, nutrition, stress management, sexual health, risky behaviors, and prevention of diseases. HEED 495 INDEPENDENT STUDIES IN HEALTH EDUCATION 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Health Education 177 HEED 499 EXPERIMENTAL OFFERING IN HEALTH ED .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 178 History Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 History COUNSELING Rancho Cordova Center - 916-255-0717 HIST 308 HISTORY OF WORLD CIVILIZATIONS, 1500 TO This Folsom Lake College program offers a study of PRESENT 3 UNITS history that contributes to cultural literacy and develops Prerequisite: None. critical thinking and other useful skills while helping Advisory: ENGWR 101; or eligible for ENGWR 300 students understand today and plan for tomorrow. General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area C2; CSU Area D6; IGETC Area 3B; IGETC Area 4F Career Options Course Transferable to UC/CSU Administrator; Archivist; Business Consultant; Foreign Hours: 54 hours LEC Service; Government Service; Historian; Journalist; This course is a survey of the development of the major civilizations of the Librarian, Museum Curator; Pre-Law/Lawyer; world from the 16th century to the present, with particular emphasis on the Researcher/Research Analyst; State Park Historian; dynamic interaction of peoples and cultures. The focus is on the role played Teacher; Writer by social, political, economic, cultural and religious forces in shaping the major world civilizations and the legacy of these civilizations within the world today. Some career options may require more than two years of college study. HIST 312 HISTORY OF THE UNITED STATES (TO 1865) 3 UNITS Prerequisite: None. Highlights Advisory: ENGWR 101 or eligibility for ENGWR 300 Overview of World Civilization and American General Education: AA/AS Area V(a); CSU Area D6; CSU Area F1; CSU Area F2; History, Women in American History IGETC Area 4F Study Abroad in such locations as London, Paris, Course Transferable to UC/CSU Florence and Salamanca Hours: 54 hours LEC Faculty includes widely traveled scholars, authors 7KLVFRXUVHSRUWUD\VWKHJURZWKRIWKHKLVWRU\RI$PHULFDIURPWKHSUH and active historians Columbian period to 1865. It focuses on its institutions and ideals, examining the decisions and developments that shaped our national heritage. The U.S. Constitution and the establishment of American government institutions are History (HIST) also covered. HIST 307 HISTORY OF WORLD CIVILIZATIONS TO 1500 3 UNITS HIST 313 HISTORY OF THE UNITED STATES (1865-1945) 3 UNITS Prerequisite: None. Prerequisite: None. Advisory: ENGWR 101; or eligibility for ENGWR 300 Advisory: ENGWR 101 or eligibility for ENGWR 300 General Education: AA/AS Area V(b); CSU Area C2; CSU Area D6; IGETC Area 3B; General Education: AA/AS Area V(a); CSU Area D6; CSU Area F1; CSU Area F3; IGETC Area 4F IGETC Area 4F Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course is a survey of the development of world civilizations from antiquity This course portrays America’s development from the period of Reconstruction to 1500CE, with particular emphasis on the dynamic interaction and comparison following the Civil War in 1865 through the end of the Second World War in of peoples and cultures. The focus is on the roles played by social, political, H[DPLQLQJWKHVLJQLÀFDQWLGHDOVGHFLVLRQVIRUFHVLQVWLWXWLRQVLQGLYLGXDOV economic, cultural and religious forces in shaping the major world civilizations events, and processes that affected continuity and change during this time. and the legacy of these civilizations within the world today. Coverage also includes California state and local government. Folsom Lake College 2011-2012 History 179 HIST 314 RECENT UNITED STATES HISTORY 3 UNITS HIST 344 SURVEY OF CALIFORNIA HISTORY: A MULTICULTURAL Prerequisite: None. PERSPECTIVE 3 UNITS Advisory: ENGWR 101 or eligibility for ENGWR 300 Prerequisite: None. General Education: AA/AS Area V(a); CSU Area D6; CSU Area F1; CSU Area F3; General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D6; IGETC Area 4F IGETC Area 4F Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course is a general historical survey of the social, political and economic This course reviews those events that constitute our country’s history from 1945 developments of California from its origin to the present time. Emphasis is to the present, ensuing against the background of a “world setting.” While the SODFHGRQWKHVWDWH·VPXOWLFXOWXUDOKHULWDJHDQGRQVLJQLÀFDQWORFDOKLVWRU\ emphasis tends to be on political developments, the course also covers broad economic, social, and cultural patterns. It includes coverage of California state HIST 390 HISTORY FIELD STUDY .5-4 UNITS and local government. Prerequisite: None Course Transferable to CSU HIST 319 AMERICAN ENVIRONMENTAL HISTORY 3 UNITS Hours: 12 hours LEC ; 18 hours LAB Prerequisite: None. 7KLVFRXUVHSURYLGHVDQRSSRUWXQLW\IRUÀUVWKDQGREVHUYDWLRQRIDYDULHW\RI General Education: CSU Area D6; IGETC Area 4F historic and prehistoric sites in the Sacramento and Sierra Nevada foothills Course Transferable to UC/CSU environment, as well as an examination of museum collections and presentation Hours: 54 hours LEC techniques of historical and cultural materials. Depending on availability, This course examines the past interactions between human society and the it includes visits to active excavation, preservation, and/or restoration natural world in what is now the United States. Issues to be discussed include projects. This class is ideal for social science majors, future teachers, park Native American resource management, the ecological effects of the arrival service personnel, heritage resource volunteers, and those interested in the of Europeans in the “New World”, resource exploitation in the industrial era, LQWHUSUHWDWLRQÀHOG cultural constructions of nature, and the preservation, conservation, and HQYLURQPHQWDOPRYHPHQWV,QWKHFRQWH[WRIWKHKLVWRULFDOLQÁXHQFHRIQDWXUH HIST 392 PRINCIPLES OF HERITAGE INTERPRETATION 3 UNITS upon human society and the impact of human society upon nature, the course Same As: ANTH 392 and BIOL 392 FRYHUVEURDGSROLWLFDOVRFLDODQGFXOWXUDOSDWWHUQVDQGFRQÁLFWV,QWKHVDPH Prerequisite: None. context, it also includes multicultural interpretations of the California and Sierra Course Transferable to CSU 1HYDGDIRRWKLOOH[SHULHQFHZKLFKPD\HQWDLOÀHOGWULSV Hours: 54 hours LEC This interdisciplinary course covers the basics of interpreting historical, cultural, HIST 331 WOMEN IN AMERICAN HISTORY 3 UNITS and natural resources to the general public. Interpretation is a communication Prerequisite: None. process that forges emotional and intellectual connections between the Advisory: ENGWR 101 or eligibility for ENGWR 300 interests of the audience and the inherent meanings of the resource. Topics will General Education: AA/AS Area V(a); CSU Area D4; CSU Area D6; CSU Area F1; LQFOXGH GHYHORSLQJDXGLHQFHDZDUHQHVV XQGHUVWDQGLQJUHVRXUFHLGHQWLÀFDWLRQ CSU Area F2; IGETC Area 4F developing a program using a thematic approach; writing measurable Course Transferable to UC/CSU performance objectives; and learning program delivery techniques. Completion Hours: 54 hours LEC RIWKLVFRXUVHZLOOTXDOLI\VWXGHQWVWRDSSO\IRUSURIHVVLRQDOFHUWLÀFDWLRQWKURXJK Survey history of the United States from 1607 to the present, emphasizing the WKH1DWLRQDO$VVRFLDWLRQIRU,QWHUSUHWDWLRQDVD&HUWLÀHG,QWHUSUHWLYH*XLGH economic and social conditions that gave women more actual respect and some (CIG). This course is recommended for students interested in history, biology, public power. Course includes the roles of women in Native American tribes, anthropology, recreation, education, and communication. Not open to students the English heritage of the colonists, the contributions of women in creating who have received credit for BIOL 392 or ANTH 392. new homes and farms, and the role of women in times of war. Emphasis on the role of women in the three major social issues of the 19th century: labor, DEROLWLRQDQGZRPHQ·VULJKWV,QFOXGHVSUHVHQWGD\LVVXHVDQGWKHOHJDF\RI how women in the past dealt with similar issues. 180 History Folsom Lake College 2011-2012 HIST 393 FIELD EXPERIENCE IN HISTORY OR HERITAGE INTERPRETATION 2 UNITS Same As: ANTH 393 and BIOL 393 Prerequisite: None. Advisory: Completion of HIST 344 or HIST 392 with a grade of “C” or better. Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB This course is a cooperative effort between the college and the organizations LQYROYHGLQKLVWRU\RUWKHUHODWHGÀHOGRIKHULWDJHLQWHUSUHWDWLRQ,QWHUQVKLS sponsors assist students in acquisition of skills and the application of knowledge learned in the classroom. In addition to developing applied job related skills, VWXGHQWVZLOOOHDUQVNLOOVLQMREVHHNLQJFDUHHUJRDOVHWWLQJWHDPEXLOGLQJDQG leadership. During the internship, students will continue to check in with the class to receive input and feedback on their experience. This course requires that the students obtain an internship during the course of the semester that will last a minimum of 54 hours. HIST 495 INDEPENDENT STUDIES IN HISTORY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB HIST 499 EXPERIMENTAL OFFERING IN HISTORY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Horticulture 181 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Horticulture COUNSELING Rancho Cordova Center - 916-255-0717 HORT 498 WORK EXPERIENCE IN HORTICULTURE 1-4 UNITS The Folsom Lake College programs offer students the Prerequisite: None. opportunity to learn Nursery Operations and Landscape Advisory: ENGWR 101 Maintenance in a unique professional growth industry. A General Education: AA/AS Area III(b) wide variety of employment opportunities are available (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS in the Sacramento area. The continued growth of the volunteer opportunity or job related to career goals. area and the need for specialized training are creating Course Transferable to CSU DGHPDQGIRUTXDOLÀHGLQGLYLGXDOV +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills Career Options in preparation for employment or advancement within their current job. Course Nursery Management and Operations; Park content will include understanding the application of education to the workforce; Maintenance; Landscape Design, Contracting & completion of required forms, which document the student’s progress and hours Maintenance; Fertilizer & Insecticide Application; spent at the work site; and developing workplace skills and competencies. Research; Retail/Wholesale; Estimator; Consultant; 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU Government Agency employee orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related Highlights work experience is required for each additional unit. The course may be taken Field trips for appreciation and evaluative study four times for credit, when there is new or expanded learning on the job, for Practical design opportunities a maximum of 16 units. Horticulture (HORT) HORT 299 EXPERIMENTAL OFFERING IN HORTICULTURE .5-4 UNITS Prerequisite: None Hours: 18 hours LEC ; 4 hours LAB HORT 300 INTRODUCTION TO HORTICULTURE 3 UNITS Prerequisite: None. General Education: AA/AS Area IV Course Transferable to UC/CSU Hours: 54 hours LEC This course surveys horticultural principles and practices. Course topics include environmental factors that promote plant cultivation, basic plant structure and function, general knowledge of plant usage, and landscape planning and maintenance. Field trips may be required. HORT 495 INDEPENDENT STUDIES IN HORTICULTURE 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 182 Human/Career Development Folsom Lake College 2011-2012 Human/Career Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Development COUNSELING Rancho Cordova Center - 916-255-0717 HCD 111 COLLEGE DISCOVERY PROGRAM 1 UNIT Folsom Lake College Human/Career Development courses Prerequisite: None. are designed to assist students with recognizing their full Hours: 18 hours lecture potential through developing self awareness, educational This course is designed to introduce the student to college programs, services, management and lifelong independent career planning policies, and procedures. Topics covered include general education, major skills. Instruction includes obtaining skills necessary to selection, eServices tutorial, class scheduling techniques and campus resources. succeed in college and make positive and productive work/life decisions. HCD 123 STUDY STRATEGIES AND TECHNIQUES 3 UNITS Prerequisite: None Highlights Hours: 54 hours LEC Understanding of how changes in the workplace This course is designed for student with learning challenges who want to improve impact career change and lifelong transition WKHLUDFDGHPLFVNLOOVDQGOHDUQVSHFLÀFVWXG\VNLOOVDQGVWUDWHJLHV6WXGHQWVZLOO Obtain knowledge and skills needed to succeed in have an opportunity to develop and improve techniques for textbook reading, college note taking, and test taking. They will learn strategies for time management, Career exploration and research to assist with career memory improvement, and test preparation, as well as critical thinking and planning and decision making organization in written expression. In addition, they will be able to discover their Awareness of skills and competencies required for own learning styles and choose individually tailored, appropriate combinations effective and competitive workplace performance of study strategies and techniques. The course includes familiarization with Addresses balanced lifestyle concepts and their UHOHYDQWFDPSXVUHVRXUFHVDVZHOODVWKH,QWHUQHWDQGRIIFDPSXVLQIRUPDWLRQ relationship to job satisfaction and work/life success resources. This course is not transferable to UC/CSU. This course is open to all Support strategies for those with learning disabilities students but is designed and particularity helpful for students with learning problems and a variety of disabilities. HCD 310 COLLEGE SUCCESS 3 UNITS Human/Career Development (HCD) Prerequisite: None. HCD 81 DIAGNOSTIC ASSESSMENT .5 UNITS General Education: AA/AS Area III(b); CSU Area E1 Prerequisite: None. Course Transferable to UC/CSU Hours: 10 hours LEC Hours: 54 hours LEC This course is designed to gather assessment data and evaluate eligibility This comprehensive course is designed to assist students in obtaining the for learning disability services using guidelines mandated by the California skills and knowledge necessary to reach their educational objectives. Topics &RPPXQLW\&ROOHJHVV\VWHP2QHWRRQHDVVHVVPHQWZLWKD/HDUQLQJ include: motivation and discipline, memory development, time management, Disabilities Specialist/Psychologist will help evaluate learning strengths, areas communication skills, career planning, transfer options, study skills, and of concern and learning styles with a goal toward establishing appropriate personal issues commonly reported by college students. The course is educational objectives and improved academic performance. Initial and UHFRPPHQGHGIRUQHZVWXGHQWVDQGRWKHUVZKRFDQEHQHÀW IROORZXSLQVWUXFWLRQVWUHQJWKHQVWKHVWXGHQWVXQGHUVWDQGLQJRIWHVWUHVXOWV and applications. This course will be graded on a pass/no pass basis and may HCD 318 TRANSFER: MAKING IT HAPPEN 2 UNITS be taken one time for credit. Prerequisite: None. General Education: AA/AS Area III(b) Course Transferable to UC/CSU Hours: 36 hours LEC This course provides a comprehensive study of the university transfer process as it relates to community college students. Topics include an overview of higher education, transfer admission requirements, college research, major selection, transfer resources, student support services, transitional issues, and the college application process. Folsom Lake College 2011-2012 Human/Career Development 183 HCD 330 LIFE AND CAREER PLANNING 1 UNIT Prerequisite: None. General Education: AA/AS Area III(b) Course Transferable to CSU Hours: 18 hours LEC This course is a comprehensive approach to life and career planning based on extensive measurement of aptitude, interests, personality type, values, and skills. Personal and career goals will be formulated using career research and decision making strategies. Course topics will include changing career trends and job search techniques. HCD 335 CAREER DEVELOPMENT 3 UNITS Prerequisite: None. General Education: AA/AS Area III(b) Course Transferable to CSU Hours: 54 hours LEC This course provides a comprehensive approach to life and career planning based on extensive measurement of career development theories, interests, skills, personality types and values. Personal and career goals are developed. Course topics include career research, resume and cover letter development, interviewing strategies, decision making, and time management strategies. Students will be required to purchase additional class materials. HCD 495 INDEPENDENT STUDIES IN HUMAN/CAREER DEVELOPMENT 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB HCD 499 EXPERIMENTAL OFFERING IN HUMAN/CAREER DEVELOPMENT .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB HCD 1000 SUPERVISED TUTORING 0 UNITS Prerequisite: None Hours: hours LAB This course offers individualized tutoring designed to assist students to increase their success in college courses. Students may enroll for support of more than one college course per semester. Content will vary depending upon the adjunct course. Attention will be given to essential study skills and utilization of campus learning resources. May be repeated in subsequent semesters. 184 Human Services & Gerontology Folsom Lake College 2011-2012 Human Services & Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Gerontology COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE DEGREES A.A. - Human Services, General A.A. — Human Services, General A.A. - Human Services, Gerontology REQUIRED PROGRAM ...... Units CERTIFICATES OF ACHIEVEMENT HSER 300 Introduction to Human Services ...... 3 Human Services, General HSER 302 Intro to Psychology of Human Relations .3 Human Services, Gerontology HSER 350 Employment Skills in Human Services ....3 HSER 360 Techniques of Interviewing and Counseling CERTIFICATES OF RECOGNITION ...... 3 Human Services, Home Caregiver HSER 362 Practices in Human Services ...... 6 HSER 364 Techniques of Group Counseling ...... 4 This Folsom Lake College program prepares students PSYC 300 General Principles ...... 3 for employment as an associate professional, and Plus six (6) units selected from: ...... 6 also prepares students for transfer level training for GERON 300/SOC 335 Sociology of Aging (3) Psychology and Social Work majors towards Marriage HSER 304 Introduction to Counseling Children (3) Family Therapists, Social Workers, and Psychologists. HSER 340 Introduction to Chemical Dependency (3) Associate Professional employment includes agencies such HSER 494 Topics in Human Services (0.5-4) as youth group homes, youth and family services, schools, PSYC 320 Social Psychology (3) probation, welfare, and mental health departments. Both SOC 300 Introductory Sociology (3) WKHGHJUHHDQGFHUWLÀFDWHVDUH&68WUDQVIHUUDEOHDQG SOC 321 Race, Ethnicity and Inequality in the U.S. IXOÀOOORZHUGLYLVLRQUHTXLUHPHQWVIRUD3V\FKRORJ\%$ ...... (3) GHJUHH DQG IXOÀOO XSSHUGLYLVLRQ UHTXLUHPHQWV IRU D TOTAL UNITS REQUIRED ...... 31 MS in Counseling degree. Suggested Electives: ENGWR 300, 330, 331; CISA 300, Career Options 301, 320, 321, 340; HEED 300, 312, 313; STAT 300. Peer Support Group Facilitator; Youth Group Home Worker; Alcoholism Program Worker; Family, Welfare, This A.A. degree may be obtained by completion of the and Health Agencies Worker; Ombudsman Program Required Program, plus General Education Requirements, Workers; Work with Correctional Agencies; Consumer SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO &RQVXOWDQW &RXQW\RU6WDWH(OLJLELOLW\:RUNHU &RQÁLFW Containment Workers The A.A. degree program in Human Services provides performance-based training for both associate level Highlights employment and transfer preparation. Provides training for Individual and group counseling Psychology and Social Work majors towards Marriage Family Tours of Human Services agencies Therapists, Social Workers, and Psychologists. All courses Interviews with employers within this curriculum are transferable to CSU four-year Employment training, including resumes, cover degree programs. Coursework includes performance-based letters, and interviews training in client screening, intake, assessment, orientation, individual counseling, group counseling, consultation, client’s ULJKWV FRQÀGHQWLDOLW\ FULVLV LQWHUYHQWLRQ FOLHQW HGXFDWLRQ professional ethics, reports and record keeping. Upon completion of this program, the student will be able to: 'HÀQHWKHIXQFWLRQVRIVRFLDOVHUYLFHGHOLYHU\V\VWHPV Analyze public policy issues, complexities and controversies affecting social service agencies and their clients Folsom Lake College 2011-2012 Human Services & Gerontology 185 Integrate different theoretical approaches in working to a four-year college should consult the Requirements for with clients Transfer Institutions section of this catalog. Identify the community resources used in assisting clients Appraise and apply the knowledge of existing California Upon completion of this program, the student will be able to: professional codes of ethics for the helping professions 'HPRQVWUDWHVNLOOHDVHFRQÀGHQFHUDSSRUWDQGOLVWHQLQJ Describe the application of clients’ rights in the social skills when communicating with the elderly at different service delivery system cognitive levels. Evaluate one’s own values and attitudes as they apply Evaluate and discuss similarities and differences to ethical decision making surrounding diverse aging populations as they relate Demonstrate effective individual and group setting to life expectancy, mortality, mobility, family, work, interpersonal and social skills in interactions with a retirement, mental health, death, lifestyles, sexuality, demographically diverse population and use of services. Discuss the impact of language and other cultural factors DEGREE WKDWLQÁXHQFHGUXJHGXFDWLRQGUXJXVHDQGWUHDWPHQW A.A. — Human Services, Gerontology options with the elderly. Evaluate common methods of care for the dying including REQUIRED PROGRAM ...... Units hospitals, skilled nursing facilities, care centers, and GERON 331 Interviewing, Counseling the Elderly .....3 hospice care. GERON 333 Techniques of Individual and Group Recognize and identify risk of caregiver stress in cases of Counseling of the Elderly ...... 4 Alzheimer’s, dementia, and other diagnoses correlated HSER 300 Introduction to Human Services ...... 3 with aging. HSER 302 Introduction to Psychology of Human Identify and evaluate elder abuse causes, preventions Relations ...... 3 strategies, and resources. HSER 340 Introduction to Chemical Dependency ..3 Identify strategies for meeting the challenges of aging HSER 350 Employment Skills in Human Services ....3 within a socio-cultural framework. HSER 360 Techniques of Interviewing and Counseling Recognize and evaluate demographic, socioeconomic, ...... 3 legal, and physiologic aspects of aging HSER 362 Practices in Human Services ...... 6 Develop practical workplace skills and knowledge HSER 364 Techniques of Group Counseling ...... 4 QHHGHGIRUHPSOR\PHQWLQWKHÀHOG PSYC 300 General Principles ...... 3 Transfer skills, units, and experience to a gerontology TOTAL UNITS REQUIRED ...... 35 major at a four year institution. Suggested Electives: CISA 300, CISA 301, CISA 320, CERTIFICATE OF ACHIEVEMENT CISA 321, CISA 340, CISC 320, CISC 321; ENGWR 300, Human Services, General ENGWR 330, ENGWR 331; HEED 300, 312, 313; STAT 300. REQUIRED PROGRAM ...... Units HSER 300 Introduction to Human Services ...... 3 This A.A. degree may be obtained by completion of the HSER 302 Intro to Psychology of Human Relations 3 Required Program, plus General Education Requirements, HSER 350 Employment Skills in Human Services ....3 SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO HSER 360 Techniques of Interviewing and Counseling ...... 3 The Gerontology Degree Program will prepare students HSER 362 Practices in Human Services ...... 6 to assist seniors in managing their health, psychological, HSER 364 Techniques of Group Counseling ...... 4 and social needs unique to the elderly population via a PSYC 300 General Principles ...... 3 broad overview of the biological, psychological, and social Plus six (6) units selected from: ...... 6 aspects of aging. The need for specialization in gerontology GERON 300/SOC 335 Sociology of Aging (3) is clearly shown in population trends and documented in HSER 304 Introduction to Counseling Children (3) literature citing the lack of adequately prepared geriatric HSER 340 Introduction to Chemical Dependency (3) caregivers. The focus is on preparation for associate-level HSER 494 Current Issues in Human Services (3) SRVLWLRQVZLWKSULYDWHLQGXVWU\JRYHUQPHQWDQGQRQSURÀW PSYC 320 Social Psychology (3) agencies providing health services to senior adults. All courses SOC 300 Introductory Sociology (3) transfer to California State Universities. Students planning SOC 321 Race, Ethnicity and Inequality in the U.S. (3) to continue specialization in gerontology by transferring TOTAL UNITS REQUIRED ...... 31 186 Human Services & Gerontology Folsom Lake College 2011-2012 Suggested Electives: ENGWR 300, 330, 331; CISA 300, 7KH*HURQWRORJ\&HUWLÀFDWH3URJUDPZLOOSUHSDUHVWXGHQWV 301, 320, 321, 340; HEED 300, 312, 313; STAT 300 to assist seniors in managing their health, psychological, and social needs unique to the elderly population via a 7KH FHUWLÀFDWH SURJUDP LQ +XPDQ 6HUYLFHV SURYLGHV broad overview of the biological, psychological, and social performance-based training for both associate level aspects of aging. The need for specialization in gerontology employment and transfer preparation. Provides training is clearly shown in population trends and documented in for Psychology and Social Work majors towards Marriage literature citing the lack of adequately prepared geriatric Family Therapists, Social Workers, and Psychologists. caregivers. The focus is on preparation for associate-level All courses within this curriculum are transferable to SRVLWLRQVZLWKSULYDWHLQGXVWU\JRYHUQPHQWDQGQRQSURÀW CSU four-year degree programs. Coursework includes agencies providing health services to senior adults. performance-based training in client screening, intake, assessment, orientation, individual counseling, group Upon completion of this program, the student will be able to: FRXQVHOLQJFRQVXOWDWLRQFOLHQW·VULJKWVFRQÀGHQWLDOLW\FULVLV 'HPRQVWUDWHVNLOOHDVHFRQÀGHQFHUDSSRUWDQG intervention, client education, professional ethics, reports listening skills when communicating with the elderly at and record keeping. different cognitive levels. (YDOXDWHDQGGLVFXVVVLPLODULWLHVDQGGLIIHUHQFHV Upon completion of this program, the student will be able to: surrounding diverse aging populations as they relate 'HÀQHWKHIXQFWLRQVRIVRFLDOVHUYLFHGHOLYHU\V\VWHPV to life expectancy, mortality, mobility, family, work, Analyze public policy issues, complexities and retirement, mental health, death, lifestyles, sexuality, controversies affecting social service agencies and and use of services. their clients 'LVFXVVWKHLPSDFWRIODQJXDJHDQGRWKHUFXOWXUDO Integrate different theoretical approaches in working IDFWRUVWKDWLQÁXHQFHGUXJHGXFDWLRQGUXJXVHDQG with clients treatment options with the elderly. Identify the community resources used in assisting clients (YDOXDWHFRPPRQPHWKRGVRIFDUHIRUWKHG\LQJ Appraise and apply the knowledge of existing California including hospitals, skilled nursing facilities, and professional codes of ethics for the helping professions hospice care. Describe the application of clients’ rights in the social 5HFRJQL]HDQGLGHQWLI\ULVNRIFDUHJLYHUVWUHVVLQ service delivery system cases of Alzheimer’s and other dementia. Describe the application of clients’ rights in the social ,GHQWLI\DQGHYDOXDWHHOGHUDEXVHFDXVHV service delivery system preventions strategies, and resources. Demonstrate effective individual and group setting ,GHQWLI\VWUDWHJLHVIRUPHHWLQJWKHFKDOOHQJHVRI interpersonal and social skills in interactions with a aging within a socio-cultural framework. demographically diverse population. 5HFRJQL]HDQGHYDOXDWHGHPRJUDSKLFVRFLRHFRQRPLF legal, and physiologic aspects of aging. CERTIFICATE OF ACHIEVEMENT 'HYHORSSUDFWLFDOZRUNSODFHVNLOOVDQGNQRZOHGJH Human Services, Gerontology needed for employment. REQUIRED PROGRAM ...... Units CERTIFICATE OF RECOGNITION GERON 331 Interviewing, Counseling the Elderly .....3 Human Services, Home Caregiver GERON 333 Techniques of Individual and Group Counseling of the Elderly .....4 REQUIRED PROGRAM ...... Units HSER 300 Introduction to Human Services ...... 3 GERON 300/SOC 335 Sociology of Aging ...... 3 HSER 302 Introduction to Psychology of Human HSER 302 Introduction to Psychology of Human Relations ...... 3 Relations ...... 3 HSER 340 Introduction to Chemical Dependency ..3 HSER 350 Employment Skills in Human Services ....3 HSER 350 Employment Skills in Human Services ....3 HSER 498 Work Experience ...... 3 HSER 360 Techniques of Interviewing and Counseling TOTAL UNITS REQUIRED ...... 12 ...... 3 HSER 362 Practices in Human Services ...... 6 7KH+RPH&DUHJLYHU&HUWLÀFDWHSUHSDUHVUHFLSLHQWVZLWK HSER 364 Techniques of Group Counseling ...... 4 in-home ethical and legal preparation, interpersonal skill PSYC 300 General Principles ...... 3 WUDLQLQJ DQG LQIRUPDWLRQ UHJDUGLQJ WKH QHHGV DIÀOLDWHG TOTAL UNITS REQUIRED ...... 35 with aging. All courses transfer to California State Universities. Students planning to continue specialization in Folsom Lake College 2011-2012 Human Services & Gerontology 187 gerontology by transferring to a four-year college should HSER 304 INTRODUCTION TO COUNSELING CHILDREN 3 UNITS consult the Requirements for Transfer Institutions section of Prerequisite: None this catalog. Course Transferable to CSU Hours: 54 hours LEC Upon completion of this program, the student will be able to: A study of the tools children use daily to cope with feelings, adjust to changes, GHPRQVWUDWH VNLOO HDVH FRQÀGHQFH UDSSRUW DQG overcome disappointment and trauma, make sense out of the world around listening skills when communicating with the elderly at them and grow in their various relationships. Children’s play medium will be different cognitive levels. experienced, with special emphasis on the importance of imagination and the evaluate and discuss similarities and differences use of fantasy. Assignments will require association with children. surrounding diverse aging populations as they relate to life expectancy, mortality, mobility, family, work, HSER 340 INTRODUCTION TO CHEMICAL DEPENDENCY 3 UNITS retirement, mental health, death, lifestyles, sexuality, Prerequisite: None. and use of services. Course Transferable to CSU discuss the impact of language and other cultural Hours: 54 hours LEC IDFWRUVWKDWLQÁXHQFHGUXJHGXFDWLRQGUXJXVHDQG This course introduces and examines the psychological and physiological treatment options with the elderly. effects of chemical dependency on the individual. Also included is an analysis evaluate common methods of care for the dying of the effects of substance abuse on the family; the sociological and economic including hospitals, skilled nursing facilities, and conditions contributing to substance abuse, and a description of communication hospice care. efforts at prevention and treatment. recognize and identify risk of caregiver stress in cases of Alzheimer’s and other dementia. HSER 341 PHYSIOLOGY AND PHARMACOLOGY: ALCOHOL & identify and evaluate elder abuse causes, preventions OTHER DRUGS 3 UNITS strategies, and resources. Prerequisite: HSER 340 with a grade of “C” or better identify strategies for meeting the challenges of aging Course Transferable to CSU within a socio-cultural framework. Hours: 54 hours LEC recognize and evaluate demographic, socioeconomic, This course is a study of the chemical composition, pharmacokinetics and the legal, and physiologic aspects of aging. physiological effects of psychoactive drugs on the central nervous system. develop practical workplace skills and knowledge Psychoactive drugs discussed include alcohol, opiates, stimulants, depressants, needed for employment. psychotherapeutics, and psychedelics. Also included will be the physiological and psychological mechanisms associated with tolerance, habituation, and withdrawal that occur during the addiction phase of drug use. Human Services (HSER) HSER 350 EMPLOYMENT SKILLS IN HUMAN SERVICES 3 UNITS Prerequisite: None. HSER 300 INTRODUCTION TO HUMAN SERVICES 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Course Transferable to CSU This course is an introduction to interviewing and counseling with parents, Hours: 54 hours LEC family system dynamics, family and drug intervention, crisis training, court 7KLVFRXUVHLVDFRPSUHKHQVLYHRYHUYLHZRIWKHÀHOGRI+XPDQ6HUYLFHVLQ mandated reporting, legislative mandates required of counselors, and laws private and public agencies. The course topics include learning of agency pertaining to counseling minors and other client populations within Human functions and worker activities through reading, class discussion, and class Services Agencies. This is a required course for the Human Services/Gerontology speakers. Emphasis is on the roles and skills of associate professionals such GHJUHHDQGFHUWLÀFDWH as health workers, activity directors for the elderly, and adolescent and child welfare assistants. HSER 360 TECHNIQUES OF INTERVIEWING AND COUNSELING 3 UNITS HSER 302 INTRODUCTION TO PSYCHOLOGY OF HUMAN Prerequisite: HSER 302 with a grade of “C” or better RELATIONS 3 UNITS Corequisite: HSER 362 Prerequisite: None. Course Transferable to CSU General Education: AA/AS Area III(b); CSU Area E1 Hours: 54 hours LEC Course Transferable to CSU This course is an introduction to effective counseling and interviewing techniques Hours: 54 hours LEC DVDSSOLHGWRDVVRFLDWHSURIHVVLRQDOH[SHULHQFHVDV FRXQVHORUDQGJURXS This course is an introduction to attitudes, values, and methods that enhance counselor aides, mental health workers, social service technicians and other new communication skills in human relations. This course is a required course for the FDUHHUVRQDOODFDGHPLFOHYHOVLQSHRSOHWRSHRSOHVHUYLFHV7KLVLVDUHTXLUHG +XPDQ6HUYLFHV*HURQWRORJ\GHJUHHDQGFHUWLÀFDWHZKLFKLVRSHQWRDOOVWXGHQWV FRXUVHIRUWKH+XPDQ6HUYLFHV*HURQWRORJ\GHJUHHDQGFHUWLÀFDWH 188 Human Services & Gerontology Folsom Lake College 2011-2012 HSER 362 PRACTICES IN HUMAN SERVICES 3 UNITS HSER 495 INDEPENDENT STUDIES IN HUMAN SERVICES 1-3 UNITS Prerequisite: HSER 302 with a grade of “C” or better Prerequisite: None Corequisite: HSER 350 and 360 Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 18 hours LEC ; 108 hours LAB HSER 498 WORK EXPERIENCE IN HUMAN SERVICES 1-4 UNITS 7KLVFRXUVHSURYLGHVUHVHDUFKDQGVXSHUYLVHGÀHOGH[SHULHQFHLQSXEOLFDQGRU Prerequisite: None. private agencies providing mental health, corrections, chemical dependency, and Advisory: ENGWR 101 child/adolescent treatment services. Students apply concepts, values and skills General Education: AA/AS Area III(b) acquired in other core courses to the process of helping others via internships Enrollment Limitation: Student must be in a paid or unpaid internship, volunteer DQGÀHOGWULSV6WXGHQWHYDOXDWLRQLVFRPSHWHQF\EDVHG7KLVFRXUVHPD\EH position or job related to career goals. taken four times for credit, requiring a new Learning Objectives Agreement for Course Transferable to CSU different lab settings and client populations. +RXUV KRXUV/$% HSER 364 TECHNIQUES OF GROUP COUNSELING 4 UNITS This course provides students with opportunities to develop marketable skills Prerequisite: HSER 360 and 362 with grades of “C” or better in preparation for employment or advancement within their current job. Course Course Transferable to CSU content will include understanding the application of education to the workforce; Hours: 54 hours LEC ; 54 hours LAB completion of required forms, which document the student’s progress and hours This course introduces techniques of counseling in groups with people of a spent at the work site; and developing workplace skills and competencies. YDULHW\RIDJHV6WXGHQWVOHDUQIDFLOLWDWLRQDQGFRIDFLOLWDWLRQZLWKLQDJURXS 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU setting, and a goal of learning facilitation towards clients’ improved skills in orientation and 75 hours of related paid work experience, or 60 hours of problem resolution and solution development. Course emphasizes recognition of unpaid work experience, for one unit. An additional 75 or 60 hours of related unique and common problems and participation in understanding and behavior work experience is required for each additional unit. The course may be taken change. This is a required course for the Human Services/Gerontology degree four times for credit, when there is new or expanded learning on the job, for DQGFHUWLÀFDWH a maximum of 16 units. HSER 494 TOPICS IN HUMAN SERVICES .5-4 UNITS HSER 499 EXPERIMENTAL OFFERING IN HUMAN SERVICES Prerequisite: None .5-4 UNITS Course Transferable to CSU Prerequisite: None Hours: 54 hours LEC Course Transferable to CSU Exploration of those topics and issues which are most relevant for future and Hours: 18 hours LEC ; 54 hours LAB present workers in human services. Emphasis will be on those issues which are not consistently covered by other required human services courses. These issues may include: chemical dependency, interventions in poverty, stress management, child neglect and abuse, patient rights, and organization for advocacy. Folsom Lake College 2011-2012 Human Services & Gerontology 189 GERON 498 WORK EXPERIENCE IN GERONTOLOGY 1-4 UNITS Gerontology (GERON) Prerequisite: None. Advisory: ENGWR 101 GERON 300 SOCIOLOGY OF AGING 3 UNITS Enrollment Limitation: Students must be in a paid or unpaid internship, volunteer Same As: SOC 335 position or job related to gerontology. Students are advised to consult with the Prerequisite: None. *HURQWRORJ\'HSDUWPHQWIDFXOW\WRUHYLHZVSHFLÀFFHUWLÀFDWHDQGGHJUHHZRUN General Education: AA/AS Area V(b); CSU Area D0; CSU Area E1 experience requirements. Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC +RXUV KRXUV/$% This introductory course examines the aged and the aging process, with This course provides students with opportunities to develop marketable skills emphasis on social factors affecting and affected by an aging population. It LQSUHSDUDWLRQIRUHPSOR\PHQWRUDGYDQFHPHQWZLWKLQWKHÀHOGRIJHURQWRORJ\ includes an analysis of demography and history of aging in America; individual It is designed for students interested in work experience and/or internships aging and adaption; needs, resources, and social support systems; employment in transfer level degree occupational programs. Course content includes and retirement; and social class/cultural differences. Not open to students who understanding the application of education to the workforce; completion of have received credit for SOC 335. required forms which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. Appropriate level GERON 331 INTERVIEWING, COUNSELING THE ELDERLY 3 UNITS learning objectives are established by the student and the employer. During the Prerequisite: PSYC 300. Grade of “C” or better required to meet prerequisite. semester, the student is required to attend a weekly orientation and 75 hours Course Transferable to CSU of related paid work experience, or 60 hours of unpaid work experience for Hours: 54 hours LEC one unit. An additional 75 or 60 hours of related work experience is required Techniques of counseling the elderly with emphasis on rehabilitation using IRUHDFKDGGLWLRQDOXQLW7KHZHHNO\RULHQWDWLRQLVUHTXLUHGIRUÀUVWWLPH 5HPRWLYDWLRQ5HDOLW\2ULHQWDWLRQ6HQVLWLYLW\7UDLQLQJDQG/LIH5HYLHZ participants, returning participants are not required to attend the orientation Individual and group processes as related to the elderly are applied. The course but are required to meet with the instructor as needed to complete all program is an integral part of the Gerontology program. forms and assignments. Work Experience may be taken for a total of 16 units when there are new or expanded learning objectives. GERON 333 TECHNIQUES OF INDIVIDUAL AND GROUP COUNSELING OF THE ELDERLY 4 UNITS GERON 499 EXPERIMENTAL OFFERING IN GERONTOLOGY Prerequisite: GERON 331. Grade of “C” or better required to meet prerequisite. .5-4 UNITS Course Transferable to CSU Prerequisite: None Hours: 54 hours LEC ; 54 hours LAB Course Transferable to CSU Exploration of the effectiveness of counseling techniques of the elderly within Hours: 18 hours LEC ; 54 hours LAB DQLQVWLWXWLRQDOVHWWLQJ1RQWUDGLWLRQDOWHFKQLTXHVRIFRXQVHOLQJDQGVXSSRUW are investigated. Student involvement with the elderly under supervision is a major function of the course. This course is an integral part of the Gerontology program. GERON 495 INDEPENDENT STUDIES IN GERONTOLOGY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 190 Humanities Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Humanities COUNSELING Rancho Cordova Center - 916-255-0717 Upon completion of this program, the student will be able to: DEGREE A.A. - Humanities Describe the fundamental questions people have pondered over the past 2500 years. This Folsom Lake College program offers courses in Analyze, evaluate, and synthesize philosophical classical, modern, American and non-Western humanities. problems in order to develop and defend a position. ,QHDFKFRXUVHEDVLFKXPDQYDOXHVDVH[HPSOLÀHGLQ Demonstrate an understanding of the development of the arts, philosophy, religion and history are examined. FXOWXUHDVUHÁHFWHGLQWKHDUWVSKLORVRSK\DQGKLVWRU\ of the Western world. Career Options Evaluate the artistic and cultural achievements of a Communication; Education; Journalism; Law; Politics; particular period by comparing and contrasting them to Public Relations; Museum Curator the achievements of previous and subsequent periods. Demonstrate community and cultural awareness by Some career options may require more than two years attending cultural events and evaluating their relevance. of college study. Utilize research skills to write papers that examine the EDVLFKXPDQYDOXHVH[HPSOLÀHGLQWKHDUWVOLWHUDWXUH and/or philosophy of particular eras in history. Highlights Employ inductive or deductive reasoning to challenge or 'LYHUVLÀHGDQGWDOHQWHGIDFXOW\ defend assertions in arguments and argumentative essays. +DQGVRQH[SHULHQFHLQYDULRXVÀHOGVUHODWLQJWR above career options Excellent background in liberal arts for transfer or interdisciplinary study Humanities (HUM) HUM 300 CLASSICAL HUMANITIES 3 UNITS DEGREE Prerequisite: None. A.A. — Interdisciplinary Studies, Humanities General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU REQUIRED PROGRAM ...... Units Hours: 54 hours LEC HUM 300 Classical Humanities ...... 3 The course focuses upon Western culture in its attempt to interpret human HUM 310 Modern Humanities ...... 3 H[SHULHQFHDQGLGHQWLW\7KHFRXUVHH[DPLQHVEDVLFKXPDQYDOXHVDVH[HPSOLÀHG PHIL 300 Introduction to Philosophy ...... 3 in the arts, philosophy and history. Emphasis is on the Greeks, the Romans, and A minimum of 12 units from the following: WKH-XGHR&KULVWLDQWUDGLWLRQVXSWRWKHHQGRIWKH0LGGOH$JHV ARTH 300, 333; CMED 305; ENGLT 340, 345; HUM 320, 332, 334, 340; MUFHL 300; PHIL 352, 358; TA HUM 310 MODERN HUMANITIES 3 UNITS 300 ...... 12 Prerequisite: None. TOTAL UNITS REQUIRED ...... 21 General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU This A.A. degree may be obtained by completion of the Hours: 54 hours LEC Required Program, plus General Education Requirements, This course focuses upon Western culture in its attempt to interpret human SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO H[SHULHQFHDQGLGHQWLW\7KHFRXUVHH[DPLQHVEDVLFKXPDQYDOXHVDVH[HPSOLÀHG in the arts, philosophy, and history. Emphasis is on the Renaissance, the Baroque The Humanities program at Folsom Lake College offers period, and the Modern age. students the opportunity to develop a breadth of interdisciplinary knowledge, enhance their appreciation of the arts, sharpen their critical thinking skills, and prepare them for transfer to the university. Folsom Lake College 2011-2012 Humanities 191 HUM 320 ASIAN HUMANITIES 3 UNITS HUM 340 AFRICAN AMERICAN HUMANITIES 3 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC 7KLVFRXUVHH[DPLQHVEDVLFKXPDQYDOXHVDVH[HPSOLÀHGLQWKHDUWOLWHUDWXUH This course examines the African American experience in the United States music, philosophy, and history of the Far East from ancient times to the present. from an historical and political perspective by experiencing and analyzing Emphasis is placed upon the relationship of the humanities to the historical the arts and artistic expressions. The course draws upon music, art, literature developments, geographical features, and cultural contexts of India, China, and DQGSKLORVRSK\DVDYHQXHVIRUXQGHUVWDQGLQJWKHLQÁXHQFHVDQGFKDOOHQJHVWR -DSDQ7KLVFRXUVHIXOÀOOV)ROVRP/DNH&ROOHJH·V(WKQLF0XOWLFXOWXUDO6WXGLHV African American identity both historically and contemporarily. requirement for the Associates Degree. HUM 495 INDEPENDENT STUDIES IN HUMANITIES 1-3 UNITS HUM 325 ARTS AND HUMANITIES OF THE ISLAMIC WORLD 3 UNITS Prerequisite: None Prerequisite: None. Course Transferable to CSU Hours: 54 hours lecture Hours: 18 hours LEC ; 54 hours LAB This course examines the arts and humanities shaped by Islamic thoughts and HUM 499 EXPERIMENTAL OFFERING IN HUMANITIES .5-4 UNITS beliefs from the 7th century to contemporary times in the Islamic regions. Prerequisite: None It includes information on the history, religion, philosophy, visual arts, and Course Transferable to CSU OLWHUDWXUH,WDGGLWLRQDOO\FRYHUVPXVLFDQGODWHUDUWIRUPVVXFKDVÀOP7KLV Hours: 18 hours LEC ; 54 hours LAB course emphasizes Arab, Persian, African, and Asian contributions in the Islamic lands and in Diaspora. HUM 332 AMERICAN HUMANITIES 3 UNITS Prerequisite: None. General Education: AA/AS Area I; AA/AS Area VI; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Hours: 54 hours LEC This course examines ideas and values about the American experience by analyzing the literature, art, music, philosophy and history from the beginning RIWKHWZHQWLHWKFHQWXU\WRWKHSUHVHQW7KHFRXUVHGUDZVXSRQWKHDUWVRI African American, Native American, Asian American, Anglo and Latino cultures as avenues for understanding issues of race, ethnicity, class, and gender as they intersect with mainstream American values. HUM 334 CALIFORNIA CULTURES 3 UNITS Prerequisite: None. Advisory: ENGWR 101 or eligibility for ENGWR 300 General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Hours: 54 hours LEC This course examines California cultural development in the arts, literature, music and philosophy of the early indigenous people through the Spanish, Mexican and Anglo presences of the 19th century. The course will inspect the development of values and the manifestation of those values in politics and culture today, including the contributions of immigrant groups to the social milieu of the 20th century. Field trips are required. 192 Interdisciplinary Studies Folsom Lake College 2011-2012 Interdisciplinary Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Studies COUNSELING Rancho Cordova Center - 916-255-0717 Arts and Humanities: DEGREE A.A. - Areas of Emphasis ART 300, 302, 303, 304, 305, 307, 312, 316, 320, 323, A.A. - American Studies 327, 328, 336, 337 361, 370, 372, 373, 383, 386, 390, A.A. - Humanities 402, 404, 430 A.A. - Women’s Studies ARTH 300, 303, 309, 311, 312, 326, 332, 333; CMED 305* This Folsom Lake College major is intended for students ENCW 400, 410 who wish a general background in the areas of humanities ENGLT 303, 310, 311, 320, 321, 339, 340, 341, 345, or social science at the community college level. Several 360, 370, 402; ENGWR 301 RSWLRQV DUH RIIHUHG LQ VSHFLÀF LQWHUHVW DUHDV EXW DOO FMS 300, 320, 321 are intended to give the student an interdisciplinary FRENCH 311, 312, 401, 402, 411, 412 foundation for further study or an overview of the area HIST 307, 308 chosen. Students who wish to transfer to a four-year HUM 300, 310, 320, 332, 334, 340 college should consult with a counselor. MUFHL 300, 310, 311, 321, 330, 400, 401, 410 MUIVI 310, 311, 370, 371 Career Options MUP 350, 357 Religious Service; Human Service Careers; Research; PHOTO 300 301, 425* Teacher; Law; Administrator; Attorney; Historian; Foreign PHIL 300, 304, 310, 330, 331, 338, 350, 352, 356 Service; Archivist; Social Worker; Public Relations SILA 305, 306, 315, 316; SPAN 401, 402, 411, 412, 425 &RQVXOWDQW (PSOR\PHQW&RXQVHORU 3UREDWLRQ2IÀFHU TA300 Counselor Communication and English: Some career options may require more than two years of COMM 301, 311, 315, 331, 361 college study. Classes beyond the associate degree may be ENGWR 300, 301, 302 UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ PHIL 300, 320, 325, 328 for transfer to a university program. Social and Behavioral Sciences: Highlights ANTH 310, 319, 320, 330; BUS 330, 345 A valuable foundation for a variety of career or CMED 300; COMM 325, 341, 363 transfer opportunities ECON 302, 304 'LYHUVLÀHGDQGWDOHQWHGIDFXOW\ ECE 312*, 314* Overview of theoretical and cultural principles FCS 312*, 314* GEOG 310; GERON 300 HIST 307, 308, 312, 313, 314, 331 DEGREE JOURN 310 A.A. — Interdisciplinary Studies, Areas of Emphasis: PHIL 360 Arts & Humanities, Communication & English, Social & POLS 301, 302, 310 Behavioral Sciences, Math & Science, Understanding & PSYC 300, 312, 320, 335, 340, 351, 368, 372* Self-Development SS 338, 360; SOC 300, 301, 321, 335 Required Program ...... 18 Units Math and Science (this emphasis requires completion of courses from both math and science): A minimum of 18 units from the following: ANTH 300, 301 Choose ONE “Area of Emphasis” below in which to ASTRO 300, 301 complete a minimum of 18 units. Within the chosen area, BIOL 300, 307, 310, 323, 350*, 400, 410, 410, 420, select courses from at least three different disciplines. The 430, 431, 440, 470 Math and Science emphasis requires completion of CHEM 305, 306, 321, 322, 400, 401, 402, 410, 420, 421 courses from both math and science. Folsom Lake College 2011-2012 Interdisciplinary Studies 193 ENVT 304*, GEOG 300, 301, 306 GEOL 300, 301, 305, 306, 310, 311, 330, 342, 345, U po n c o mpletio n of t h is program, t h e s t ude nt will be able to : 351 evaluate and interpret the ways in which people MATH 300, 310, 335, 341, 343, 344, 350, 351, 370, throughout the ages in different cultures have 400, 401, 402, 410, 420 responded to themselves and the world around them PHYS 310, 311, 350, 360, 411, 421, 431 in artistic and cultural creation and expression (Arts PS 302 and Humanities). PSYC 312, 330; STAT 300 analyze critically, argue persuasively, and communicate clearly (Communication and English). Understanding and Self Development: evaluate how societies and social subgroups operate COMM 321 (Social and Behavioral Sciences). ECE 314 reason quantitatively and empirically (Math and ENGED 320 Science). FCS 322, 324 evaluate personal choices regarding disease GERON 300 prevention, healthy living, and making positive life HEED 300, 350 choices (Understanding and Self Development). HCD 310 HSER 302 DEGREE NUTRI300 A.A. — Interdisciplinary Studies, American Studies one-unit maximum from any 300-level or 400-level ADAPT, DANCE, FITNS, PACT, SPORT, TMACT REQUIRED PROGRAM ...... Units PET 301 A minimum of 15 units for the following: PSYC 340, 354, 356, 358, 360 (no more than one course selected from each group) SOC 310, 335 (a.) ENGLT 320, 321; (b.) HIST 312, 313, 314, 331; TOTAL UNITS REQUIRED ...... 18 (c.) HUM 332; (d.) POLS 301; The Interdisciplinary Studies Associate in Arts (A.A.) (e.) PSYC 360; Degree may be obtained by completion of the required (f.) SOC 300, 301, 321 ...... 15 program, plus general education requirements, plus A minimum of 6 units for the following: VXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO (no more than one course selected from each group) (a.) BUS 300; Please note: completion of FLC graduation requirements (b.) HUM 310; in and of itself will not satisfy transfer general education. (c.) PHIL 300, 338 ...... 6 Students are strongly encouraged to meet with a counselor TOTAL UNITS REQUIRED ...... 21 to determine appropriate courses that can simultaneously meet FLC graduation requirements and transfer GE This A.A. degree may be obtained by completion of the patterns such as CSU GE and/or IGETC. Required Program, plus General Education Requirements, Courses marked with an * are cross listed and have a SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO credit limitation. The American Studies program at Folsom Lake College The Interdisciplinary Studies degree is designed for students provides students with an interdisciplinary survey of the who wish a broad knowledge of arts and sciences plus historical, institutional, political, philosophical, cultural, and additional coursework in a prescribed “Area of Emphasis”. social achievements of America and its people. The program This program is a good choice for students planning on focuses on extending students’ breadth of knowledge, transferring to the California State University or University challenging their assumptions and preconceived notions, of California. The student will be able to satisfy general and preparing them for transfer to the university. education requirements, plus focus on transferable course ZRUN WKDW UHODWHV WR D VSHFLÀF PDMRU DQGRU LQGLYLGXDO Upon completion of this program, the student will be able to: interest. Demonstrate an understanding of indigenous ways in America before and after European colonization. It is highly recommended that students consult a counselor Trace and analyze the chronology of events that make up to determine the classes within each area that will best America’s past to understand change and/or continuity prepare them for their intended transfer major. 194 Interdisciplinary Studies Folsom Lake College 2011-2012 and cause and/or effect in history. DEGREE Evaluate the artistic and cultural achievements of a A.A. — Interdisciplinary Studies, Women’s Studies particular era by comparing and contrasting them to the achievements of previous and/or subsequent periods. REQUIRED PROGRAM ...... Units Utilize research skills to write papers that examine the A minimum of 9 units for the following: EDVLF KXPDQ YDOXHV H[HPSOLÀHG LQ $PHULFDQ KLVWRU\ ENGLT 360 Women in Literature ...... 3 politics, art, literature, and/or philosophy. HIST 331 Women in American History...... 3 Investigate and evaluate historical data to determine PSYC 356 Human Sexuality ...... 3 WKHFRQWULEXWLRQVVDFULÀFHVDQGH[SHULHQFHVRIGLYHUVH PSYC 360 Psychology of Women ...... 3 JURXSVZKRKDYHEHHQVLJQLÀFDQWLQWKHGHYHORSPHQW A minimum of 12 units for the following: of the United States in a given period. (no more than one course from each group) (a.) ANTH 312 DEGREE (b.) BUS 300; A.A. — Interdisciplinary Studies, Humanities (c.) ENGLT 310, 311, 320, 321, 330, 340, 341, 360; (d.) HIST 312, 313, 314, 331; REQUIRED PROGRAM ...... Units (e.) HUM 332; HUM 300 Classical Humanities ...... 3 (f.) PHIL 310, 320, 338; HUM 310 Modern Humanities ...... 3 (g.) POLS 301; PHIL 300 Introduction to Philosophy ...... 3 (h.) PSYC 356, 360, 372; A minimum of 12 units from the following: (i.) SOC 300, 301, 321; ARTH 300, 333; CMED 305; ENGLT 340, 345; HUM (j.) TA 304 ...... 12 320, 332, 334, 340; MUFHL 300; PHIL 352, 358; TA TOTAL UNITS REQUIRED ...... 21 300 ...... 12 TOTAL UNITS REQUIRED ...... 21 This A.A. degree may be obtained by completion of the Required Program, plus General Education Requirements, This A.A. degree may be obtained by completion of the SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Required Program, plus General Education Requirements, SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO This program is designed for both men and women, focusing on women and their: Achievements; Behavior, Feelings, and Upon completion of this program, the student will be able to: ([SHULHQFH +LVWRULFDO 6LJQLÀFDQFH &XOWXUDO DQG 6RFLDO Describe the fundamental questions people have Contributions; Roles in Society and the Political System; pondered over the past 2500 years. /LWHUDU\6LJQLÀFDQFH DQG3RVLWLRQVLQWKH%XVLQHVV:RUOG Analyze, evaluate, and synthesize philosophical The program seeks to broaden students’ knowledge of problems in order to develop and defend a position women’s achievements, challenge lingering stereotypes of Demonstrate an understanding of the development of women, and expand perceptions of women’s roles in society FXOWXUHDVUHÁHFWHGLQWKHDUWVSKLORVRSK\DQGKLVWRU\ of the Western world Upon completion of this program, the student will be able to: Evaluate the artistic and cultural achievements of a Demonstrate an understanding of the contributions of particular period by comparing and contrasting them to Colonial and Native American women during colonization the achievements of previous and subsequent periods. in the U.S. Demonstrate community and cultural awareness by Utilize research skills to write papers that examine the attending cultural events and evaluating their relevance. roles and responsibilities of women during the labor, Utilize research skills to write papers that examine the abolition, or women’s rights movements of the 19th and EDVLFKXPDQYDOXHVH[HPSOLÀHGLQWKHDUWVOLWHUDWXUH 20th centuries. and/or philosophy of particular eras in history. Evaluate the artistic and/or literary achievements of Employ inductive or deductive reasoning to challenge or women of a particular era by comparing and contrasting defend assertions in arguments and argumentative essays. them to those of previous and/or subsequent periods. ,QYHVWLJDWHDQGHYDOXDWHWKHFRQWULEXWLRQVVDFULÀFHVDQG experiences of women historically given the political, moral, and cultural constraints of a particular era. Identify and analyze the psychological, biological, and VRFLDOLQÁXHQFHVRQWKHEHKDYLRURIZRPHQLQDJLYHQHUD of history. Folsom Lake College 2011-2012 Journalism 195 JOUR 495 INDEPENDENT STUDIES IN JOURNALISM 1-3 UNITS Journalism (JOUR) Prerequisite: None Course Transferable to CSU JOUR 310 MASS MEDIA AND SOCIETY 3 UNITS Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None. General Education: AA/AS Area V(b); CSU Area D7; IGETC Area 4J JOUR 499 EXPERIMENTAL OFFERING IN JOURNALISM .5-4 UNITS Course Transferable to UC/CSU Prerequisite: None Hours: 54 hours LEC Course Transferable to CSU Survey of the mass media: history, philosophy, structure and trends, as Hours: 18 hours LEC ; 54 hours LAB well as theories which help to explain effects and the importance of mass communications as a social institution. Exploration of economics, technology, law, ethics, and social issues, including cultural and ethnic diversity. This course is the same as CMED 300, and only one may be taken for credit. JOUR 335 INTRODUCTION TO DESKTOP PUBLISHING 2 UNITS Prerequisite: None Advisory: CISC 300 or 302 or 310; or JOUR 330. Course Transferable to CSU Hours: 27 hours LEC ; 27 hours LAB This course will cover the introductory elements of desktop publishing. The course is taught in three modules with a project attached to each module. The course covers hardware and software, elements of design, computer graphics, text composition, page layout, and integration of text and graphics. Projects may include, but are not limited to: business cards, stationery, logos, covers, Á\HUVEURFKXUHVDQGQHZVOHWWHUV6WXGHQWVPD\UHFHLYHWZRXQLWVFUHGLWIRU HDFKWRSLFRIIHUHG&RQVXOWWKHFODVVVFKHGXOHIRUVSHFLÀFWRSLFV1RWRSHQWR students who have received credit for CISA 330. JOUR 336 INTERMEDIATE DESKTOP PUBLISHING 2 UNITS Prerequisite: CISA 330 or JOUR 335. Course Transferable to CSU Hours: 27 hours LEC ; 27 hours LAB This course will cover the intermediate elements of desktop publishing. The course is taught in three modules with a project attached to each module. The course covers intermediate hardware and software, elements of intermediate GHVLJQJUDSKLFVDQGWH[WFRPSRVLWLRQPXOWLSDJHOD\RXWGHVLJQIRUSXEOLVKLQJ SUHVHQWDWLRQVSURMHFWPDQDJHPHQWDQGVLQJOHDQGPXOWLSDJHGRFXPHQWV Projects may include, but are not limited to: reports, slicks, slides, overheads, posters, transparencies, billboards, brochures, and newsletters. Students may receive two units credit for each topic offered. Consult the class schedule for VSHFLÀFWRSLFV5HFRPPHQGHGVXSSOHPHQWDOFRXUVHV &,6$ $5&+RU$57 320; and CISA 340. Not open to students who have received credit for CISA 331. JOUR 340 WRITING FOR PUBLICATION 3 UNITS Prerequisite: ENGWR 300 or JOUR 300. Course Transferable to CSU Hours: 54 hours LEC :ULWLQJQRQÀFWLRQIRUSXEOLFDWLRQZLWKHPSKDVLVRQGHYHORSLQJZULWLQJVW\OH 7KHFRXUVHFRYHUVZULWLQJIRUVSHFLÀFDXGLHQFHVZULWLQJPDJD]LQHDQGIHDWXUH articles, researching and interviewing and developing an effective prose style. 6WXGHQWVZLOOOHDUQKRZWRZULWHUHYLHZVSURÀOHVSHUVRQDOQDUUDWLYHVDQGORQJHU articles and how to sell them. 196 Library Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Library COUNSELING Rancho Cordova Center - 916-255-0717 The Folsom Lake College Library courses teach vital Library (LIBR) research skills that enable students to achieve success in their college classes, their careers, and their day-to- LIBR 318 LIBRARY RESEARCH AND INFORMATION LITERACY day lives. Students will gain “research survival skills” to 1 UNIT cope with the information rich environment in which they Prerequisite: None. live. They will develop the ability to access information General Education: AA/AS Area III(b) from a broad range of resources, and to evaluate this Course Transferable to UC/CSU information and its sources. Course study will include Hours: 18 hours LEC information from print, online subscription databases This course will help students acquire the information competency skills and the Internet. QHFHVVDU\WRFRQGXFWDFDGHPLFRUSHUVRQDOUHVHDUFK,WSURYLGHVDVWHSE\ step guide to the research process that is applicable to term papers, course FLC Librarians also offer non-credit library instruction ZRUNDQGOLIHORQJOHDUQLQJ,WHPSKDVL]HVGHYHORSLQJHIIHFWLYHVHDUFK sessions, demonstrating the use of library resources and strategies, selecting information tools, locating and retrieving information the Internet. A schedule of our drop-in library instructions sources, analyzing and critically evaluating information, organizing and using is available on the library home page. Please stop by information. the reference desk to pick up a helpful handout, obtain individual assistance, or for more information. LIBR 499 EXPERIMENTAL OFFERING IN LIBRARY .5-4 UNITS Prerequisite: None Students interested in a paraprofessional library career Course Transferable to CSU can complete the Library and Information Technology Hours: 18 hours LEC ; 54 hours LAB program available at Sacramento City College. Students interested in a professional library career need a bachelor’s degree and a graduate Library and Information Science degree. Highlights Become familiar with academic library organization. Learn how to select and use appropriate information sources. Develop skills to effectively design online search strategies. Learn how to evaluate print and online information resources. Folsom Lake College 2011-2012 Management 197 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Management COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE A.A. - Management DEGREE A.A. — Management This broad-based management program offers REQUIRED PROGRAM ...... Units introductory courses as well as more specialized ACCT 301 Financial Accounting ...... 4 ones ranging from studies of the standard corporate ACCT 311 Managerial Accounting ...... 4 organization to analyzing the small business. BUS 300 Introduction to Business ...... 3 BUS 330 Managing Diversity in the Workplace ..3 Managers help organizations achieve their objectives BUS 340 Business Law ...... 3 through effective planning, organizing, directing, and CISC 310 Intro to Computer Information Science or controlling. The management program attempts to Any three (3) additional units selected from: ...... develop an understanding of the importance and diversity CISA 300, 308, 310, 320, 330, CISC 300, 308, RILWVUHODWHGÀHOGV 320 ...... 3 This program prepares students for entry into a company ECON 302 Principles of Macroeconomics or management training program and upgrades the skills ECON 320/BUS 320 Concepts of Personal Finance of those already working in industry, allowing them to ...... 3 advance to supervisory positions. Students planning MGMT 362 Techniques of Management ...... 3 vocations in personnel services or analyst positions in MGMT 372 Human Relations & Organizational state or federal government service should also consider Behavior ...... 3 this degree program. TOTAL UNITS REQUIRED ...... 29 Career Options This A.A. degree may be obtained by completion of the Branch Manager; Department Manager; First-line Required Program, plus General Education Requirements, 6XSHUYLVRU 2IÀFH 0DQDJHU 3ODQW 0DQDJHU 3URMHFW SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Manager; Entrepreneur; Shift Supervisor; Small Business Owner/Manager This program prepares students for entry into a company management training programs and upgrades the skills of Some career options may require more than two years of those already working in industry, allowing them to advance college study. to supervisory positions. Students planning vocations in personnel services or analyst positions in state or federal Highlights government service should also consider this degree program. Additional training in courses acceptable as electives for civil service professional occupations Upon completion of this program, the student will be able to: Hands-on experience in the use of computers for Incorporate leadership skills and abilities that are business purposes effective in managing a multicultural workforce. Opportunities for work experience in local industry, Analyze practical business problems. business, and government Apply current management philosophies to current A lab with tutorial assistance management problems. Integrate management principles in relationship to ÀQDQFHSHUVRQQHOSURGXFWVVHUYLFHVDQGLQIRUPDWLRQ Communicate effectively verbally and in writing in various business settings. Utilize critical thinking and research skills in the evaluation of alternative solutions. 198 Management Folsom Lake College 2011-2012 MGMT 360 MANAGEMENT COMMUNICATION 3 UNITS Management (MGMT) Prerequisite: None. Advisory: MGMT 362 MGMT 308 PERSONNEL AND HUMAN RESOURCES General Education: AA/AS Area II(b) MANAGEMENT 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Course Transferable to CSU This course provides skill training in utilizing communication opportunities in Hours: 54 hours LEC organizations that includes the study of the communication process, the analysis This course presents the student with the materials necessary to begin the of the barriers to effective oral and written communication, and the development complex study and analysis of such areas as civil rights, labor law, the personnel of guidelines to improve interpersonal relations within an organization through “Human Resources” organization and various management theories currently the effective methods of oral and written communications. found in both public and private sector organization. MGMT 362 TECHNIQUES OF MANAGEMENT 3 UNITS MGMT 310 INTRODUCTION TO PUBLIC MANAGEMENT 3 UNITS Prerequisite: None. Prerequisite: None. Course Transferable to CSU Course Transferable to CSU Hours: 54 hours LEC Hours: 54 hours LEC This course is designed for entrepreneurs and other managers as well as those 7KLVFRXUVHSURYLGHVDQLQWURGXFWLRQWRWKHÀHOGRISXEOLFPDQDJHPHQW,W HQWHULQJPLGPDQDJHPHQWSRVLWLRQV,WIRFXVHVRQSULPDU\PDQDJHPHQW introduces students to the fundamental components of public management functions of planning, organizing, controlling, and leading. Related skills including public organizational relations and roles, leadership, ethics, such as time management, cost control, performance evaluation, motivation, fiscal management and policymaking. It also addresses the political, communication techniques, and the social responsibility of managers are intergovernmental, and external environments in which public managers also emphasized. The course provides a clear understanding of management function. and leadership tasks as well as skill development in essential management activities. MGMT 311 INTRODUCTION TO PUBLIC FINANCIAL ADMINISTRATION 3 UNITS MGMT 372 HUMAN RELATIONS AND ORGANIZATIONAL Prerequisite: None. BEHAVIOR 3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Course Transferable to CSU 7KLVFRXUVHSURYLGHVDQRYHUYLHZWRWKHÀHOGRI3XEOLF)LQDQFLDO$GPLQLVWUDWLRQ Hours: 54 hours LEC ,WH[DPLQHVÀQDQFLDODGPLQLVWUDWLRQLQSXEOLFDQGQRWIRUSURÀWRUJDQL]DWLRQV This course emphasizes the psychology of human relations management. 7RSLFVLQFOXGH FRQFHSWVDQGDFWLYLWLHVLQSXEOLFÀQDQFLDOPDQDJHPHQWEXGJHWLQJ ,WFRYHUVKXPDQLQWHUDFWLRQSULQFLSOHVWKDWEXLOGFRQÀGHQFHFRPSHWHQFH WD[DWLRQUHYHQXHSODQQLQJERUURZLQJÀVFDOFRQWUROVDQGWKHDQDO\WLFDOVNLOOV leadership and management plans and positive attitudes in work organizations. QHHGHGWRGLUHFWDQGFRQWUROSXEOLFÀVFDODFWLYLWLHV Topics include the basis for human behavior, perception, communication, motivation, performance improvement, group behavior, negotiation, ethics MGMT 315 GOVERNMENT RELATIONS AND POLICY DEVELOPMENT and social responsibility. 3 UNITS Prerequisite: None. MGMT 495 INDEPENDENT STUDIES IN MANAGEMENT 1-3 UNITS Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Course Transferable to CSU This course provides a practical overview of the public policy process and its Hours: 54 hours LEC ; 3 hours LAB LPSOLFDWLRQIRUJRYHUQPHQWGHFLVLRQPDNLQJ,WH[SORUHVDQXPEHURIFRQFHSWV associated with policy analysis and aims to provide students with practical KDQGVRQVNLOOVWKDWFDQEHXVHGLQDYDULHW\RISROLF\VHWWLQJV7RSLFVFRYHUHG in this course will include policy writing and research, political lobbying, the legislative process, stakeholder consensus building, and ethics in policy making. Folsom Lake College 2011-2012 Management 199 MGMT 498 WORK EXPERIENCE IN MANAGEMENT 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity, or job related to management. Students are advised to FRQVXOWZLWKWKH0DQDJHPHQW%XVLQHVV'HSDUWPHQWWRUHYLHZVSHFLÀFFHUWLÀFDWH and degree work experience requirements. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. MGMT 499 EXPERIMENTAL OFFERING IN MANAGEMENT .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 200 Marketing Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Marketing COUNSELING Rancho Cordova Center - 916-255-0717 CISC 310 Intro to Computer Information Science (3) DEGREE A.A. - Marketing or Three (3) units to include: Marketing is a dynamic area of study that provides CISC 300 Computer Familiarization (1) and immediate job and career opportunities after one Any two (2) additional units selected from: course or the completion of a degree. The skills learned CISA 300, CISA 310, CISA 320, CISA 340, CISC 320 are easily converted into well-paying careers by many ECON 302 Principles of Macroeconomics or students. There is no limit to your success when these areas ECON 320/BUS 320 Concepts of Personal Finance of study are utilized successfully. The skills learned are ...... 3 essential for international and domestic business and for MGMT 362 Techniques of Management ...... 3 companies large and small. MKT 300 Principles of Marketing ...... 3 MKT 310 Selling Professionally ...... 3 Career Options MKT 312 Retailing or Buyer; Account Executive; Entrepreneur; Investment BUS 350 Small Business Management Entrepreneurship Counselor; Marketing Services; Stockbroker; Purchasing or Agent; Salesperson; Shipping Clerk; Marketing Manager; Three (3) units selected from: Export/Import BUS 210, 212, 214, 224 ...... 3 MKT 314 Advertising ...... 3 Some career options may require more than two years of BUS 498 Work Experience (3) or college study. Human/Career Dev. (any course combination) ...... 3 TOTAL UNITS REQUIRED ...... 41-42 Highlights Additional training in courses acceptable as Suggested Electives: CISA 340, CISA 330; RE 300 electives for civil service professional occupations Opportunities for Work Experience in local industry This A.A. degree may be obtained by completion of the and business Required Program, plus General Education Requirements, Training in a career where one third of the SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO presidents of Fortune 500 corporations have marketing backgrounds The Marketing degree provides an opportunity for students Coursework in international marketing to acquire knowledge and training for careers in sales, A lab with tutorial assistance advertising, and marketing. Marketing is a dynamic area of study that provides immediate job and career opportunities. DEGREE The competency-based curriculum is designed to prepare A.A. — Marketing students for a variety of positions and to provide basic training for advancement to management positions and for REQUIRED PROGRAM ...... Units transfer to four-year universities ACCT 101 Fundamentals of College Accounting (3) or Upon completion of this program, the student will be able to: ACCT 301 Financial Accounting (4) ...... 3-4 Integrate the functions of the marketing mix. BUS 300 Introduction to Business ...... 3 Plan, produce, and select the appropriate media for BUS 310 Business Communication ...... 3 advertising. BUS 330 Managing Diversity in the Workplace ..3 Identify and examine consumer buyer behavior and BUS 340 Business Law ...... 3 evaluate which marketing communications medium will BUSTEC 302 Computer Keyboarding ...... 2 most effectively meet needs of the marketplace. Incorporate principles of product development, pricing, distribution strategies, promotion strategies and market research. Apply the marketing mix to create and analyze various marketing strategies. Folsom Lake College 2011-2012 Marketing 201 MKT 312 RETAILING 3 UNITS Marketing (MKT) Prerequisite: None. Course Transferable to CSU MKT 120 SURVEY OF INTERNATIONAL BUSINESS 3 UNITS Hours: 54 hours LEC Prerequisite: None This course will study modern retail operations with emphasis on consumer Hours: 54 hours LEC behavior, store location and layout, sourcing of goods, pricing, organization, This course is a comprehensive overview of international business designed promotion, management and other pertinent factors of retail operations. to provide both beginners and experienced business people with a global perspective on international trade including foreign investments, impact of MKT 314 ADVERTISING 3 UNITS ÀQDQFLDOPDUNHWVDQGWKHRSHUDLWRQRIPXOWLQDWLRQDOFRUSRUDWLRQV Prerequisite: None. Course Transferable to CSU MKT 122 INTERNATIONAL MARKETING 3 UNITS Hours: 54 hours LEC Prerequisite: None 7KLVFRXUVHLVDQLQWURGXFWLRQWRWKHÀHOGRIDGYHUWLVLQJLWVKLVWRU\SXUSRVH Hours: 54 hours LEC institutions, and functions. Studies are made of the various media used in This course presents the problems of marketing in the international marketplace general advertising, as well as the effective use of these media. Students will and how marketers approach and solve them. The course focuses on concepts produce ads and advertising campaigns. and principles by teaching the theory and practice of international marketing through the use of practical examples and actual case studies of international, MKT 330 INTERNET MARKETING 3 UNITS both United States and foreign, marketing organizations. Studies include: Prerequisite: None. international marketing position of the United States, market entry strategies, Course Transferable to CSU analysis of foreign markets, culture and marketing, product design, pricing, Hours: 54 hours LEC distribution, promotion and sales. This course is designed to provide both the novice and skilled business person with a working knowledge of how to use Internet marketing. Students will MKT 295 INDEPENDENT STUDIES IN MARKETING 1-3 UNITS be introduced on how to interact with specialists to devise strategies that Prerequisite: None build customer relations through technological strategies. These specialists Hours: 18 hours LEC ; 54 hours LAB may include network specialists, systems analysts, graphic designers, or web MKT 299 EXPERIMENTAL OFFERING IN MARKETING .5-4 UNITS masters. Students will have a good understanding of how this technology can Prerequisite: None be used to help his/her business be more successful. Hours: 18 hours LEC ; 54 hours LAB MKT 495 INDEPENDENT STUDIES IN MARKETING 1-3 UNITS MKT 300 PRINCIPLES OF MARKETING 3 UNITS Prerequisite: None Prerequisite: None Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC This course is a general overview of marketing principles. The course covers MKT 498 WORK EXPERIENCE IN MARKETING 1-4 UNITS the process of planning and executing the conception, pricing, promotion, and Prerequisite: None. distribution of ideas, goods and services to create exchanges that satisfy Advisory: ENGWR 101 individual and organizational goals. Elements of the marketing environment General Education: AA/AS Area III(b) such as government regulation, environmental protection, competition, and (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS consumer behavior will be analyzed. volunteer opportunity or job related to career goals. Course Transferable to CSU MKT 310 SELLING PROFESSIONALLY 3 UNITS +RXUV KRXUV/$% Prerequisite: None. This course provides students with opportunities to develop marketable skills Advisory: BUS 105 and ENGWR 101 in preparation for employment or advancement within their current job. Course Enrollment Limitation: None content will include understanding the application of education to the workforce; Course Transferable to CSU completion of required forms, which document the student’s progress and hours Hours: 54 hours LEC spent at the work site; and developing workplace skills and competencies. This course examines the elements of successful professional selling. This course 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU emphasizes the development of a business personality and its application orientation and 75 hours of related paid work experience, or 60 hours of to the approach, direction, and closing of a sale. Different types of selling unpaid work experience, for one unit. An additional 75 or 60 hours of related experience such as direct, industrial, wholesale, and retail are covered. This work experience is required for each additional unit. The course may be taken FODVVLVUHFRPPHQGHGIRUWKRVHHQWHULQJDQ\ÀHOGRIEXVLQHVVFDUHHUV four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. 202 Marketing Folsom Lake College 2011-2012 MKT 499 EXPERIMENTAL OFFERING IN MARKETING .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Mathematics & Statistics 203 Mathematics & Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Statistics COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE DEGREE A.S. - Mathematics A.S. — Mathematics Mathematics is a multifaceted subject of great beauty REQUIRED PROGRAM ...... Units and application. The study of mathematics explores some MATH 400 Calculus I ...... 5 of the deepest puzzles that have ever been encountered MATH 401 Calculus II ...... 5 and equips the student with a universal language used to MATH 402 Calculus III ...... 5 VWXG\TXDQWLWLHVDQGUHODWLRQVKLSVLQDOOÀHOGV7KHVWXG\ MATH 410 Introduction to Linear Algebra ...... 3 of mathematics provides students with the ability to MATH 420 Differential Equations ...... 4 think logically and abstractly and develop the problem- Plus select one of the following courses: ...... 4 solving and computational skills necessary for success in CISP 360 Introduction to Structured Programming (4) DQ\ÀHOGRIVWXG\ CISP 370 Beginning Visual BASIC (4) TOTAL UNITS REQUIRED ...... 26 Career Options Actuary; Architecture; Assessor; Auditor; Biologist; Budget Associate of Science Degree (A.S.) may be obtained by Analyst; Chemist; Controller; Computer Programmer; completion of the Required Program, plus General Education Demographer; Dentist; Doctor; Economist; Engineering; UHTXLUHPHQWVSOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Epidemiologist; Finance; Mathematician; Operations Researcher; Statistician; Public Opinion Analyst; Surveyor; Systems Analyst; Teacher; Veterinary Science This degree is designed to allow students to meet common lower division requirements for a major in mathematics at Most of these careers require education beyond the two- many four-year transfer institutions. Required courses for year college level. WKLVGHJUHHPD\DOVRIXOÀOOORZHUGLYLVLRQUHTXLUHPHQWVIRU four-year degrees in computer science and engineering. Highlights Upon completion of this program, the student will be able to: A professional and innovative staff committed to providing the best possible mathematics education Apply quantitative thinking processes and reasoning skills A comprehensive mathematics curriculum addressing in upper division academic work and/or workplace tasks. the needs of both the transfer student and the non- Recognize and construct valid arguments using deductive transfer student and inductive reasoning skills. A program that uses assessment for proper 'HÀQH DQG XWLOL]H WHUPLQRORJ\ RI PDWKHPDWLFV ZLWK placement of students emphasis in calculus, linear algebra, and either statistics, logic or problem solving. Communicate mathematical concepts to varied audiences. Solve problems collaboratively. Use mathematical tools essential to success in upper division math courses. Select learning strategies that are appropriate for them 204 Mathematics & Statistics Folsom Lake College 2011-2012 MATH 120 INTERMEDIATE ALGEBRA 5 UNITS Mathematics (MATH) Prerequisite: MATH 100 with a grade of “C” or better; or placement through the assessment process. MATH 20 ARITHMETIC 5 UNITS General Education: AA/AS Area II(b) Prerequisite: None. Hours: 90 hours LEC Hours: 90 hours LEC This course reviews and extends the concepts of elementary algebra with This course provides group and individual instruction in the fundamentals of problem solving skills emphasized throughout. Topics which are reviewed arithmetic with an emphasis on written and mental computational skills. In order and extended include: linear and quadratic equations, factoring polynomials, to enhance mental computational skills, calculators will not be allowed. Topics rational expressions, exponents, radicals, equations of lines, and systems include operations with whole numbers, fractions, decimals, signed numbers, of equations. New topics include: absolute value equations and inequalities, percents, ratios, proportions, problem solving, and applications involving UDWLRQDOH[SRQHQWVWUDQVODWLRQVDQGUHÁHFWLRQVRIJUDSKVIXQFWLRQQRWDWLRQDQG measurement and geometry. function operations, exponential and logarithmic functions, graphs of quadratic DQGVLPSOHSRO\QRPLDOIXQFWLRQVTXDGUDWLFLQHTXDOLWLHVQRQOLQHDUV\VWHPVRI MATH 30 PRE-ALGEBRA MATHEMATICS 5 UNITS equations, and an introduction to conic sections. Prerequisite: MATH 20 with a grade of “C” or better; or placement through the assessment process. MATH 295 INDEPENDENT STUDIES IN MATHEMATICS 1-3 UNITS Hours: 90 hours LEC Prerequisite: None 7KLVFRXUVHLQSUHDOJHEUDPDWKHPDWLFVHPSKDVL]HVWKHIXQGDPHQWDORSHUDWLRQV Hours: 18 hours LEC ; 54 hours LAB RQLQWHJHUVDQGGHFLPDOVDVZHOODVLQJHRPHWULFÀJXUHVPHDVXUHPHQWDQG algebra. Topics include: fractions; decimals; signed numbers; properties of MATH 299 EXPERIMENTAL OFFERING IN MATHEMATICS H[SRQHQWV VFLHQWLÀFQRWDWLRQ HYDOXDWLRQRIH[SUHVVLRQVDQGIRUPXODV OLQHDU .5-4 UNITS equations; algebraic manipulations on polynomials; and the rectangular Prerequisite: None coordinate system. Hours: 18 hours LEC ; 54 hours LAB MATH 310 MATHEMATICAL DISCOVERY 3 UNITS MATH 100 ELEMENTARY ALGEBRA 5 UNITS Prerequisite: MATH 110 (or Geometry), AND MATH 120 both with a grade of “C” Prerequisite: MATH 30 with a grade of “C” or better; or placement through or better; or equivalent skills demonstrated through the assessment process. the assessment process. General Education: AA/AS Area II(b); CSU Area B4 Hours: 90 hours LEC Course Transferable to CSU This course includes the fundamental concepts and operations of algebra with Hours: 54 hours LEC problem solving skills emphasized throughout. Topics include: properties of This course is designed to enhance students’ understanding of mathematics real numbers, linear equations and inequalities, integer exponents, polynomials, by involving them in the mathematical process of exploration, conjecture, and factoring polynomials, rational expressions and equations, radical expressions proof. Students will explore mathematical patterns and relations, formulate and equations, systems of linear equations and inequalities, the rectangular conjectures, and prove their conjectures. Areas of mathematics from which coordinate system, graphs and equations of lines, and solving quadratic content may be derived include number theory, statistics, probability, geometry, equations. and sequences and series. This course is recommended for students interested MATH 110 ELEMENTARY GEOMETRY 5 UNITS in a career in education. Prerequisite: MATH 100 with a grade of “C” or better; or placement through MATH 335 TRIGONOMETRY WITH COLLEGE ALGEBRA 5 UNITS the assessment process. Prerequisite: Math 120 (Intermediate Algebra) and Geometry; both with a grade General Education: AA/AS Area II(b) of “C” or better; or placement through the assessment process. Hours: 90 hours LEC General Education: AA/AS Area II(b); CSU Area B4 This course covers aspects of elementary geometry. Topics include terms and Course Transferable to CSU GHÀQLWLRQVSURSHUWLHVRISDUDOOHOOLQHVDQGSDUDOOHORJUDPVFRQJUXHQWDQG Hours: 90 hours LEC similar triangles, properties of triangles, right triangles, and basic trigonometry. This is a full trigonometry course with college algebra concepts reviewed, Later topics include properties of circles, construction of loci, areas, and extended, and integrated when they are relevant to the trigonometric volumes. The course also emphasizes problem solving strategies, elementary concepts. The trigonometric topics include right triangle trigonometry, unit logic, and reading and writing proofs. circle trigonometry, graphs of trigonometric functions, proofs of trigonometric identities, solving trigonometric equations, applications of trigonometric functions (laws of sines and cosines), inverse trigonometric functions, polar coordinates, graphing polar functions, and vectors. The algebra topics include exponential and logarithmic functions, complex numbers, in addition to solving equations, inequalities, and systems of equations. Folsom Lake College 2011-2012 Mathematics & Statistics 205 MATH 343 MODERN BUSINESS MATHEMATICS 4 UNITS MATH 400 CALCULUS I 5 UNITS Prerequisite: MATH 120 with a grade of “C” or better; or placement through Prerequisite: MATH 370 with a grade of “C” or better; or placement through the assessment process. the assessment process. General Education: AA/AS Area II(b); CSU Area B4 General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 Course Transferable to CSU Course Transferable to UC/CSU Hours: 72 hours LEC Hours: 90 hours LEC This course is designed around applications of mathematics in an economic and This course explores the basic concepts of analytic geometry, limits of functions, EXVLQHVVFRQWH[W7KHPDMRUWRSLFVLQFOXGHGDUHIXQFWLRQVÀQDQFH LQWHUHVWDQG GHULYDWLYHVDQGLQWHJUDOV7RSLFVFRYHUHGZLOOLQFOXGHÀQGLQJWKHOLPLWVRI exponential models), rates of change, optimization, and linear programming. functions by graphing and indeterminate forms of algebraic expressions. The content of the course is structured to incorporate tables, graphs and data Graphing, derivatives, and integrals involving algebraic, trigonometric, VHWVFROOHFWHGIURPUHDOZRUOGVLWXDWLRQV7KLVFRXUVHLVQRWUHFRPPHQGHGIRU exponential, logarithmic, and inverse trigonometric functions will also be mathematics or physical science majors. covered. Many applications will be covered, including those involving rectilinear PRWLRQGLIIHUHQWLDOVUHODWHGUDWHVJUDSKLQJRSWLPL]DWLRQDQGÀQGLQJDUHDV MATH 350 CALCULUS FOR THE LIFE AND SOCIAL SCIENCES I of bounded regions. 3 UNITS Prerequisite: MATH 335 with a grade of “C” or better; or placement through MATH 401 CALCULUS II 5 UNITS the assessment process. Prerequisite: MATH 400 with a grade of “C” or better General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 90 hours LEC This course is an introduction to calculus. Topics include functions, trigonometric This course is a continuation of MATH 400. Topics covered include techniques of functions, limits, analytic geometry, and differential calculus with applications LQWHJUDWLRQQXPHULFDOLQWHJUDWLRQLPSURSHULQWHJUDOVLQÀQLWHVHULHVSDUDPHWULF to business, social, and biological sciences. This course is intended for students equations, polar coordinates, and conic sections. Many applications will be majoring in social and biological sciences. covered including those involving areas between plane regions, volumes of revolution, work, moments and concepts of mass, average value, arc length, MATH 351 CALCULUS FOR THE LIFE AND SOCIAL SCIENCES II and surface area. 3 UNITS Prerequisite: MATH 350 with a grade of “C” or better MATH 402 CALCULUS III 5 UNITS General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 Prerequisite: MATH 401 with a grade of “C” or better Course Transferable to UC/CSU General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 Hours: 54 hours LEC Course Transferable to UC/CSU 7KLVFRXUVHLVDFRQWLQXDWLRQRI0$7+7RSLFVLQFOXGH GHÀQLWHDQGLQGHÀQLWH Hours: 90 hours LEC integrals, power series, analytic geometry, multivariate calculus, and differential 7KLVFRXUVHH[WHQGVWKHFRQFHSWVRIOLPLWVGHULYDWLYHVDQGLQWHJUDOVWRYHFWRU equations with applications to business, social, and biological sciences. Not valued functions and functions of more than one variable. Topics covered will open to students who have received credit for MATH 401 or higher level LQFOXGHWKUHHGLPHQVLRQDODQDO\WLFJHRPHWU\DQGYHFWRUVSDUWLDOGHULYDWLYHV mathematics course. multiple integrals, line integrals, surface integrals, and the theorems of Green, Gauss (Divergence), and Stokes. Many applications of the calculus will MATH 370 PRE-CALCULUS MATHEMATICS 5 UNITS be included. Prerequisite: MATH 335 with a grade of “C” or better; or placement through the assessment process. MATH 410 INTRODUCTION TO LINEAR ALGEBRA 3 UNITS General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 Prerequisite: MATH 400 with a grade of “C” or better Course Transferable to UC/CSU General Education: AA/AS Area II(b); CSU Area B4 Hours: 90 hours LEC Course Transferable to UC/CSU 7KLVFRXUVHLVGHVLJQHGWRSUHSDUHVWXGHQWVIRU&DOFXOXV 0$7+ Hours: 54 hours LEC &RXUVHFRQWHQWLQFOXGHVDEULHIUHYLHZIROORZHGE\DQLQGHSWKH[WHQVLRQRIWKH This course introduces linear algebra. Topics include matrices, determinants, properties of polynomial, rational, exponential, logarithmic and trigonometric systems of equations, vector spaces, linear transformations, eigenvectors, and IXQFWLRQV$GGLWLRQDOWRSLFVLQFOXGHV\VWHPVRIOLQHDUDQGQRQOLQHDUHTXDWLRQV applications. This course is intended for majors in mathematics, engineering, and inequalities, conic sections, sequences and series, binomial theorem, VFLHQFHDQGUHODWHGÀHOGV analytic geometry, vectors, parametric, and polar equations. A graphing calculator may be required for this course. 206 Mathematics & Statistics Folsom Lake College 2011-2012 MATH 420 DIFFERENTIAL EQUATIONS 4 UNITS Prerequisite: MATH 401 with a grade of “C” or better Mathematics - Statistics (STAT) General Education: AA/AS Area II(b); CSU Area B4 Course Transferable to UC/CSU STAT 300 INTRODUCTION TO PROBABILITY AND STATISTICS Hours: 72 hours LEC 4 UNITS This course will cover the theory and the applications of the solutions of ordinary Prerequisite: MATH 120 with a grade of “C” or better; or placement through differential equations and systems of ordinary differential equations. Students the assessment process. will be introduced to various topics useful in the solution of these differential General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 equations including power series, Laplace transforms, matrices, eigenvalues Course Transferable to UC/CSU and eigenvectors, and numerical methods. Hours: 72 hours LEC This course is an introduction to probability and statistics. Topics include: MATH 495 INDEPENDENT STUDIES IN MATHEMATICS 1-3 UNITS elementary principles and applications of descriptive statistics, counting Prerequisite: None principles, elementary probability principles, probability distributions, Course Transferable to CSU estimation of parameters, hypothesis testing, linear regression and correlation, Hours: 18 hours LEC ; 54 hours LAB DQG$129$$VFLHQWLÀFRUJUDSKLQJFDOFXODWRUZLWKWZRYDULDEOHVWDWLVWLFV capabilities may be required. MATH 499 EXPERIMENTAL OFFERING IN MATHEMATICS .5-4 UNITS STAT 495 INDEPENDENT STUDIES IN STATISTICS 1-3 UNITS Prerequisite: None Prerequisite: None Course Transferable to CSU Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 18 hours LEC ; 54 hours LAB STAT 499 EXPERIMENTAL OFFERING IN STATISTICS .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Mathematics & Statistics 207 FOLSOM LAKE COLLEGE MATH SEQUENCE Based on the results of my assessment, I place in the following classes: MATH 20 Arithmetic [non-degree applicable / non-transferable] MATH 30^ Pre-Algebra [non-degree applicable / non-transferable] MATH 100^ Elementary Algebra Transfer students other than Architecture, CIS, Transfer students with Architecture, CIS, Engineering, Engineering, Math, Preprofessional or Science majors Math, Preprofessional or Science majors MATH 120^ MATH 110^ MATH 120^ MATH 110^ Intermediate Algebra Elementary Geometry Intermediate Algebra Elementary Geometry [AA / AS applicable, [AA / AS applicable, [AA / AS applicable, [AA / AS applicable, meets AA / AS competency] meets AA / AS competency] meets AA / AS competency] meets AA / AS competency] If Geometry is If Geometry is on transcript (grade of C or better) on transcript (grade of C or better) MATH 335^ Trigonometry with College Algebra [CSU]* MATH 343^ MATH 310^ Math Discovery Modern Business Mathematics MATH 370^ MATH 350^ [CSU]* [CSU]* Calculus for the Life & Social Pre-Calculus Math Sciences [CSU / UC]* [CSU / UC]* STAT 300^ Intro to Probability & Statistics MATH 400^ MATH 351 Calculus for the Life & Social [CSU / UC]* Analytic Geometry & Calculus I Sciences II [CSU / UC]* [CSU / UC]* MATH 401 MATH 410 Analytic Geometry & Calculus II Intro to Linear Algebra [CSU / UC]* [CSU / UC]* MATH 402 MATH 420 Analytic Differential Equations Geometry & Calculus III [CSU / UC]* [CSU / UC]* Revised 3/09 KEY: * = Speak with a Counselor for Transfer Information ^ = Eligibility can be determined by Assessment Process NOTE: Current as of March 2010; subject to change 208 Music Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Music COUNSELING Rancho Cordova Center - 916-255-0717 MUFHL 310 SURVEY OF MUSIC HISTORY AND LITERATURE The Folsom Lake College music program includes vocal 3 UNITS and instrumental components as well as courses on music, Prerequisite: None. and music history. The program in music is designed to General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A provide students with a foundation in music, to gain an Course Transferable to UC/CSU appreciation of and an interest in pursuing music as a Hours: 54 hours LEC hobby or career. This course is a historical survey of Western music from Greek antiquity through the Baroque period (c. 1750), emphasizing the relation of music to social, Career Options cultural, economic and political factors involved in creating the music. This Music Education; Public and Private Teaching; Vocal course is required for music majors and designed for those students particularly Performance; Instrumental Performance; Music Store interested in the humanities and the arts. Employment & Management; Church Music Direction; Composer MUFHL 311 SURVEY OF MUSIC HISTORY AND LITERATURE 3 UNITS Some career options may require more than two years Prerequisite: ENGWR 101 and ESLW 320 with grades of “C” or better of college study. Classes beyond the associate degree General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A PD\EHUHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRU Course Transferable to UC/CSU preparation for transfer to a university program. Hours: 54 hours LEC This course is a historical survey of Western classical music from the 18th Highlights century Enlightenment through modern times. Students use listening exercises Various avenues for vocal performance – college and readings to study the development of classical music in historical and chorus, choir, chamber singers. cultural contexts. Students study the aesthetic principles and values from A very talented and highly motivated staff various eras to develop their own musical and artistic judgments. The course meets the requirement for music majors. MUFHL 321 BASIC MUSICIANSHIP 3 UNITS Music - Fundamentals, History, Prerequisite: None. & Literature (MUFHL) General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU MUFHL 300 INTRODUCTION TO MUSIC 3 UNITS See UC Limitations & Counselor Prerequisite: None. Hours: 54 hours LEC General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A This course is an introduction to the fundamentals of music. Students will learn Course Transferable to UC/CSU basic music terminology and develop skill in reading music notation, including See UC Limitations & Counselor the staff, notes, rhythms, intervals, scales, chords, keys, and key signatures. Hours: 54 hours LEC Musical literacy and creativity will be reinforced by aural and rhythmic drills, This course is an introduction to music of the Western Tradition. Students the use of music software, and short, creative assignments. Works from classical will develop analytical listening skills to access and comprehend meanings, and commercial music will be used for demonstration purposes. Recommended functions, and perspectives of music production specific to traditionally for students with little or no music experience. understood eras in art history, such as Medieval, Renaissance, Baroque, Classical, Romantic, Twentieth Century, and Contemporary. Students will learn KRZVRFLDODVSHFWVVXFKDVUDFHDJHHWKQLFLW\JHQGHUDQGVRFLRHFRQRPLF IRUFHVLQÁXHQFHWKHZD\VLQZKLFKPXVLFLVSURGXFHGDQGUHFHLYHGLQDYDULHW\ of social, historical, and cultural contexts. Folsom Lake College 2011-2012 Music 209 MUFHL 330 WORLD MUSIC 3 UNITS MUFHL 411 ADVANCED MUSIC THEORY 4 UNITS Prerequisite: None. Prerequisite: MUFHL 410 with a grade of “C” or better General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1; IGETC Area 3A Advisory: MUIVI 351 Course Transferable to UC/CSU Course Transferable to UC/CSU See UC Limitations & Counselor Hours: 54 hours LEC ; 54 hours LAB Hours: 54 hours LEC 7KLVFRXUVHLVDFRQWLQXDWLRQRI08)+/,WLQFOXGHVDPRUHLQGHSWKVWXG\ This course is a comprehensive, comparative listeners’ survey of the folk, ethnic, of 16th and 18th century counterpoint, fugue, variation, altered chords, dance, and ceremonial music traditions around the world and in the United sonata allegro and rondo forms, and late 19th, 20th, and 21st century writing States. Concepts of ethnicity, ethnocentrism, racism, ageism, class differences, techniques including; 9th, 11th and 13th chords, altered dominants, chromatic and gender issues will be addressed. Guided listening presentations will show harmony, serial music, current music idioms, and analysis techniques. Practice how traditional forms and styles have led to the urban, professional music LQUK\WKPLFPHORGLFKDUPRQLFDQGFRQWUDSXQWDOVLJKWVLQJLQJHDUWUDLQLQJDQG popular in many countries today know as “World Beat.” Music of the Americas, dictation. Required for music majors. Africa, Asia, Oceania and Europe will be covered. MUFHL 495 INDEPENDENT STUDIES IN MUSIC FUNDAMENTALS/ MUFHL 400 MUSIC THEORY 4 UNITS HISTORY AND LITERATURE 1-3 UNITS Prerequisite: MUFHL 321 with a grade of “C” or better; or placement through Prerequisite: None the assessment process. Course Transferable to CSU Corequisite: MUIVI 345 Hours: 18 hours LEC ; 54 hours LAB Advisory: MUIVI 345; Students should have some ability to play a musical MUFHL 499 EXPERIMENTAL OFFERING IN MUSIC instrument and read music. Concurrent enrollment in MUIVI 345 is FUNDAMENTALS/HISTORY AND LITERATURE .5-4 UNITS recommended if the student has had no piano study. Prerequisite: None General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC ; 54 hours LAB This course is an introduction to music theory and its applications to classical and commercial music. Students will develop skills in musical analysis, keyboard KDUPRQ\GLFWDWLRQDQGVLJKWVLQJLQJ6KRUWFUHDWLYHDVVLJQPHQWVZLOOEH Music - Instrumental/Voice Instruction included to provide students with experience in the application of materials (MUIVI) learned in class. MUIVI 300 BEGINNING INSTRUMENTS 1-2 UNITS MUFHL 401 MUSIC THEORY 4 UNITS Prerequisite: None. Prerequisite: MUFHL 400 with a grade of “C” or better Advisory: MUFHL 321 Corequisite: MUIVI 346 Course Transferable to UC/CSU General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Hours: 14 hours LEC ; 66 hours LAB Course Transferable to UC/CSU 7KLVLVDEHJLQQLQJOHYHOFRXUVHIRUVWXGHQWVZKRZLVKWRVWXG\DVWULQJ Hours: 54 hours LEC ; 54 hours LAB woodwind, brass, or percussion instrument. Topics of study include technique, 7KLVFRXUVHLVDFRQWLQXDWLRQRI08)+/,WSURYLGHVDPRUHLQGHSWKVWXG\ refining the sound, repertoire, instrument care and maintenance, and of scales, intervals, triads, diatonic harmonies, part writing, rhythms, sight SHUIRUPDQFH$PLQLPXPRIWKUHHDGGLWLRQDOKRXUVRIYHULÀHGSUDFWLFHDZHHN singing, ear training, dictation, history and performance. It includes analysis LVUHTXLUHGIRUWKHWZRXQLWRSWLRQ7KHFRXUVHPD\EHWDNHQIRXUWLPHVIRU and composition and is required for music majors. credit, with different study topics each time. Students must provide their own instrument. MUFHL 410 ADVANCED MUSIC THEORY 4 UNITS Prerequisite: MUFHL 401 with a grade of “C” or better MUIVI 310 VOICE CLASS 2 UNITS Advisory: MUIVI 351; or placement through the assessment process. Prerequisite: None. General Education: CSU Area C1; IGETC Area 3A General Education: CSU Area C1 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 18 hours LAB This course is a continuation of Music Theory (MUFHL 401). It includes the Training in the correct use of the singing voice, vocal techniques, and repertoire. study of 16th and 18th century counterpoint, fugue, variation, altered chords, Required for vocal majors, but open to all students desiring to begin the study borrowed chords, variation technique, sonata form, rondo form, and late 19th of voice. and 20th century writing techniques. Practice in rhythmic, melodic, harmonic and contrapuntal sight singing, ear training and dictation is included in the study. This course is required for music majors. 210 Music Folsom Lake College 2011-2012 MUIVI 311 VOICE CLASS 2 UNITS MUIVI 351 INTERMEDIATE PIANO 2 UNITS Prerequisite: MUIVI 310 with a grade of “C” or better Prerequisite: MUIVI 350. Grade of “C” or better, or the ability to play all major General Education: CSU Area C1 scales, hands together, two octaves and harmonic minor in A, E, B, F, D, and G. Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 18 hours LAB Hours: 24 hours LEC ; 36 hours LAB Training in the correct use of the singing voice, vocal techniques, and repertoire. This course is the second year of piano study. It is a continuation of MUIVI Required for vocal majors, but open to all students desiring the study of voice. 350. The course includes the further development of insight into music as an artistic means of communication through the study of scales, chords, MUIVI 320 VOICE CLASS, INTERMEDIATE 2 UNITS melodic harmonization and repertoire. The course also serves to develop the Prerequisite: MUIVI 311. Grade of “C” or better required to meet prerequisite. IXQGDPHQWDOVNLOOVIRUWKHQRQNH\ERDUGPXVLFPDMRUWRSUHSDUHWKHPIRUD Course Transferable to UC/CSU profession in music. This course is designed to be taken concurrently with Hours: 36 hours LEC ; 18 hours LAB MUFHL 411. 9RFDOH[HUFLVHDQGLQWHOOHFWXDODQDO\VLVIRUWKHGHYHORSPHQWRIHIÀFLHQWVLQJLQJ technique and skill in performing vocal literature. Performance in class and in MUIVI 370 BEGINNING GUITAR 2 UNITS recital is essential. Required for vocal majors. Students may wish to challenge Prerequisite: None. the prerequisite on the basis of equivalent experience. General Education: CSU Area C1 Course Transferable to UC/CSU MUIVI 321 VOICE CLASS, INTERMEDIATE 2 UNITS Hours: 36 hours LEC ; 18 hours LAB Prerequisite: MUIVI 320. Grade of “C” or better required to meet prerequisite. Beginning instruction on the guitar with emphasis on the fundamentals of Course Transferable to UC/CSU PXVLFDVZHOODVEDVLFJXLWDUFKRUGWHFKQLTXHDQGDFFRPSDQLPHQWÀJXUDWLRQV Hours: 36 hours LEC ; 18 hours LAB Practical application of proper singing techniques with emphasis on English and MUIVI 371 INTERMEDIATE GUITAR 2 UNITS Italian diction, and English and Italian literature. Performance in class and in Prerequisite: MUIVI 370 with a grade of “C” or better recital is essential. Required for vocal majors. Students may wish to challenge General Education: CSU Area C1 the prerequisite on the basis of equivalent experience. Course Transferable to UC/CSU Hours: 36 hours LEC ; 18 hours LAB MUIVI 345 BEGINNING PIANO 1-2 UNITS A continuation of MUIVI 370 with emphasis on increased skills in chording, Prerequisite: None arpeggiation, accompaniment, improvisation, melodic reading, and development Advisory: MUFHL 321 (Basic Musicianship); Eligibilitiy for ENGWR 101 or ESLW of personal style. Students may wish to challenge the prerequisite on the basis 320. of equivalent experience. Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB MUIVI 372 ADVANCED GUITAR 2 UNITS This course is an introduction to basic piano playing and it is required for all Prerequisite: MUIVI 371 with a grade of “C” or better JHQHUDODQGFRPPHUFLDOPXVLFPDMRUV7KLVFRXUVHLVWKHÀUVWLQDIRXUVHPHVWHU Advisory: MUFHL 321 sequence designed to develop the student’s keyboard skills at the piano. Course Transferable to CSU Students are advised to have basic music reading skills or have completed Hours: 27 hours LEC ; 27 hours LAB MUFHL 321. The course prepares students who are transferring for piano 7KLVFRXUVHLQFOXGHVKLJKHUOHYHOQRWHUHDGLQJDFFRPSDQLPHQWWHFKQLTXHVDQG SURÀFLHQF\H[DPLQDWLRQ$PLQLPXPRIWZRKRXUVDZHHNRXWVLGHSUDFWLFHLV ensemble playing. The development of personal style is encouraged. Advanced UHTXLUHGIRUWKHWZRXQLWRSWLRQ *XLWDUDOORZVWKHVWXGHQWWRFRQWLQXHVWXG\LQJWKHJXLWDUSDVWWKHÀUVW\HDU Students may wish to challenge the prerequisite on the basis of equivalent MUIVI 346 BEGINNING PIANO 1-2 UNITS experience. Students must provide their own guitar. Prerequisite: MUIVI 345 with a grade of “C” or better. Course Transferable to UC/CSU MUIVI 410 APPLIED MUSIC 1 UNIT Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None Beginning Piano (MUIVI 346) continues piano preparation begun in MUIVI 345. Course Transferable to CSU This course is the second in a sequence of four courses designed to develop Hours: 18 hours LEC the student’s keyboard skills at the piano. This course is designed to be taken 7KLVFRXUVHLQYROYHVRIIFDPSXVLQVWUXPHQWDORUYRFDOVWXG\UHTXLULQJD concurrently with Music Theory (MUFHL 401). The course prepares students who PLQLPXPRIRQHKDOIKRXUSHUZHHNRILQGLYLGXDOVWXG\ZLWKDSULYDWHLQVWUXFWRU DUHWUDQVIHUULQJWRIRXU\HDUGHJUHHJUDQWLQJSURJUDPVIRUWKHSLDQRSURÀFLHQF\ (at student’s expense) for a minimum of 18 weeks. The course meets one hour examination. A minimum of two hours a week outside practice is required for per week on campus for instruction and performance. The course may be taken WKHWZRXQLWRSWLRQ four times for credit. Folsom Lake College 2011-2012 Music 211 MUIVI 420 APPLIED MUSIC 1 UNIT This course is the study and performance of Jazz Band repertoire. Representative Prerequisite: None. repertoire may include selections from Early Jazz to current jazz performance Enrollment Limitation: The student should own a musical instrument appropriate PHWKRGV3XEOLFSHUIRUPDQFHDQGÀHOGWULSVUHTXLUHG0D\EHWDNHQIRXUWLPHV IRUWKHDSSOLHGPXVLFÀHOGRIFKRLFH for credit. Course Transferable to CSU Hours: 8 hours LEC ; 92 hours LAB MUP 350 COLLEGE CHOIR 2 UNITS 7KLVLVWKHÀUVWFRXUVHLQDIRXUSDUWVHULHVDQGRIIHUVLQGLYLGXDOL]HGLQVWUXPHQWDO Prerequisite: MUP 357 with a grade of “C” or better or vocal instruction with a private instructor. It focuses on the development General Education: CSU Area C1 of individual performance skills and solo and ensemble repertoire. Juried Course Transferable to UC/CSU performance is required. Required for all traditional performance and jazz Hours: 18 hours LEC ; 72 hours LAB music majors. Study and performance of standard vocal literature from 16th century to modern period. Students are urged to enter during the freshman year. The course is not MUIVI 495 INDEPENDENT STUDIES IN MUSIC/INSTRUMENTAL/ OLPLWHGWRPXVLFPDMRUVDQGLVRSHQWRDOOTXDOLÀHGVWXGHQWV3XEOLFSHUIRUPDQFHV VOICE INSTRUCTION 1-3 UNITS required. May be taken four times for credit. Prerequisite: None General Education: CSU Area C1 MUP 357 COLLEGE CHORUS 2 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 162 hours LAB General Education: CSU Area C1 Independent study designed to provide instrumental training not offered Course Transferable to UC/CSU in other music courses. Components of the course may include private or Hours: 18 hours LEC ; 54 hours LAB group instructions, solo and ensemble work, accompanying experience, and Designed for the college student who is interested in a musical experience. programmed learning in music fundamentals and music technology. Also for 6WXG\DQGSHUIRUPDQFHRIVWDQGDUGFKRUDOOLWHUDWXUH$QDOOFROOHJHJURXS students interested in developing tutorial and/or instructional skills. Each Public performances required. Musical background is not necessary. May be component may be repeated for a total of 3 units, up to a maximum of 9 units. taken four times for credit. MUIVI 499 EXPERIMENTAL OFFERING IN MUSIC MUP 400 VOCAL JAZZ ENSEMBLE 2 UNITS INSTRUMENTAL/VOICE INSTRUCTION .5-4 UNITS Prerequisite: None. Prerequisite: None (QUROOPHQW/LPLWDWLRQ $QDXGLWLRQLVUHTXLUHG7KHDXGLWLRQZLOOLQFOXGH VLJKW Course Transferable to CSU singing, aural skills, improvisation and the preparation and performance of a Hours: 18 hours LEC ; 54 hours LAB short musical excerpt. Course Transferable to UC/CSU See UC Limitations & Counselor Music - Performance (MUP) Hours: 18 hours LEC ; 54 hours LAB This course is an advanced choral ensemble of limited size performing a wide MUP 311 ADVANCED ORCHESTRA 1-2 UNITS YDULHW\RIPXVLFLQWKHMD]]VW\OH3XEOLFSHUIRUPDQFHIHVWLYDODQGÀHOGWULSVDUH Prerequisite: None. required. Audition is required. This course may be taken four times for credit. Enrollment Limitation: Students may be admitted to this course by audition and permission of the instructor only. Audition times and dates will be announced MUP 422 SPECIAL ENSEMBLE PARTICIPATION .5-2 UNITS by the department. Prerequisite: None. Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 108 hours LAB Hours: 108 hours LAB This course is the continuing study and performance of orchestral repertoire. This course is open to all students who sing or play musical instruments. Additional topics may include experience in conducting, rehearsal techniques Instrumentation of groups will vary, including jazz combo, piano quintet, guitar and section leading. Field trips may be required. Students will be expected ensemble, and related music as well as choral groups. The course may be taken to supply their own musical instruments in most instances. Some musical a maximum of four times for credit. instruments may be provided by the college. This course may be taken four times. MUP 495 INDEPENDENT STUDIES IN MUSIC PERFORMANCE 1-3 UNITS MUP 320 JAZZ BAND 2 UNITS Prerequisite: None Prerequisite: None. Course Transferable to CSU Enrollment Limitation: Ability to play at least one instrument commonly used Hours: 18 hours LEC ; 54 hours LAB in jazz ensemble; audition required. Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB 212 Music Folsom Lake College 2011-2012 MUP 499 EXPERIMENTAL OFFERING IN MUSIC PERFORMANCE MUSM 334 INTRODUCTION TO MUSICAL INSTRUMENT DIGITAL .5-4 UNITS INTERFACE (MIDI) 2 UNITS Prerequisite: None Prerequisite: None. Course Transferable to CSU Advisory: MUIVI 310 Hours: 18 hours LEC ; 54 hours LAB Course Transferable to CSU Hours: 9 hours LEC ; 81 hours LAB This course is an introduction to the rapidly evolving use of professional music Music - Specializations in Music software and MIDI electronic instruments. Various music hardware options, including keyboards, synthesizers, samplers, computers and drum machines, (MUSM) will be explored. Through a series of MIDI projects, students learn to use MUSM 110 THE BUSINESS OF MUSIC 3 UNITS PXVLFVHTXHQFLQJQRWDWLRQDQG&$, FRPSXWHUDVVLVWHGLQVWUXFWLRQ VRIWZDUH Prerequisite: None Hours: 54 hours LEC MUSM 356 PRO TOOLS 101, INTRODUCTION TO PRO TOOLS This course presents an overview of music in the marketplace, including the 1.5 UNITS processes of promotion, publicity, artist management, talent agents, recording Prerequisite: MUSM 334 with a grade of “C” or better strategies, selling music through the internet, copyrights, and royalties. Course Transferable to CSU Hours: 27 hours LEC MUSM 111 THE BUSINESS OF MUSIC 3 UNITS 7KLVLVWKHÀUVWFRXUVHRIIHULQJDVSDUWRIWKH&ROOHJH·V'LJLGHVLJQ&HUWLÀHG Prerequisite: MUSM 110 (The Business of Music) with a grade of “C” or better. Training Location alliance. It is an introductory course to Digidesign’s Pro Hours: 54 hours LEC Tools digital audio workstation software application. This course fully trains 7KLVFRXUVHSURYLGHVDQRYHUYLHZRIWKHPXVLFEXVLQHVVDVGHÀQHGE\WKH students in the basic operation of Pro Tools. Students learn how to record, publishing and the radio industry. It also includes details and processes of trade edit and mix music and Musical Instrument Digital Interface (MIDI) within the and service marks, attorney functions, merchandising, publishing agreement Pro Tools application. This course is conducted in the Music Department’s IDEA points, and copyright functions. (Interdisciplinary Electronic Arts) computer lab. This course may be taken once for credit. MUSM 112 THE BUSINESS OF MUSIC/ARTIST MANAGEMENT 3 UNITS MUSM 370 MUSIC FOR CHILDREN 3 UNITS Prerequisite: MUSM 111 (The Business of Music) with a grade of “C” or better. Prerequisite: None. Hours: 54 hours LEC General Education: AA/AS Area I 7KLVFRXUVHFRYHUVGHÀQLWLRQVGXWLHVDQGDJUHHPHQWVRIDUWLVWPDQDJHPHQW Course Transferable to CSU Topics include functions of a personal manager and the relationship with the Hours: 54 hours LEC artist, guidelines to career planning, choosing managers and clients, record ([SHULHQFHVDQGPDWHULDOVIRULQWHJUDWLQJPXVLFLQWRSUHVFKRROHOHPHQWDU\ company relations and other team players. The course will also analyze the and recreational programs. Recommended for elementary and early childhood personal manager agreement and organize an artist’s tour. credential candidates, recreation leaders, and others who use music with children. Required for Teacher Assistant Program. (See Early Childhood MUSM 320 CONTEMPORARY SONGWRITING 3 UNITS Education) Prerequisite: MUFHL 321 (Basic Musicianship) with a grade of “C” or better; or placement through the assessment process. MUSM 495 INDEPENDENT STUDIES IN MUSIC SPECIALIZATIONS Course Transferable to CSU IN MUSIC 1-3 UNITS Hours: 54 hours LEC Prerequisite: None This course covers the process of writing popular songs, including writing Course Transferable to CSU lyrics, designing instrumental and vocal arrangements, studying melodic and Hours: 18 hours LEC ; 54 hours LAB harmonic skills, learning popular song forms, analyzing musical styles, and MUSM 499 EXPERIMENTAL OFFERING IN MUSIC SPECIALIZATIONS creating lead sheets. IN MUSIC .5-4 UNITS Prerequisite: None MUSM 321 CONTEMPORARY SONGWRITING 3 UNITS Course Transferable to CSU Prerequisite: MUSM 320 with a grade of “C” or better . Hours: 18 hours LEC ; 54 hours LAB Course Transferable to CSU Hours: 54 hours LEC This course covers advanced processes of popular songwriting, including production and song evaluation, lyrical interpretation, publishing songs, and the songwriters’ marketing system. Folsom Lake College 2011-2012 Natural Resources 213 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Natural Resources COUNSELING Rancho Cordova Center - 916-255-0717 NATR 304 THE FOREST ENVIRONMENT 3 UNITS This program offers a study of introductory ecology Prerequisite: None. and natural resource courses. The need to understand General Education: AA/AS Area IV and preserve our natural resources is becoming greater Course Transferable to UC/CSU every year. This general education coursework prepares Hours: 54 hours LEC students to have a greater awareness and appreciation This course covers basic biological and physical science concepts important to of the natural world around them and the threats posed a general understanding of forest ecology and forestry. Forest history, forests by human actions. of the United States, general tree taxonomy, forest ecology, soils, silvics, and insects and diseases of forest trees are investigated. Additional topics include Career Options WKHUROHRIÀUHLQIRUHVWPDQDJHPHQWIRUHVWPHDVXUHPHQWVPXOWLSOHXVH Naturalist/Interpreter; Forest Technician; Wildlife management, and current forest issues and policies related to forest resource Technician; Restoration Ecologist; Park Ranger; use. Field trips are required. Environmental Educator; Science Writer NATR 320 PRINCIPLES OF ECOLOGY 4 UNITS Some career options may require more than two years of Prerequisite: None. college study. Classes beyond the associate degree may be General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; IGETC Area 5B UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ Course Transferable to UC/CSU for transfer to a university program. Hours: 54 hours LEC ; 54 hours LAB This course covers the basic principles of ecology, including the physical and Highlights biological factors of different environments in relation to the distribution of +DQGVRQÀHOGH[SHULHQFHLQZLOGOLIHDQGHFRORJLFDO plants and animals. Emphasis will be on the management of ecosystems using sampling techniques ecological principles and the understanding of current ecological issues. Field Working with wildlife, ecology and forestry trips are required. SURIHVVLRQDOVLQWKHÀHOG NATR 495 INDEPENDENT STUDIES IN NATURAL RESOURCES 1-3 UNITS Prerequisite: None Natural Resources (NATR) Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB NATR 302 INTRODUCTION TO WILDLIFE BIOLOGY 4 UNITS Prerequisite: None. NATR 499 EXPERIMENTAL OFFERING IN NATURAL RESOURCES General Education: AA/AS Area IV .5-4 UNITS Course Transferable to CSU Prerequisite: None Hours: 54 hours LEC ; 54 hours LAB Course Transferable to CSU This course is an introduction to wildlife biology and the basic principles and Hours: 18 hours LEC ; 54 hours LAB techniques related to the practice of wildlife management. It emphasizes ecological principles of populations and communities as they relate to the interdependence of wildlife and human populations. Topics include the social, political, and biological implications of wildlife management. Additionally, this course covers habitat and population sampling, radio telemetry, and the development of a wildlife management plan. Field trips are required. 214 1RQ3URÀW0DQDJHPHQW Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 1RQ3UR¿W0DQDJHPHQW COUNSELING Rancho Cordova Center - 916-255-0717 CERTIFICATE OF ACHIEVEMENT 1RQ3URÀW0DQDJHPHQW CERTIFICATE OF ACHIEVEMENT NON-PROFIT MANAGEMENT REQUIRED PROGRAM ...... Units %86 ,QWURWRWKH1RQSURÀW6HFWRU ...... 3 %86 1RQSURÀW)XQGUDLVLQJ ...... 3 BUS 182 Nonprofit Governance & Financial Management ...... 3 BUS 300 Intro to Business ...... 3 BUS 310 Business Communications ...... 3 MGMT 362 Techniques of Management ...... 3 MKT 300 Principles of Marketing ...... 3 TOTAL UNITS REQUIRED ...... 21 7KLV SURJUDP SURYLGHV DQ RYHUYLHZ RI QRWIRUSURÀW organizations, with a particular emphasis on regional and VWDWHQRQSURÀWDVVRFLDWLRQVLQWKH6DFUDPHQWRUHJLRQ7KH program focuses on managing operational and policy LVVXHV RI D QRQSURÀW RUJDQL]DWLRQ DQG LV GHVLJQHG IRU VWXGHQWVLQWHUHVWHGLQQRQSURÀWDVVRFLDWLRQPDQDJHPHQW and leadership occupations. Upon completion of this program, the student will be able to: Demonstrate an understanding of the key differences EHWZHHQWKHQRQSURÀWIRUSURÀWDQGSXEOLFVHFWRUV QRQSURÀWJRYHUQDQFHRSHUDWLRQVDQGÀVFDODVSHFWV RIQRQSURÀWRUJDQL]DWLRQV $UWLFXODWHWKHGLIIHUHQWÀQDQFLDOSODQQLQJFKDOOHQJHV IDFLQJQRQSURÀWVFRPSDUHGWRWKHIRUSURÀWVHFWRU Demonstrate an understanding of the fundamentals of fundraising and composing effective fundraising campaign. Demonstrate an understanding of the various types of fundraising campaigns and choose the most appropriate one to implement. Demonstrate an understanding of endowments and special funds. Demonstrate understanding of handling/processing grants. Demonstrate an understanding of fund accounting and bylaws. Folsom Lake College 2011-2012 Nutrition & Foods 215 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Nutrition & Foods COUNSELING Rancho Cordova Center - 916-255-0717 NUTRI 307 NUTRITION FOR FITNESS 2 UNITS Folsom Lake College’s courses provide a basic Same As: KINES 402 understanding of nutritional needs and are designed to Prerequisite: None. serve the needs of Nursing, Medical, Dental, or Veterinary Course Transferable to CSU or other students interested in pursuing a degree in the Hours: 36 hours LEC 'LHWHWLFRU1XWULWLRQÀHOG 6WXGHQWVZLOOVWXG\WKHEDVLFSULQFLSOHVRIQXWULWLRQDVZHOODVWKHUDPLÀFDWLRQV RIQXWULWLRQRQÀWQHVVWUDLQLQJ7KLVFRXUVHLVSDUWRIWKH)LWQHVV3URIHVVLRQDO Career Options &HUWLÀFDWH3URJUDPRIIHUHGWKURXJKWKH3K\VLFDO(GXFDWLRQ'HSDUWPHQW7KLV Career Options: Hospital/nursing homes; school food course is not open to students who have completed KINES/PET 402. service; college food service; industry; restaurants; public health agencies; nutrition programs; WIC programs, NUTRI 308 WEIGHT MANAGEMENT 2.5 UNITS Meals on Wheels; health clubs; weight management Prerequisite: None. clinics; community wellness centers. Corequisite: FITNS 304, 306, 307, 331, 370, 380, 381, or 401 ; Of the corequisites listed, one must be taken concurrently. If NUTRI 308 is taken a second time, a Some career options may require more than two years of different FITNS course is recommended. college study. Classes beyond the associate degree may be Advisory: ENGWR 101 and MATH 30 UHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRUSUHSDUDWLRQ Course Transferable to CSU for transfer to a university program. Hours: 27 hours LEC ; 54 hours LAB This course focuses on the various components of weight management and Highlights strategies for a healthier lifestyle. The role of diet, exercise, and behavior Lab experience with cooking, food-tasting and diet PRGLÀFDWLRQDVZHOODVWKHSK\VLRORJLFDOVRFLRORJLFDODQGSV\FKRORJLFDODVSHFWV analysis of weight management will be discussed. Students will analyze weight loss Professional and innovative faculty programs and “fad” diets to evaluate their effectiveness. Disordered eating will Hands-on experience in nutrition and diet assessment also be addressed. Students will create plans for weight management based on individual needs, obstacles and goals. Students will actively learn how to SODQDQGSUHSDUHKHDOWK\PHDOVLQFRUSRUDWHÀWQHVVLQWRWKHLUOLIHVW\OHDQG maintain a healthy weight. Lab will include time for food preparation, tasting, Nutrition and Foods (NUTRI) and evaluation. This course may be taken twice with a different corequisite FITNS course. Second semester students will advance their nutrition knowledge NUTRI 300 NUTRITION 3 UNITS in developing more extensive meal plans and developing healthy, nutritious Prerequisite: None. PHDOVDVZHOODVDXJPHQWWKHLUÀWQHVVSURJUDPZLWKDGLIIHUHQWFRXUVH)LHOG Advisory: MATH 30 trip may be required for second semester students. General Education: AA/AS Area III(b); CSU Area E1 Course Transferable to UC/CSU NUTRI 310 CULTURAL FOODS OF THE WORLD 3 UNITS Hours: 54 hours LEC Prerequisite: None. This course examines the basic principles of nutrition, sources and functions of General Education: AA/AS Area VI the nutrients in all stages of the life cycle, nutrition as a world problem, and Course Transferable to CSU consumer problems related to food. The course will emphasize topics such as See UC Limitations & Counselor ZHLJKWORVVVSRUWVQXWULWLRQVXVWDLQDEOHIRRGIRRGVDIHW\WKHGLHWGLVHDVH Hours: 54 hours LEC relationship, global nutrition and analysis of special nutritional requirements 7KLVFRXUVHFRPSDUHVYDULRXVZHVWHUQDQGQRQZHVWHUQFXOWXUDOIRRGFXVWRPV from the prenatal period through the geriatric years. An evaluation of personal DQGSDWWHUQVLQFOXGLQJWKHLUVRFLDOUHOLJLRXVHFRQRPLFDQGDHVWKHWLFVLJQLÀFDQFH dietary habits using current dietary guidelines and nutritional assessment (WKQRFHQWULVPJHQGHUUHODWHGVWHUHRW\SHVDQGUDFLVPDVWKH\UHODWHWRWKH methods will be completed to help students analyze their own nutritional health. availability, distribution, and preparation of food throughout the world will also be compared. The nutritional status of various cultures as it relates to geographic agricultural and socioeconomic factors will be studied. 216 Nutrition & Foods Folsom Lake College 2011-2012 NUTRI 320 CHILDREN’S HEALTH, SAFETY AND NUTRITION 3 UNITS Same As: ECE 415 Prerequisite: None. Advisory: NUTRI 300 General Education: AA/AS Area III(b) Course Transferable to CSU Hours: 54 hours LEC This course examines basic nutrition, health, and safety needs of children from the prenatal period through school age. Students will identify the nutrients in foods as they affect a child’s physical and mental development. The course emphasis is placed on maintaining the optimal health, safety, and nutritional status of children at home and in group care. Projects related to children’s nutrition, health, and safety are required as part of the course. Not open to students who have received credit for ECE 415. NUTRI 324 NUTRITION FOR HEALTHY AGING 3 UNITS Prerequisite: None. Advisory: ENGWR 101 and MATH 30 Course Transferable to CSU Hours: 54 hours LEC This course is an introduction to nutritional concerns as they apply to the elderly. Students will explore the physiological, psychosocial, and chronic degenerative conditions associated with aging and the nutritional implications of each. This FODVVLQFOXGHVDÀHOGWULSWRDFRPPXQLW\SURJUDPWKDWSURYLGHVPHDOVIRRG social interaction, and/or recreation activities to seniors. NUTRI 495 INDEPENDENT STUDIES IN NUTRITION & FOODS 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB NUTRI 499 EXPERIMENTAL OFFERING IN NUTRITION .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Philosophy 217 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Philosophy COUNSELING Rancho Cordova Center - 916-255-0717 PHIL 304 INTRODUCTION TO EASTERN PHILOSOPHY 3 UNITS Philosophy is the logical examination of the fundamental Prerequisite: None. issues people have pondered for over 2500 years. What General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B is reality and what is beauty? What is knowledge and Course Transferable to UC/CSU truth? What is good and just? Does human existence Hours: 54 hours LEC have meaning and does God exist? Philosophy courses This course provides an introduction to the philosophical traditions of Hinduism, are directed toward understanding these questions in Buddhism, Taoism and Confucianism, focusing on the metaphysics, epistemology, their historical and cultural contexts and applying insights DQGHWKLFVRIWKHVHWUDGLWLRQV7KLVFRXUVHIXOÀOOV)ROVRP/DNH&ROOHJH·V(WKQLF to contemporary life. Rigorous philosophical study will Multicultural requirement for the Associates Degree. improve one’s critical thinking skills. PHIL 310 INTRODUCTION TO ETHICS 3 UNITS Career Options Prerequisite: None. Education; Ethics; Management; Law; Government; General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B 3XEOLVKLQJ 5HOLJLRXV6HUYLFH 6FLHQWLÀF5HVHDUFK 6RFLDO Course Transferable to UC/CSU Work; Teaching; All Human Service Careers Hours: 54 hours LEC This course introduces the student to classical and contemporary ethical theories Some career options may require more than two years and their application to a variety of contemporary moral issues such as capital of college study. SXQLVKPHQWDQLPDOULJKWVDIÀUPDWLYHDFWLRQDERUWLRQHXWKDQDVLDWRUWXUH DQGVDPHVH[PDUULDJH Highlights Dedicated and enthusiastic instructional staff with PHIL 320 LOGIC AND CRITICAL REASONING 3 UNITS expertise in critical thinking and ethics Prerequisite: None. Excellent transfer preparation by emphasizing General Education: AA/AS Area II(b); CSU Area A3 critical writing and reading Course Transferable to UC/CSU Examination of traditional philosophical issues Hours: 54 hours LEC This course provides an introduction to basic principles of logic and critical thinking used in the analysis of argument, including deduction, induction, and fallacy recognition. Emphasis is placed on developing analytical skills and Philosophy (PHIL) applying principles of sound reasoning to the arguments encountered in life. $UJXPHQWDWLYHWRSLFVIURPDFDGHPLFÀHOGVDQGWH[WERRNVWKHHOHFWURQLFDQG PHIL 300 INTRODUCTION TO PHILOSOPHY 3 UNITS print media, advertisements, politics and ethics may be considered. The quality Prerequisite: None. DQGTXDQWLW\RIUHTXLUHGZULWLQJLQWKLVFRXUVHZLOOUHÁHFWWKHVWDQGDUGVRID General Education: AA/AS Area II(b); CSU Area A3; IGETC Area 3B VHFRQGVHPHVWHUFROOHJHOHYHOFRPSRVLWLRQFRXUVH Course Transferable to UC/CSU Hours: 54 hours LEC PHIL 325 SYMBOLIC LOGIC 3 UNITS In this course, students will apply the critical thinking techniques of analysis, Prerequisite: None. HYDOXDWLRQDQGV\QWKHVLVWRDUHDVRISKLORVRSKLFDOLQTXLU\LQFOXGLQJPHWD General Education: AA/AS Area II(b); CSU Area A3 philosophy, epistemology, metaphysics, ethics, political philosophy, philosophy Course Transferable to UC/CSU of religion, history of philosophy, and existentialism. Students will practice Hours: 54 hours LEC distinguishing fact from opinion, employing inductive and deductive reasoning, This course introduces students to the nature of deductive systems of logic identifying logical errors and fallacies, and developing oral and written and their application. Students will study approaches to argumentation and arguments to support their own philosophical perspectives or challenge the methods of formal proof, and they will learn to evaluate argumentative forms perspectives of others. The quality and quantity of the course’s required writing IRUYDOLGLW\DQGVRXQGQHVV7KHV\PEROLFDQDO\WLFIRFXVUHFRPPHQGVWKHFRXUVH ZLOOUHÁHFWWKHVWDQGDUGVRIDVHFRQGVHPHVWHUFRPSRVLWLRQFRXUVH to students in the sciences, computer programming, mathematics, linguistics, law, and philosophy. 218 Philosophy Folsom Lake College 2011-2012 PHIL 328 CRITICAL REASONING AND COMPOSITION 3 UNITS PHIL 350 PHILOSOPHY OF RELIGION 3 UNITS Prerequisite: ENGWR 300 with a grade of “C” or better Prerequisite: None. General Education: AA/AS Area II(b); CSU Area A3; IGETC Area 1B General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course provides instruction in critical thinking, including traditional logic, This course is a historical and topical survey of the questions, problems, and and advanced composition. A series of writing assignments focus on increasing theories philosophers have developed in attempts to understand religion as a the sophistication of students’ argumentative writing skills. Theoretical models fundamental impulse within human experience and as a major cultural force. RIFULWLFDOWKLQNLQJDQGFRPSRVLWLRQZLOOEHDSSOLHGWRDFDGHPLFÀHOGVDQG Rather than survey the different religions, this course considers the basic textbooks, electronic and print media, advertisements, ethics, politics, and philosophical beliefs and concepts that seem auxiliary to religion. Topics include PXOWLFXOWXUDOLVVXHV(VVD\VZLOOEHHYDOXDWHGIRUWKHLUTXDOLW\LQERWKFULWLFDO the possibility of religious knowledge, faith versus reason, theistic arguments, thinking and composition. conceptions of God, religious language, atheism, agnosticism, mysticism, the SUREOHPRIHYLOLPPRUWDOLW\WKHFKDOOHQJHRIVFLHQFHDQGUHOLJLRQ·VLQÁXHQFH PHIL 330 HISTORY OF CLASSICAL PHILOSOPHY 3 UNITS on ethics and politics. Prerequisite: None. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B PHIL 352 INTRODUCTION TO WORLD RELIGIONS 3 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 54 hours LEC General Education: AA/AS Area I; AA/AS Area VI; CSU Area C2; IGETC Area 3B This course is a survey of the origin and development of Western Philosophy Course Transferable to UC/CSU from the period of the ancient Greeks and Romans, and continuing through the Hours: 54 hours LEC Middle Ages. This course is especially recommended for all philosophy, history This course will introduce students to the major world religious traditions, and humanities majors. including indigenous sacred ways, Hinduism, Buddhism, Taoism and Confucianism, Judaism, Christianity, and Islam. Students will study the practices PHIL 331 HISTORY OF MODERN PHILOSOPHY 3 UNITS and beliefs of each tradition and will read selected material from the sacred Prerequisite: None. ZULWLQJVRIHDFKWUDGLWLRQ$OVRWKHLQÁXHQFHRIWKHVHUHOLJLRQVRQFRQWHPSRUDU\ General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B issues in the United States including ethnicity, ethnocentrism, racism, ageism, Course Transferable to UC/CSU FODVVGLIIHUHQFHVDQGVH[XDORULHQWDWLRQLVFRQVLGHUHG7KLVFRXUVHIXOÀOOV)ROVRP Hours: 54 hours LEC Lake College’s Ethnic/Multicultural requirement for the Associates Degree. This course is a survey of the development of Western Philosophy from the period of the Renaissance through the period of modern Europe and America. PHIL 356 INTRODUCTION TO THE BIBLE 3 UNITS It is especially recommended for all philosophy, history and humanities majors. Prerequisite: None. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B PHIL 338 CONTEMPORARY PHILOSOPHY 3 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 54 hours LEC General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B In this course, students survey the literary, historical, ethical, theological and Course Transferable to UC/CSU philosophical themes of the Bible. Students will read extensive passages from Hours: 54 hours LEC the Hebrew and Christian scriptures with special focus on textual analysis and This course is recommended for students interested in an introduction to literary criticism. Topics from the Hebrew scriptures include the development philosophy with a focus on existential concerns such as alienation, authenticity, of monotheism, the social justice tradition of the Prophets, the wisdom and and anxiety. It also examines the philosophy of mind and language, including SRHWLFZULWLQJVDQGWKHVFRSHDQGHPSKDVLVRIH[WUDFDQRQLFDOZRUNV7RSLFV the structure of consciousness and the meaning of “meaning” and language. from the New Testament scriptures include the investigation of the Gospels and the “Jesus Problem” and the examination of the early development of the Christian Church. Folsom Lake College 2011-2012 Philosophy 219 PHIL 358 OUR MOTHERS’ LEGACY: SPIRITUAL AND RELIGIOUS TRADITIONS OF WOMEN 3 UNITS Prerequisite: None. General Education: CSU Area C2; IGETC Area 3B Course Transferable to UC/CSU Hours: 54 hours LEC This course introduces students to ancient feminine forms of divinity and women’s roles as spiritual visionaries, priestesses, shamans, and religious practitioners through the ages. In addition, the course examines cultures in which women have retained their spiritual authority and those in which women who have been oppressed are reclaiming their spiritual power. This FRXUVHIXOÀOOV)ROVRP/DNH&ROOHJH·V(WKQLF0XOWLFXOWXUDOUHTXLUHPHQWIRUWKH Associates Degree. PHIL 360 SOCIAL/POLITICAL PHILOSOPHY 3 UNITS Prerequisite: None. General Education: AA/AS Area V(b); AA/AS Area I; CSU Area C2; CSU Area D7; IGETC Area 3B; IGETC Area 4G Course Transferable to UC/CSU Hours: 54 hours LEC 7KLVFRXUVHLVDKLVWRULFDODQGWRSLFDOVXUYH\RIVLJQLÀFDQWWKHPHVRIVRFLDO political philosophy from Plato to the present. Topics may include freedom, government, justice, law, rights, punishment, war, authority, and the state. PHIL 495 INDEPENDENT STUDIES IN PHILOSOPHY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 3 hours LAB PHIL 499 EXPERIMENTAL OFFERING IN PHILOSOPHY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 220 Photography Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Photography COUNSELING Rancho Cordova Center - 916-255-0717 PHOTO 262 THE EASTERN SIERRA LANDSCAPE, MONO LAKE The Folsom Lake College Photography program is BASIN 2 UNITS designed to teach skills for entry-level positions in the Prerequisite: None. photographic industry or for advanced students wishing Hours: 18 hours LEC ; 54 hours LAB more specialized skills. This program will also be of This course is designed to give students an opportunity to study topics not value to the student interested in photography as a included in current course offerings. Students will participate in a landscape vocation or an adjunct to a vocation. photography workshop in the Eastern Sierra emphasizing the Mono Lake Basin. The course will include a variety of topics primarily dealing with digital imaging, Career Options including black and white, infrared, and low light photography. Students will Commercial Illustration and Advertising; Portrait & be responsible for their own travel, food, accommodations and photographic Wedding Photography; Photographic Lab Technician; materials. Field trip fees for entry to California State Parks may be required if Photojournalism; Industrial Photography; Fashion & Bodie is included in the itinerary. Glamour Photography; Architectural Photography PHOTO 264 THE PACIFIC COAST LANDSCAPE 2 UNITS Some career options may require more than two years Prerequisite: None. of college study. Classes beyond the associate degree Hours: 18 hours LEC ; 54 hours LAB PD\EHUHTXLUHGWRIXOÀOOVRPHFDUHHURSWLRQVRUIRU This course is designed to give students an opportunity to participate in a preparation for transfer to a university program. ODQGVFDSHSKRWRJUDSK\ZRUNVKRSHPSKDVL]LQJWKH3DFLÀF&RDVW7KHFRXUVH ZLOOLQFOXGHDYDULHW\RIWRSLFVLQFOXGLQJDSSO\LQJÀOPDQGGLJLWDOFDPHUD Highlights techniques to black and white, infrared, color slide and negative, digital, large Digital Imaging format and low light photography. Students will be responsible for all their Digital Printer own photographic expenses, and may incur additional fees for transportation, Field Trips to a variety of photographic venues in lodging, food, park fees and more. the Sacramento, Bay Area, and Yosemite/Eastern Sierras PHOTO 294 TOPICS IN PHOTOGRAPHY .5-4 UNITS Prerequisite: None Hours: 36 hours LEC ; 54 hours LAB Photography (PHOTO) PHOTO 295 INDEPENDENT STUDIES IN PHOTOGRAPHY 1-3 UNITS Prerequisite: None PHOTO 260 THE EASTERN SIERRA LANDSCAPE, YOSEMITE VALLEY Hours: 18 hours LEC ; 54 hours LAB 2 UNITS Prerequisite: None. PHOTO 299 EXPERIMENTAL OFFERING IN PHOTOGRAPHY Hours: 18 hours LEC ; 54 hours LAB .5-4 UNITS This course is designed to give students an opportunity to participate in a Prerequisite: None landscape photography workshop in the Sierras emphasizing the Yosemite Hours: 18 hours LEC ; 54 hours LAB Valley. This course will include a variety of topics including how to work with PHOTO 300 PHOTOGRAPHY - ITS INFLUENCE IN CONTEMPORARY ÀOPDQGGLJLWDOIRUPDWVLQFOXGLQJEODFNDQGZKLWHLQIUDUHGFRORUVOLGHVDQG SOCIETY 1 UNIT negatives; they may also learn about large format cameras and low light Prerequisite: None. photography. Students may incur fees for lodging, food, transportation and General Education: CSU Area C1 park admissions. Students are also responsible for all their own photographic Course Transferable to UC/CSU expenses. Hours: 18 hours LEC This course is a survey course of important historical and contemporary SKRWRJUDSKHUVGHVLJQHGWRH[SRVHWKHVWXGHQWWRYDULRXVÀHOGVRISKRWRJUDSK\ In our society, we are overwhelmed by visual information of all kinds. This course intends to increase visual literacy. The format of the class includes: slide presentations, discussions, written tests and a journal. Folsom Lake College 2011-2012 Photography 221 PHOTO 302 BEGINNING DIGITAL PHOTOGRAPHY 3 UNITS PHOTO 410 ADVANCED DIGITAL IMAGING 3 UNITS Prerequisite: None. Prerequisite: PHOTO 400 with a grade of “C” or better Course Transferable to CSU Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 54 hours LAB 7KLVFRXUVHFRPELQHVOHFWXUHVZLWKKDQGVRQH[SHULHQFHLQGLJLWDOSKRWRJUDSK\ This course is an advanced study of digital imaging and related software Instruction includes digital camera function, exposure control, technical and programs. Methods currently used in publishing will be emphasized. The class creative control, computer manipulation of images and digital output options. includes lectures, use of computers, scanners, and a variety of output devices, The format of the class includes lectures, visual presentations, lab time, exams and preparation of a digital portfolio. This course will introduce the student to and a portfolio. Students are responsible for camera and printing costs. Field WKHHPHUJLQJÀHOGRIPXOWLPHGLDDQGYLVLWYDULRXVORFDOEXVLQHVVHV$IHHLV trips may be required. charged for digital printing. PHOTO 370 PORTRAITURE AND WEDDING PHOTOGRAPHY PHOTO 415 ADVANCED DIGITAL PHOTO RESTORATION AND 3 UNITS RETOUCHING 3 UNITS Prerequisite: PHOTO 302 with a grade of “C” or better; Consent of the instructor Prerequisite: PHOTO 302 and 400 with grades of “C” or better; Consent of Course Transferable to CSU the instructor Hours: 36 hours LEC ; 54 hours LAB Course Transferable to CSU This course introduces students to the techniques, skills, and business of Hours: 36 hours LEC ; 54 hours LAB wedding and portrait photography. Techniques of lighting, use of correct This class prepares students for professional retouching and restoration of FDPHUDVDQGÀOPVSURIHVVLRQDOSUDFWLFHVDQGVWUDWHJLHVIRUEHJLQQLQJEXVLQHVV damaged photographs and also for portrait and glamour retouching. Students DUHH[DPLQHG7KHFODVVLQFOXGHV OHFWXUHVODEWLPHRQORFDWLRQÀHOGWULSV will learn to use computer software and hardware suited to these purposes. exams, and a portfolio geared toward a professional presentation. Students are Students are responsible for camera and processing costs. UHVSRQVLEOHIRUSURYLGLQJFDPHUDÀOPGLJLWDOUHFRUGLQJPHGLDDQGSURFHVVLQJ printing costs. PHOTO 495 INDEPENDENT STUDIES IN PHOTOGRAPHY 1-3 UNITS Prerequisite: PHOTO 310. Grade of “C” or better required to meet prerequisite. PHOTO 390 STUDIO LIGHTING TECHNIQUES 3-4 UNITS Course Transferable to CSU Prerequisite: PHOTO 302 with a grade of “C” or better; Consent of the instructor Hours: 18 hours LEC ; 54 hours LAB Course Transferable to CSU This course is designed to allow advanced students to pursue and research their Hours: 36 hours LEC ; 54 hours LAB photographic interests and receive credit. Students must provide a proposal This course is a study in studio lighting techniques used in commercial outlining their area of interest and arrange meetings with an instructor. photography. Topics of instruction include: correct exposure using strobe, Students may wish to challenge the prerequisite on the basis of equivalent lighting ratios, basic portraiture and advertising, appropriate choices of camera experience. IRUPDWVDQGÀOPVDQGVWXGLHVLQFRPSRVLWLRQRIFRPPHUFLDOSKRWRJUDSKV Students are encouraged to work in a variety of formats, using black and white DQGFRORU6WXGHQWVPD\FRPSOHWHWKHFRXUVHZLWKÀOPRUGLJLWDOFDPHUDV7KH FODVVLQFOXGHV OHFWXUHVYLVXDOSUHVHQWDWLRQVDQGGLVFXVVLRQVRQORFDWLRQÀHOG trips, digital lab time, exams and a portfolio. Students will incur camera and processing costs. PHOTO 400 DIGITAL IMAGING 3 UNITS Prerequisite: None. Course Transferable to CSU Hours: 36 hours LEC ; 54 hours LAB Digital imaging focuses on image acquisition, manipulation, printing and publication. Methods and standards currently in use in the photographic publishing industry will be emphasized. Students will capture images through digital cameras or scanners. Students will process images using industry standard software such as the current version of Photoshop to produce printed or electronic multimedia presentations and incorporate these images into a student’s digital portfolio. Students must provide their own adjustable digital FDPHUDDQGGLJLWDOVWRUDJHPHGLD$IHHSHUSULQWLVFKDUJHGIRURQFDPSXV digital printing. 222 Photography Folsom Lake College 2011-2012 PHOTO 498 WORK EXPERIENCE IN PHOTOGRAPHY 1-4 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area III(b) (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS volunteer opportunity, or job related to career interests. Course Transferable to CSU +RXUV KRXUV/$% This course provides students with opportunities to develop marketable skills in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; completion of required forms, which document the student’s progress and hours spent at the work site; and developing workplace skills and competencies. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. PHOTO 499 EXPERIMENTAL OFFERING IN PHOTOGRAPHY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Physical Education/Kinesiology 223 Physical Education/ Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Kinesiology COUNSELING Rancho Cordova Center - 916-255-0717 CERTIFICATE OF ACHIEVEMENT CERTIFICATES OF ACHIEVEMENT Group Fitness Instructor Group Fitness Instructor Personal Trainer Required Program ...... (units) The Physical Education curriculum offers a wide variety of .,1(6*URXS)LWQHVV,QVWUXFWRU&HUWLÀFDWLRQ ...... 3 FRXUVHVWRDFFRPPRGDWHYDU\LQJÀWQHVVOHYHOVLQWHUHVWV KINES 414 Health Fitness Management ...... 3 DQG DELOLWLHV LQFOXGLQJ GDQFH FDUGLRYDVFXODU ÀWQHVV KINES 415 Designing Fitness Training for the Active ...... martial arts, strength training, mind/body activities like Older Adult ...... 2 yoga and tai chi, individual sport activities such as archery, KINES 416 Sport and Fitness Psychology: Motivational tennis and golf, adapted physical education courses, Strategies for Behavioral Change ...... 2 DQGWKHRU\FRXUVHVIRUWKHDVSLULQJÀWQHVVSURIHVVLRQDO KINES 417 Fitness Injury Prevention and Management 2 These courses are designed not only to enhance physical KINES 402/NUTRI 307 Nutrition for Fitness ...... 2 conditioning, but to stimulate the students’ intellectual TOTAL UNITS REQUIRED ...... 14 growth as well. Students should carefully read the course description to determine if it will meet their needs. Many 7KH*URXS)LWQHVV,QVWUXFWRU&HUWLÀFDWHSURJUDPLVGHVLJQHGWR of the Physical Education offerings transfer to both the provide students with the theoretical knowledge and practical CSU and UC systems accommodating students pursuing a VNLOOVQHFHVVDU\WREHVXFFHVVIXOLQWKHÀHOGRIJURXSÀWQHVV four-year degree. However, some four-year colleges and LQVWUXFWLRQ,QDGGLWLRQWKLVFHUWLÀFDWHZLOOSUHSDUHVWXGHQWV universities limit the number of units they will accept toward to sit for the American Council on Exercise’s Group Fitness WKH EDFFDODXUHDWH GHJUHH )RU VSHFLÀF UHTXLUHPHQWV Instructor examination. students should refer to a catalog from the transfer institution of their choice. Students are also advised to Upon completion of this program, the student will be able to: see a counselor before selecting the courses best aligned perform and interpret the results of a comprehensive with their transfer institution. One unit laboratory activity KHDOWKVFUHHQLQJDQGÀWQHVVDVVHVVPHQW courses may be taken four times. design safe and effective group exercise classes utilizing appropriate music and equipment. Career Options demonstrate and teach safe and effective exercise *URXS ÀWQHVV LQVWUXFWRU GDQFH LQVWUXFWRU SHUVRQDO WHFKQLTXHVZLWKDSSURSULDWHPRGLÀFDWLRQVIRUDYDULHW\ WUDLQHU DFWLYLW\ GLUHFWRU FRUSRUDWH ÀWQHVV GLUHFWRU of populations. wellness coordinator. DSSO\VNLOOVDQGNQRZOHGJHWRPDQDJHÀWQHVVSURJUDPV and/or facilities. Some career options may require further education. operate within the ethical and legal scope of practice for Highlights WKHJURXSÀWQHVVLQVWUXFWRU The El Dorado Center has full service group exercise, weight room and locker room facilities. The main campus offers a dance room, group exercise room, WHQQLVFRXUWVDQGÀHOGVIRURXWGRRUFODVVHV)ROVRP·V main campus features a 27,000 square foot facility ZLWK D VWDWH RI WKH DUW GDQFH VWXGLR JURXS ÀWQHVV room, circuit training room, weight room, and exercise science lab. Future Physical Education and Athletics IDFLOLWLHVLQFOXGH DWKOHWLFVÀHOGVIRUVRIWEDOOEDVHEDOO cross country, and soccer, a tennis stadium, a track DQG ÀHOG VWDGLXP DQ DUFKHU\ WDUJHW UDQJH D practice gymnasium, and a spectator gymnasium for basketball and volleyball. 224 Physical Education/Kinesiology Folsom Lake College 2011-2012 CERTIFICATE OF ACHIEVEMENT Personal Trainer Physical Education - Adapted (ADAPT) Required Program ...... (units) ADAPT 330 ADAPTED WEIGHT TRAINING AND FITNESS 1 UNIT .,1(63HUVRQDO7UDLQHU&HUWLÀFDWLRQ ([HUFLVH Prerequisite: None. Science & Fitness Assessment ...... 3 General Education: AA/AS Area III(a); CSU Area E2 .,1(63HUVRQDO7UDLQHU&HUWLÀFDWLRQ 3URJUDP Enrollment Limitation: Because of the vast differences in physical abilities, Design & Instructional Methodology ...... 3.5 special consideration should be given to class size. Class safety could be KINES 416 Sport and Fitness Psychology: Motivational compromised with a standard class size. Strategies for Behavioral Change ...... 2 Course Transferable to UC/CSU KINES 417 Fitness Injury Prevention and Management 2 Hours: 54 hours LAB KINES 402/NUTRI 307 Nutrition for Fitness ...... 2 In adapted weight training, the instructor works under the recommendation BUS 300 Introduction to Business ...... 3 and direction of the student’s physician to develop a weight training program TOTAL UNITS REQUIRED ...... 15.5 designed to enhance the student’s ability to perform activities of daily living, as ZHOODVDVVLVWWKHVWXGHQWLQDWWDLQLQJKLVRUKHUÀWQHVVJRDOV3URJUDPVZLOOEH 7KH 3HUVRQDO 7UDLQHU &HUWLÀFDWH SURJUDP LV GHVLJQHG WR individualized and students will be encouraged to perform at a challenging, yet provide students with the theoretical knowledge and practical VDIHOHYHO6WXGHQWVFDQH[SHFWWRLPSURYHWKHLUPXVFXODUÀWQHVVZKLOHJDLQLQJ VNLOOV QHFHVVDU\ WR EH VXFFHVVIXO LQ WKH ÀHOG RI SHUVRQDO VHOIHVWHHPFRQÀGHQFHDQGJUHDWHULQGHSHQGHQFH6WXGHQWVPXVWEHUHJLVWHUHG WUDLQLQJ,QDGGLWLRQWKLVFHUWLÀFDWHZLOOSUHSDUHVWXGHQWVWR with the campus DSP&S program and provide a physician’s statement indicating: sit for the American Council on Exercise’s Personal Training WKHGLVDELOLW\ VSHFLÀFUHVWULFWLRQVDQG UHFRPPHQGHGDFWLYLWLHV examination. ADAPT 495 INDEPENDENT STUDIES IN ADAPTED PHYSICAL EDUCATION 1-3 UNITS Upon completion of this program, the student will be able to: Prerequisite: None. perform and interpret the results of a comprehensive General Education: AA/AS Area III(a) (effective Fall 2009) KHDOWKVFUHHQLQJDQGÀWQHVVDVVHVVPHQW Course Transferable to CSU FRPSLOHDQGXWLOL]HKHDOWKOLIHVW\OHPHGLFDODQGÀWQHVV Hours: 162 hours LAB assessment information to design safe, appropriate, and This course will be tailored to meet the student’s individual needs. As such, effective exercise programs. the student is responsible for meeting with the instructor of record to discuss demonstrate and teach safe and effective exercise and develop an Independent Studies Proposal including: a course description, techniques for a variety of populations. course activities, contact hours, student learning outcomes, methods of apply skills and knowledge to set up practice as an instruction, homework assignments, methods of evaluation, and appropriate independent contractor or a sole proprietorship. text or readings. operate within the ethical and legal scope of practice of the personal trainer Physical Education - Dance (DANCE) DANCE 308 WORLD DANCE HISTORY 3 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area I; AA/AS Area VI; CSU Area C1 Course Transferable to UC/CSU Hours: 54 hours LEC World Dance History will survey the development of dance traditions around the world from antiquity to the present day, applying basic theoretical models to analyze dance as culturally meaningful. The course will explore how/why dance is created, borrowed/exploited, hybridized and revered in human culture. The impact of social, political, economic, cultural and religious forces shaping GDQFHWKURXJKRXWKLVWRU\ZLOOEHH[DPLQHG&URVVFXOWXUDOWUDQVPLVVLRQV of movement stylization will inform the students’ understanding of dance chronology and theory. Folsom Lake College 2011-2012 Physical Education/Kinesiology 225 DANCE 309 INTRODUCTION TO DANCE 2 UNITS DANCE 320 BALLET 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LAB This course will introduce basic steps, styles and rhythms associated with several This course provides an introduction to foundational ballet technique, examining GDQFHGLVFLSOLQHVLQFOXGLQJEDOOHWMD]]PRGHUQKLSKRSDQGO\ULFDOIRUPVRI the social, cultural and political issues involving ballet as an artistic expressive dance. Lecture will encompass the historical and cultural placement of each form. In this course students will learn to perform beginning level ballet dance style from inception to current media trends. Class will include warm positions, barre warm up exercises, turns and techniques safely and precisely. up exercises, movement combinations and dance choreography appropriate to &HQWHUDQGDFURVVWKHÁRRUH[HUFLVHVZLOOIRFXVRQLQFUHDVHGFRQWUROVSHHG each dance style. Students will be responsible for obtaining appropriate dance strength and balance. Students will develop a ballet movement vocabulary and attire. Upon completion of this course, students will have experience performing will be able to apply ballet terminology appropriately. Students will be able to a variety of dance styles and techniques, and be able to critically discuss the evaluate ballet as a movement theory and an art form, using basic theoretical VRFLRFXOWXUDODQGKLVWRULFDOFRQWH[WRIHDFKVW\OH7KLVFRXUVHPD\EHWDNHQ models to analyze dance as culturally meaningful. This course may be taken two times for credit provided different topics are taken. four times for credit. DANCE 310 JAZZ DANCE 1 UNIT DANCE 330 MODERN DANCE 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LAB Hours: 54 hours LAB This course provides an introduction to jazz dance technique. Students will This course provides an introduction to elementary modern dance techniques, EHFRPHSURÀFLHQWDWZDUPXSFHQWHUDQGDFURVVWKHÁRRUH[HUFLVHVIRFXVHGRQ concepts and choreography, examining the role of modern dance pioneers, FRQWUROEDODQFHDQGÁH[LELOLW\$FURVVWKHÁRRUFRPELQDWLRQVZLOOHPSKDVL]H VRFLDOUHEHOOLRQZRPHQ·VLVVXHVGDQFHKLVWRU\DQGHWKQLFGDQFHLQÁXHQFHV7KH alignment, style, and technical progression, leading to memorized choreography. social, cultural and political issues involving modern dance will be surveyed, The history of jazz dance will be surveyed, as well as some basic theoretical as well as some basic theoretical perspectives used to analyze Modern dance perspectives used to analyze the social, cultural and political issues involving in contemporary media. Students will develop increased technical facility in jazz as an artistic expressive form. This course may be taken four times for the performance of modern dance movements while improving kinesthetic credit. DZDUHQHVVVWUHQJWKDQGÁH[LELOLW\$UHYLHZRIPRGHUQGDQFHKLVWRU\DQG an exploration of choreographic principles will enhance understanding of the DANCE 311 URBAN HIP HOP 1 UNIT creative and expressive foundations of this art form. This course may be taken Prerequisite: None. four times for credit. General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU DANCE 372 DANCE COMPOSITION AND PRODUCTION 2 UNITS Hours: 54 hours LAB Prerequisite: None. This course will introduce students to the elements of urban Hip Hop dance General Education: AA/AS Area III(a); CSU Area E2 style and culture. Conditioning exercises and drills will be incorporated to Course Transferable to UC/CSU develop the physical skills and capabilities necessary to execute more advanced Hours: 18 hours LEC ; 54 hours LAB movements. The movements will be instructor choreographed, but will allow This course is designed to give students the opportunity to choreograph the opportunity for students to express their individuality and creativity by and perform dance at the college level. Students will improve technique and developing signature techniques, as well as group formations. Students will experience several dance styles by exploring fundamental concepts of dance compete in small groups as part of the experience. The history and evolution composition and movement through improvisation, as well as understand the of hip hop dance will also be examined with emphasis placed on the positive role of the choreographer in dance production. Students will be responsible for message that Hip Hop brings to today’s society. No previous dance experience acquiring appropriate dance shoes and attire. This course may be taken four is necessary. This course may be taken four times for credit. times for credit provided different topics are taken. 226 Physical Education/Kinesiology Folsom Lake College 2011-2012 DANCE 378 MUSICAL THEATER DANCE 2 UNITS Prerequisite: None. Physical Education - Fitness (FITNS) General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to CSU FITNS 304 CARDIO CIRCUIT 1 UNIT Hours: 18 hours LEC ; 54 hours LAB Prerequisite: None. This course is designed to give students a full intellectual understanding of General Education: AA/AS Area III(a); CSU Area E2 and physical experience with Musical Theatre Dance. Students will explore Course Transferable to UC/CSU fundamental theoretical concepts associated with the social, historical and Hours: 54 hours LAB political forces that shaped, and continue to shape, the American musical. This course will introduce the student to a cardio circuit form of training, Students will examine choreographic innovations, advances in dance technique combining both cardio and weight training equipment in a circuit format. Students and stylization related to the musical theatre genre. Performance opportunities will utilize treadmills, rowers, bikes, ellipticals, and weight training machines. will be available. Students must acquire appropriate dance shoes and attire. This Students will proceed in timed intervals to train all the major muscle groups course may be taken two times for credit provided different topics are taken. and the cardiovascular system. Flexibility and core training will also be included in this workout. This class may be taken four times for credit. DANCE 495 INDEPENDENT STUDIES IN DANCE 1-3 UNITS Prerequisite: None FITNS 306 AEROBICS: CARDIO-KICKBOXING 1 UNIT Course Transferable to CSU Prerequisite: None. Hours: 18 hours LEC ; 54 hours LAB General Education: AA/AS Area III(a); CSU Area E2 Enrollment Limitation: None. DANCE 498 WORK EXPERIENCE IN DANCE 1-4 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 54 hours LAB (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS &DUGLR.LFNER[LQJLVDFDUGLRYDVFXODUZRUNRXWXWLOL]LQJNLFNVSXQFKHV YROXQWHHURSSRUWXQLW\RUMREUHODWHGWRWKHGDQFHÀHOG6WXGHQWVDUHDGYLVHG calisthenics and rope jumping to elevate heart rate and strengthen all major WRFRQVXOWZLWKWKH)/&'DQFH3URJUDPIDFXOW\WRUHYLHZVSHFLÀFGHJUHHZRUN muscle groups. Students will learn to apply these self defense techniques on experience requirements. Wavemasters and focus mitts to improve accuracy and provide resistance for the Course Transferable to CSU PXVFOHV6SHFLÀFVWUHQJWKHQLQJDQGVWUHWFKLQJH[HUFLVHVZLOODOVREHLQFOXGHG Hours: 300 hours LAB in this class. This course may be taken four times for credit. This course provides students with opportunities to develop marketable skills in SUHSDUDWLRQIRUHPSOR\PHQWRUDGYDQFHPHQWZLWKLQWKHÀHOGRIGDQFH&RXUVH FITNS 307 AEROBIC MIX 1 UNIT content will include understanding the application of education to the workforce; Prerequisite: None. completion of required forms which document the student’s progress and hours General Education: AA/AS Area III(a) spent at the work site; and developing workplace skills and competencies Course Transferable to UC/CSU UHODWHGWRGDQFHLQVWUXFWLRQGDQFHVWXGLRRIÀFHDGPLQLVWUDWLYHZRUNRURWKHU Hours: 54 hours LAB related activities. During the course of the semester, the student is required to This course is designed to help the student develop a balanced physical IXOÀOODKRXURULHQWDWLRQDQGKRXUVRIUHODWHGSDLGZRUNH[SHULHQFHRU ÀWQHVVSURÀOHDQGJDLQDÀUPXQGHUVWDQGLQJRISK\VLFDOÀWQHVVFRQFHSWV hours of unpaid work experience, for one unit. An additional 75 or 60 hours of Class components will emphasize a variety of aerobic activities, calisthenics, related work experience is required for each additional unit. The course may UHVLVWDQFHH[HUFLVHVDQGÁH[LELOLW\7KLVFRXUVHPD\EHWDNHQIRXUWLPHVIRU be taken four times for credit, for a maximum of 16 units when there is new credit. or expanded learning on the job or additional job responsibilities. FITNS 308 STEP AEROBICS 1 UNIT DANCE 499 EXPERIMENTAL OFFERING IN DANCE .5-4 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: CSU Area E2 Enrollment Limitation: None. Course Transferable to CSU Course Transferable to UC/CSU Hours: 72 hours LEC ; 54 hours LAB Hours: 54 hours LAB Step aerobics is a low impact cardiovascular workout that involves stepping XSDQGGRZQIURPDQDGMXVWDEOHSODWIRUPWRPXVLF5HVLVWLYHH[HUFLVHVÁRRU work, and stretching will also be included in this class. This class may be taken four times for credit. Folsom Lake College 2011-2012 Physical Education/Kinesiology 227 FITNS 324 MAT PILATES 1 UNIT FITNS 368 MINI FITNESS TOPICS .5 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a); CSU Area E2 Enrollment Limitation: None. Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 27 hours LAB Hours: 54 hours LAB 0LQLÀWQHVVWRSLFVDOORZVVWXGHQWVWRWDNHDYDULHW\RIÀWQHVVDFWLYLWLHVLQD Mat Pilates is a systematic method of mindful and precise conditioning exercises compressed time period. Topics within this course include: weight training, GHVLJQHGWRGHYHORSFRUHVWUHQJWKÁH[LELOLW\DQGERGLO\DZDUHQHVV7KURXJK FLUFXLWWUDLQLQJFDUGLRFLUFXLWWUDLQLQJ\RJDSLODWHVZDONLQJFDUGLRNLFNER[LQJ regular practice of the theoretical, philosophical and applied principles of and stretching. Students may take this course a maximum of four times, the Pilates method, students can expect to enjoy improved posture, strength, UHJDUGOHVVRIFRXUVHWRSLF6WXGHQWVKRXOGFRQVXOWWKHFODVVVFKHGXOHIRUVSHFLÀF FRQWUROEDODQFHÁH[LELOLW\DQGFRQFHQWUDWLRQ6WXGHQWVZLOOEHUHTXLUHGWR WRSLFVRIIHUHGHDFKVHPHVWHU3OHDVHQRWH WKLVFRXUVHIXOÀOOVKDOIRIWKH3( purchase a mat. requirement for graduation. FITNS 331 BOOT CAMP FITNESS 1 UNIT FITNS 380 CIRCUIT WEIGHT TRAINING 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a) General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LAB Hours: 54 hours LAB 7KLVFRXUVHLVGHVLJQHGWREHDSK\VLFDOO\LQWHQVHDQGFKDOOHQJLQJÀWQHVVFODVV &LUFXLW:HLJKW7UDLQLQJVKDOOLQWURGXFHWKHVWXGHQWWRDÀWQHVVSURJUDPRI Training exercises used during this class will include jogging, interval training, progressive resistive exercises designed to promote improvement in muscular hill running training, obstacle courses, and performing a variety of calisthenics VWUHQJWKDQGHQGXUDQFHFDUGLRYDVFXODUHQGXUDQFHDQGÁH[LELOLW\DVZHOODV designed to enhance muscular strength and endurance. In addition, students decrease in body fat percentage. The student will move in a prescribed circuit ZLOOEHFKDOOHQJHGWRXQGHUVWDQGDQGDSSO\ÀWQHVVWUDLQLQJSULQFLSOHVWRWKHLU (alternating timed lifting with active recovery) utilizing machines, free weights, training sessions. The students will train individually, with a partner or in a FDUGLRYDVFXODUDFWLYLWLHVDQGÁH[LELOLW\WUDLQLQJ7KLVFRXUVHPD\EHWDNHQIRXU team setting. This course may be taken four times for credit. times for credit. FITNS 332 OFF SEASON CONDITIONING .5-1 UNITS FITNS 381 WEIGHT TRAINING 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a) Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LAB Hours: 54 hours LAB This course is designed to optimize sports performance and reduce risk of injury 7KLVFODVVLVGHVLJQHGWRGHYHORSPXVFXODUÀWQHVVWKURXJKSURJUHVVLYHUHVLVWDQFH IRUWKHRIIVHDVRQLQWHUFROOHJLDWHDWKOHWH&RXUVHFRQWHQWZLOOLQFOXGH VSRUW training. Students will set up a personalized weight training program based VSHFLÀFVWUHQJWKWUDLQLQJFDUGLRYDVFXODUFRQGLWLRQLQJDJLOLW\ZRUNSO\RPHWULFV RQÀWQHVVDVVHVVPHQWVDQGSHUVRQDOJRDOV3URSHUOLIWLQJWHFKQLTXHVDIHW\ VSHHGWUDLQLQJDQGÁH[LELOLW\H[HUFLVHV7KLVFRXUVHPD\EHWDNHQIRXUWLPHV and program design will be emphasized. This course may be taken four times for a maximum of four units of credit. for credit. FITNS 352 POWER SCULPTING 1 UNIT FITNS 392 YOGA 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Enrollment Limitation: None. Hours: 54 hours LAB Course Transferable to UC/CSU Power Sculpting is a group training course designed to enhance muscular Hours: 54 hours LAB ÀWQHVVEDODQFHDQGLPSURYHERG\FRPSRVLWLRQWKURXJKWKHXVHRIUHVLVWDQFH Yoga is an East Indian method of mind/body exercise designed to stretch, HTXLSPHQWFRUHWUDLQLQJFDOLVWKHQLFVDQGÁH[LELOLW\H[HUFLVHV7KLVFRXUVH strengthen, and enhance muscle tone through the practice of asanas (poses) and may be taken four times. pranayama (breathing exercises). Yoga practice plus meditation helps decrease stress and increase energy levels while improving focus, concentration, and VHOIUHDOL]DWLRQ6WXGHQWVZLOOEHUHTXLUHGWRSXUFKDVHD\RJDPDW7KLVFRXUVH may be taken four times for credit. 228 Physical Education/Kinesiology Folsom Lake College 2011-2012 FITNS 395 STRETCH 1 UNIT FITNS 414 TAI CHI 1 UNIT Prerequisite: None. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LAB Hours: 54 hours LAB 7KLVFRXUVHLQVWUHWFKLQJZLOOHPSKDVL]HÁH[LELOLW\WUDLQLQJIRULQFUHDVHGKHDOWK This course explores Tai Chi and Qigong. Tai Chi is an ancient Chinese martial art DQGZHOOEHLQJWKURXJKVHOHFWHGH[HUFLVHVGHVLJQHGWRLQFUHDVHUDQJHRIPRWLRQ WKDWHPSKDVL]HVUHOD[DWLRQPHGLWDWLRQVHOIFXOWLYDWLRQDQGLQQHUFDOPUDWKHU in the primary muscle groups and joints of the body. It is designed to improve than strength to promote health while reducing stress. Qigong is an internal ÁH[LELOLW\UHGXFHVWUHVVDQGWHQVLRQLPSURYHFRRUGLQDWLRQLQFUHDVHUDQJHRI Chinese meditative practice that uses slow graceful movements and controlled motion, and prevent injuries. Students who participate in this class will gain a breathing techniques to promote well being. Students will learn Tai Chi and better understanding of how a comprehensive stretching routine will prepare Qigong forms with visualizations and movements designed to bring oneself IRUIXUWKHUYLJRURXVDFWLYLW\VXFKDVVSRUWVGDQFHPDUWLDODUWVRUZRUNUHODWHG into balance. The history and philosophy of Tai Chi will also be discussed. This movements. This class may be taken four times for credit. course may be taken four times for credit. FITNS 410 KARATE 1 UNIT FITNS 495 INDEPENDENT STUDIES IN FITNESS 1-3 UNITS Prerequisite: None. Prerequisite: None General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to CSU Course Transferable to UC/CSU Hours: 54 hours LAB Hours: 54 hours LAB FITNS 499 EXPERIMENTAL OFFERING IN FITNESS .5-4 UNITS This class in karate shall introduce the student to beginning skills and Prerequisite: None. movements in stances, blocking, punching, striking, kicking, kata (forms), and General Education: CSU Area E2 VHOIGHIHQVHWHFKQLTXHV7KHFRXUVHVKDOOLQFOXGHDOODVSHFWVRINDUDWHVSHFLÀF Course Transferable to CSU physical conditioning as well as instruction in the history and traditions, Hours: 54 hours LEC ; 54 hours LAB philosophy, etiquette, manners, courtesy, and language of the martial arts. This course offers a low impact, controlled group workout designed for Students will be required to purchase a karate uniform. This class may be individuals who need to improve mobility, balance and coordination; increase taken four times for credit. RYHUDOOÀWQHVVDQGPXVFOHVWUHQJWK UHGXFHWKHULVNRIIDOOV DQGHQKDQFH FITNS 413 OKINAWAN KOBUDO (WEAPONS) 1 UNIT IXQFWLRQDOÀWQHVV&ODVVFRPSRQHQWVLQFOXGHEXWDUHQRWOLPLWHGWRVWUHWFKLQJ Prerequisite: None. walking, chair exercises, strength training utilizing resistance bands and General Education: AA/AS Area III(a); CSU Area E2 light weights, breathing exercises, Yoga poses and Tai Chi forms. The class is Course Transferable to UC/CSU appropriate for students who have been out of physical activity for a long Hours: 54 hours LAB period of time, seniors, students with injuries, students with disabilities, 2NLQDZDQ.REXGRLVDVWXG\RIWKHDQFLHQWPHWKRGRIVHOIGHIHQVHZLWK students who cannot participate in more vigorous weight bearing activities, weapons, commonly known to be the bo staff, sai, nunchaku, tonfa, and DQGVWXGHQWVZKRQHHGWRHQKDQFHIXQFWLRQDOÀWQHVV7KLVFRXUVHPD\EHWDNHQ kama. This is a martial arts class which will introduce the student not only to three times for credit. the physical techniques in the use of these historically agricultural tools as weapons, but will provide the student with the historical, philosophical, and cultural aspects of this ancient art of weaponry. Students will also be instructed Physical Education - Kinesiology in the manners, courtesies, discipline, and protocol of the martial arts. Students will be required to purchase a kobudo uniform. This class may be taken four (KINES) [formerly Physical Education times for credit. - Theory (PET)] KINES 402 NUTRITION FOR FITNESS 2 UNITS Formerly: PET 402 Same As: NUTRI 307 Prerequisite: None. Course Transferable to CSU Hours: 36 hours LEC 6WXGHQWVZLOOVWXG\WKHEDVLFSULQFLSOHVRIQXWULWLRQDVZHOODVWKHUDPLÀFDWLRQV RIQXWULWLRQRQÀWQHVVWUDLQLQJ7KLVFRXUVHLVSDUWRIWKH)LWQHVV3URIHVVLRQDO &HUWLÀFDWH3URJUDPRIIHUHGWKURXJKWKH3K\VLFDO(GXFDWLRQ'HSDUWPHQW7KLV course was formerly known as PET 402. This course is not open to students who have completed NUTRI 307. Folsom Lake College 2011-2012 Physical Education/Kinesiology 229 KINES 410 PERSONAL TRAINER CERTIFICATION: EXERCISE KINES 414 FITNESS FACILITY MANAGEMENT 3 UNITS SCIENCE & FITNESS ASSESSMENT 3 UNITS Formerly: PET 414 Formerly: PET 410 Prerequisite: None. Prerequisite: None. Course Transferable to CSU Advisory: BIOL 310 Hours: 54 hours LEC General Education: AA/AS Area III(b) This course is designed to provide students with the basic guidelines for Enrollment Limitation: None. VWDUWLQJDQGPDQDJLQJKHDOWKÀWQHVVDQGVWXGLRIDFLOLWLHVLQWKHSULYDWHVHFWRU Course Transferable to CSU 7RSLFVFRYHUHGLQFOXGHLQLWLDOVWDUWXSRIWKHIDFLOLW\RSHUDWLQJSURFHGXUHVZLWK Hours: 54 hours LEC emphasis on equipment selection and arrangement, employee selection and This course is designed to provide the theoretical knowledge necessary to training, program planning, member management, and marketing. This course prepare for the American Council on Exercise’s National Personal Training was formerly known as PET 414. &HUWLÀFDWLRQ([DP7RSLFVLQFOXGHWKHIROORZLQJ H[HUFLVHSK\VLRORJ\KXPDQ anatomy, applied kinesiology, basic nutrition, health screening, the theory KINES 415 DESIGNING FITNESS TRAINING FOR THE ACTIVE RIÀWQHVVDVVHVVPHQWDQGH[HUFLVHDGDSWDWLRQ7KLVZDVIRUPHUO\NQRZQDV OLDER ADULT 2 UNITS PET 410. Formerly: PET 415 Prerequisite: None. KINES 411 PERSONAL TRAINER CERTIFICATION: PROGRAM Course Transferable to CSU DESIGN & INSTRUCTIONAL METHODOLOGY 3.5 UNITS Hours: 36 hours LEC Formerly: PET 411 7KLVFRXUVHZLOOWHDFKÀWQHVVLQVWUXFWRUVKRZWRGHVLJQDQGLPSOHPHQWSURJUDPV Prerequisite: HEED 320 (CPR: BLS for the Professional Rescuer) and KINES 410 that are sensitive to the physical needs of the senior population. Participants 3HUVRQDO7UDLQHU&HUWLÀFDWLRQ ([HUFLVH6FLHQFH )LWQHVV$VVHVVPHQW ZLWK will learn how to modify exercise based on age and medical conditions. grades of “C” or better; Students may substitute HEED 314 for HEED 320. Upon successful completion of this course, students will have the theoretical 6WXGHQWVPD\DOVRPHHWWKH+(('RUSUHUHTXLVLWHE\KROGLQJDYDOLG knowledge and practical skills necessary to design an exercise program which CPR/AED card from the American Heart Association or American Red Cross is appropriate for older adults, based on age and medical conditions. This course Enrollment Limitation: None. was formerly known as PET 415. Course Transferable to CSU Hours: 54 hours LEC ; 27 hours LAB KINES 416 SPORT AND FITNESS PSYCHOLOGY: MOTIVATIONAL This course is designed to provide the student with the theoretical knowledge STRATEGIES FOR BEHAVIORAL CHANGE 2 UNITS and practical skills needed to prepare for the American Council on Exercise’s Formerly: PET 416 1DWLRQDO3HUVRQDO7UDLQLQJ&HUWLÀFDWLRQ([DPLQDWLRQ7RSLFVLQFOXGH DSSOLFDWLRQ Prerequisite: None. of the applied sciences, program design and implementation of integrated Course Transferable to CSU ÀWQHVVWUDLQLQJIRUKHDOWK\DGXOWVDQGVSHFLDOSRSXODWLRQVFRPPXQLFDWLRQ Hours: 36 hours LEC health psychology, teaching techniques, injury prevention and safety, This course will explore the concepts, theories, and techniques of sport and professional responsibilities, and business fundamentals. This course was ÀWQHVVSV\FKRORJ\WKDWZLOODOORZFRDFKHVSHUVRQDOWUDLQHUVJURXSÀWQHVVDQG formerly known as PET 411. dance instructors to motivate behavioral changes in their athletes and clients. This course was formerly known as PET 416. KINES 413 GROUP FITNESS INSTRUCTOR CERTIFICATION 3 UNITS Formerly: PET 413 KINES 417 FITNESS INJURY PREVENTION AND MANAGEMENT Prerequisite: None. 2 UNITS Advisory: HEED 312 Formerly: PET 417 Course Transferable to CSU Prerequisite: None. Hours: 45 hours LEC ; 27 hours LAB Course Transferable to CSU This course is designed to provide students with the foundational knowledge, Hours: 36 hours LEC LQVWUXFWLRQDOWHFKQLTXHVDQGSURIHVVLRQDOUHVSRQVLELOLWLHVDJURXSÀWQHVV This course is an introduction to the identification, care, prevention and instructor needs to teach safe and effective exercise. This course will prepare PDQDJHPHQWRIFKURQLFRYHUXVHÀWQHVVLQMXULHVDQGEDVLFÀUVWDLGIRUWKHÀWQHVV students for the American Council on Exercise’s National Group Fitness Instructor LQGXVWU\LQVWUXFWRURUIRUWKHVWXGHQWRIÀWQHVVRUFRQGLWLRQLQJFODVVHV7KLV &HUWLÀFDWLRQ([DP7KLVFRXUVHZDVIRUPHUO\NQRZQDV3(7 class does not deal with extreme trauma injuries that might occur in athletics. This course was formerly known as PET 417. 230 Physical Education/Kinesiology Folsom Lake College 2011-2012 KINES 498 WORK EXPERIENCE IN PHYSICAL EDUCATION PACT 350 GOLF 1 UNIT 1-4 UNITS Prerequisite: None. Formerly: PET 498 General Education: AA/AS Area III(a); CSU Area E2 Prerequisite: None. Course Transferable to UC/CSU Advisory: ENGWR 101 Hours: 54 hours LAB (QUROOPHQW/LPLWDWLRQ 6WXGHQWVPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS This golf class shall introduce the student to the basic skills of the game: volunteer opportunity or job related to physical education. Students are advised full swing, chipping, pitching, putting, and sand play. Students shall also be to consult with the Physical Education/Kinesiology Department faculty to review instructed in the design and purpose of the various clubs and equipment, basic VSHFLÀFFHUWLÀFDWHDQGGHJUHHZRUNH[SHULHQFHUHTXLUHPHQWV rules and etiquette, scoring and score cards, handicapping, golf course layout, Course Transferable to CSU DQGJROIWHUPLQRORJ\7KHFRXUVHLVGHVLJQHGWRSURYLGHVXIÀFLHQWVNLOOVSUDFWLFH Hours: 300 hours LAB and knowledge of game procedure to allow each student to be able to play This course provides students with opportunities to develop marketable skills the game on a regulation golf course and enjoy the game as a lifetime leisure LQSUHSDUDWLRQIRUHPSOR\PHQWRUDGYDQFHPHQWZLWKLQWKHÀHOGRISK\VLFDO pursuit. This class may be taken four times for credit. education. It is designed for students interested in work experience and/or internships in transfer level degree occupational programs. Course content PACT 390 TENNIS 1 UNIT includes understanding the application of education to the workforce; completion Prerequisite: None. of required forms which document the student’s progress and hours spent at the General Education: AA/AS Area III(a); CSU Area E2 work site; and developing workplace skills and competencies. Appropriate level Enrollment Limitation: none learning objectives are established by the student and the employer. During the Course Transferable to UC/CSU VHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODZHHNO\RULHQWDWLRQDQGKRXUVRI Hours: 54 hours LAB related paid work experience, or 60 hours of unpaid work experience for one Tennis covers skills, rules, etiquette, and strategies of the game. Beginning tennis unit. An additional 75 or 60 hours of related work experience is required for each GHYHORSVHIÀFLHQF\RIEDVLFVNLOOVVXFKDVJURXQGVWURNHVVHUYLQJYROOH\LQJ DGGLWLRQDOXQLW7KHZHHNO\RULHQWDWLRQLVUHTXLUHGIRUÀUVWWLPHSDUWLFLSDQWV HOHPHQWDU\VWUDWHJLHVDQGJDPHUXOHV,QWHUPHGLDWHWHQQLVGHYHORSVUHÀQHPHQW returning participants are not required to attend the orientation weekly but of playing skills and strategies. Tennis stimulates enjoyable, cooperative, and are required to meet with the instructor as needed to complete all program competitive modes of behavior and promotes awareness of physical activity forms and assignments. Work Experience may be taken for a total of 16 units IRUOLIHORQJKHDOWKDQGÀWQHVV7KLVFRXUVHPD\EHWDNHQIRXUWLPHVIRUFUHGLW when there are new or expanded learning objectives. PACT 495 INDEPENDENT STUDIES IN PERSONAL ACTIVITY 1-3 UNITS Prerequisite: None Physical Education - Personal General Education: CSU Area E Activities (PACT) Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB PACT 300 ARCHERY 1 UNIT Prerequisite: None. PACT 499 EXPERIMENTAL OFFERING IN PERSONAL ACTIVITY General Education: AA/AS Area III(a); CSU Area E2 .5-4 UNITS Course Transferable to UC/CSU Prerequisite: None Hours: 54 hours LAB General Education: CSU Area E This course in target archery shall emphasize basic skill development and Course Transferable to CSU practice in the various shooting techniques of the recurve bow and arrow. Topics Hours: 18 hours LEC ; 54 hours LAB will include safety and range procedures, correct shooting form, scoring, use of the mechanical sight, and methods for developing the physical and mental strategies necessary for improved shooting performance. The student shall gain an appreciation for the sport of archery as a lifetime leisure pursuit. Students ZLOOEHUHTXLUHGWRSXUFKDVHDUPJXDUGVDQGÀQJHUVWDEV7KLVFODVVPD\EH taken 4 times for credit. Folsom Lake College 2011-2012 Physical Education/Kinesiology 231 SPORT 380 TENNIS, INTERCOLLEGIATE-MEN 2 UNITS Physical Education - Sports (SPORT) Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 SPORT 320 CROSS COUNTRY, INTERCOLLEGIATE-MEN 2 UNITS Enrollment Limitation: Prior to enrollment, the student must demonstrate Prerequisite: None. intercollegiate athletic skills via a tryout conducted by the coaching staff. General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Enrollment Limitation: Prior to enrollment, the student must demonstrate Hours: 180 hours LAB intercollegiate athletic skills via a tryout conducted by the coaching staff. This is an advanced tennis team activity for male students that provides Course Transferable to UC/CSU competition with other community college teams. Knowledge of tennis Hours: 180 hours LAB fundamentals, rules, and individual and/or team strategies appropriate to 7KLVLVDQDGYDQFHGFURVVFRXQWU\WHDPDFWLYLW\IRUPDOHVWXGHQWVWKDWSURYLGHV intercollegiate athletic competition will be expected of competitors. This course competition with other community college teams. Knowledge of running may be taken three times for credit. fundamentals, rules, and individual and/or team strategies appropriate to intercollegiate athletic competition will be expected of competitors. This course SPORT 385 TENNIS, INTERCOLLEGIATE-WOMEN 2 UNITS may be taken three times for credit. Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 SPORT 325 CROSS COUNTRY, INTERCOLLEGIATE-WOMEN 2 UNITS Enrollment Limitation: Prior to enrollment, the student must demonstrate Prerequisite: None. intercollegiate athletic skills via a tryout conducted by the coaching staff. General Education: AA/AS Area III(a); CSU Area E2 Course Transferable to UC/CSU Enrollment Limitation: Prior to enrollment, the student must demonstrate Hours: 180 hours LAB intercollegiate athletic skills via a tryout conducted by the coaching staff. This is an advanced tennis team activity for female students that provides Course Transferable to UC/CSU competition with other community college teams. Knowledge of tennis Hours: 180 hours LAB fundamentals, rules, and individual and/or team strategies appropriate to 7KLVLVDQDGYDQFHGFURVVFRXQWU\WHDPDFWLYLW\IRUIHPDOHVWXGHQWVWKDWSURYLGHV intercollegiate athletic competition will be expected of competitors. This course competition with other community college teams. Knowledge of running may be taken three times for credit. fundamentals, rules, and individual and/or team strategies appropriate to intercollegiate athletic competition will be expected of competitors. This course may be taken three times for credit. SPORT 340 GOLF, INTERCOLLEGIATE-MEN 2 UNITS Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 Enrollment Limitation: Prior to enrollment, the student must demonstrate intercollegiate golf skills via a tryout conducted by the coaching staff. Course Transferable to UC/CSU Hours: 180 hours LAB This course is an advanced golf team activity for male students that provides competition against other community college teams. Golf fundamentals, rules, individual and/or team strategies appropriate to intercollegiate athletic competition will be expected of the competitors. This course may be taken three times for credit. SPORT 345 GOLF, INTERCOLLEGIATE-WOMEN 2 UNITS Prerequisite: None. General Education: AA/AS Area III(a); CSU Area E2 Enrollment Limitation: Prior to enrollment, the student must demonstrate intercollegiate golf skills via a tryout as conducted by the coaching staff. Course Transferable to UC/CSU Hours: 180 hours LAB This course is an advanced golf team activity for female students that provides competition against other community college teams. Golf fundamentals, rules, individual and/or team strategies appropriate to intercollegiate athletic competition will be expected of the competitors. This course may be taken three times for credit. 232 Physical Science, Physics, & Astronomy Folsom Lake College 2011-2012 Physical Science, Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Physics, & Astronomy COUNSELING Rancho Cordova Center - 916-255-0717 The Folsom Lake College Physics, Physical Science and Astronomy department offers a full array of transferable Physical Science (PS) FRXUVHVWKDWIXOÀOOERWKPDMRUDQGJHQHUDOHGXFDWLRQ PS 302 INTRODUCTION TO PHYSICAL SCIENCE 4 UNITS requirements. Prerequisite: None. General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A The Physics program consists of a three-semester Course Transferable to UC/CSU calculus-based physics sequence and a two-semester Hours: 54 hours LEC ; 54 hours LAB trigonometry-based sequence. These sequences are 7KLVLVDQLQWHJUDWHGLQWHUGLVFLSOLQDU\FRXUVHZKLFKLQWURGXFHVWKHQRQ designed to meet transfer requirements for students in science major student to the physical sciences. Fundamental concepts in the physical and life sciences, engineering, architecture, astronomy, physics, chemistry and geology will be examined. This course is and computer information science. A conceptual physics not recommended for science or engineering majors. course for non-science majors and a preparatory physics course are also offered. PS 495 INDEPENDENT STUDIES IN PHYSICAL SCIENCE 1-3 UNITS Prerequisite: None The courses in Astronomy and Physical Science are offered Course Transferable to CSU as part of the general education program at Folsom Lake Hours: 18 hours LEC ; 3 hours LAB College. The physical science course emphasizes a hands PS 499 EXPERIMENTAL OFFERING IN PHYSICAL SCIENCE on learning experience. Both courses are an excellent .5-4 UNITS way for the liberal arts students to gain an appreciation Prerequisite: None RIVFLHQWLÀFNQRZOHGJHDQGPHWKRGV Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Career Options CALCULUS-BASED PHYSICS: Physicist; Engineer; Meteorologist; Oceanographer; Geologist; Physical Scientist; Astronomer; Chemist; Physics (PHYS) Architect; Computer Scientist PHYS 310 CONCEPTUAL PHYSICS 3 UNITS Prerequisite: None. TRIGONOMETRY-BASED PHYSICS: General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A 3UH0HG $OOLHG+HDOWK /LIH6FLHQFHÀHOGV Course Transferable to UC/CSU Hours: 54 hours LEC Highlights This course provides a conceptual overview of Newtonian and modern physics Modern and well-equipped laboratories IRUQRQVFLHQFHDQGVFLHQFHVWXGHQWVDOLNH7KHFRQFHSWXDORUQRQPDWKHPDWLFDO Small class size approach to physics is tied to the student’s personal experience in the everyday world, so that the student learns to see physics not as a classroom or laboratory activity, but as a part of his or her surroundings. The class is open to all students with no previous physics course. Folsom Lake College 2011-2012 Physical Science, Physics, & Astronomy 233 PHYS 311 BASIC PHYSICS 3 UNITS PHYS 431 HEAT, WAVES, LIGHT AND MODERN PHYSICS 4 UNITS Prerequisite: MATH 335 with a grade of “C” or better; or a high school course Prerequisite: MATH 401 and PHYS 411 with grades of “C” or better in trigonometry with a grade of “C” or better General Education: CSU Area B1; CSU Area B3; IGETC Area 5A General Education: AA/AS Area IV; CSU Area B1; IGETC Area 5A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB Hours: 54 hours LEC 7KLVLVWKHWKLUGFRXUVHRIWKHFDOFXOXVEDVHGSK\VLFVVHTXHQFHGHVLJQHG This course is a survey course for science, engineering, mathematics, for students studying engineering, physics, chemistry, architecture, and architecture, and computer science majors who have had no previous physics computer science. This course offers a detailed examination of topics from courses and plan to continue with PHYS 350 or 411. The course will develop thermodynamics, waves, optics, and modern physics. WKHPDWKDQGVFLHQFHEDFNJURXQGDQGWKHSUREOHPVROYLQJVNLOOVQHFHVVDU\IRU success in PHYS 350 or 411. Material covered will include math review, vectors, PHYS 495 INDEPENDENT STUDIES IN PHYSICS 1-3 UNITS and basic mechanics (kinematics, Newton’s Laws, energy). Prerequisite: None Course Transferable to CSU PHYS 350 GENERAL PHYSICS 4 UNITS Hours: 18 hours LEC ; 3 hours LAB Prerequisite: MATH 335 with a grade of “C” or better; or a high school course PHYS 499 EXPERIMENTAL OFFERING IN PHYSICS .5-4 UNITS in trigonometry with a grade of “C” or better. Prerequisite: None General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC ; 54 hours LAB 7KLVLVWKHÀUVWFRXUVHRIWKHWULJRQRPHWU\EDVHGJHQHUDOSK\VLFVVHTXHQFH GHVLJQHGIRUOLIHVFLHQFHPDMRUV7RSLFVZLOOLQFOXGHFODVVLFDOPHFKDQLFVÁXLGV mechanical waves and thermodynamics. PHYS 360 GENERAL PHYSICS 4 UNITS Prerequisite: PHYS 350 with a grade of “C” or better General Education: CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB This is the second course of the trigonometry based general physics sequence designed for life science majors. Topics will include classical electricity and magnetism, AC and DC circuits, electromagnetism, optics, wave theory and modern physics. PHYS 411 MECHANICS OF SOLIDS AND FLUIDS 4 UNITS Prerequisite: None. Corequisite: MATH 401 with a grade of “C” or better. May be taken previously. General Education: AA/AS Area IV; CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB 7KLVLVWKHÀUVWFRXUVHRIWKHFDOFXOXVEDVHGSK\VLFVVHTXHQFHGHVLJQHGIRU students studying engineering, physics, chemistry, architecture, and computer science. This course offers a detailed examination of topics from the mechanics RISDUWLFOHVULJLGERGLHVDQGÁXLGV PHYS 421 ELECTRICITY AND MAGNETISM 4 UNITS Prerequisite: MATH 401 and PHYS 411 with grades of “C” or better General Education: CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Hours: 54 hours LEC ; 54 hours LAB 7KLVLVWKHVHFRQGFRXUVHRIWKHFDOFXOXVEDVHGSK\VLFVVHTXHQFHGHVLJQHGIRU students studying engineering, physics, chemistry, architecture, and computer science. This course offers a detailed examination of topics from electricity and magnetism. 234 Physical Science, Physics, & Astronomy Folsom Lake College 2011-2012 Astronomy (ASTR) ASTR 300 INTRODUCTION TO ASTRONOMY 3 UNITS Prerequisite: None. General Education: AA/AS Area IV; CSU Area B1 Course Transferable to CSU Hours: 54 hours LEC This is a general course in astronomy that examines the nature and evolution of the solar system, stars, galaxies, cosmology and life in the universe. ASTR 400 ASTRONOMY LABORATORY 1 UNIT Prerequisite: None. Corequisite: ASTR 300 (may be taken previously) General Education: CSU Area B1; CSU Area B3; IGETC Area 5A Course Transferable to UC/CSU Hours: 54 hours LAB This course introduces students to various types of astronomical observations and presents the tools needed to analyze and interpret astronomical data. ASTR 495 INDEPENDENT STUDIES IN ASTRONOMY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB ASTR 499 EXPERIMENTAL OFFERING IN ASTRONOMY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Political Science 235 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Political Science COUNSELING Rancho Cordova Center - 916-255-0717 Political Science involves the study of governmental Highlights structures and political systems, as well as the examination Courses in both American and foreign political of how individuals and institutions interact within those structures systems. Courses in our department are designed to Widely traveled and internationally astute introduce students to principle concepts, to stimulate instructional staff an interest in the connection between theoretical ideas Insightful analysis of international events and real world events, and to motivate involvement Suggestions/contacts for student involvement in the and participation in the political process. Students are political process encouraged to think critically and creatively about issues facing them, their communities, their state, and their world. Pre-Law Education Pre-law, contrary to common belief, is not a major but Faculty in the Political Science department are widely rather a term that describes a student interested in traveled and have practical experience in a variety of applying for admission to a law school. governmental and political professions. They are focused on providing stimulating instruction in an atmosphere Because overall GPA is important in applying for that encourages and emphasizes student participation. admission to a law school, a pre-law student should $OO FRXUVHV UHTXLUH VLJQLÀFDQW ZULWLQJ DQG UHVHDUFK consider a major which he/she enjoys and can do well. Completion of English 101 or eligibility for English 300 It is advisable to consider the major as an alternative to is advised for all courses. Student success is a priority law school or one which can be used in conjunction with the and attention is paid to the individual needs of those law degree. Law schools are looking for individuals who enrolled. Educational resources are available through have a high level of writing competence; good analytical the college and the department for students who may skills; intellectual discipline; breadth in humanities, sciences require additional assistance. and social sciences; and a general understanding of the business world. Most law schools require a baccalaureate Our introductory courses also prepare students for further degree. The Law School Admission Test (LSAT) is required. study of political science and government theories and A pre-law student needs to plan a course of study in practice at the university level. Supervised internships cooperation with a counselor in the Counseling Center. and special studies in political, governmental or related organizations are also available for credit. Most of the courses we offer are transferable to accredited XQLYHUVLWLHVDQGIXOÀOOJHQHUDOHGXFDWLRQUHTXLUHPHQWVIRU Political Science (POLS) DYDULHW\RIPDMRUDQGGHJUHHSURJUDPVDQGFHUWLÀFDWHV POLS 301 INTRODUCTION TO GOVERNMENT: UNITED STATES Career Options 3 UNITS Political Science courses help students develop and Prerequisite: None. practice research, writing, and analysis skills that are Advisory: ENGWR 101 UHOHYDQWWRPDQ\SURIHVVLRQDOÀHOGV7KHVHLQWURGXFWRU\ General Education: AA/AS Area V(a); CSU Area D8; CSU Area F2; CSU Area F3; courses provide students with a better understanding IGETC Area 4H of politics and political systems which can assist them Course Transferable to UC/CSU DV D ÀUVW VWHS WRZDUG FDUHHUV LQ ODZ DGPLQLVWUDWLRQ Hours: 54 hours LEC business, politics, teaching, military leadership, foreign This course is an introduction to political science, American government and service, journalism, urban planning, local, state or federal politics and is structured to promote political and analytical understanding and government, legislative analysis and advocacy, public thinking regarding American politics and government. Areas of concentration relations, civil service and many others. include principles, institutions, problems, processes, theory, philosophy, and ideology. 236 Political Science Folsom Lake College 2011-2012 POLS 302 INTRODUCTION TO GOVERNMENT: FOREIGN 3 UNITS Prerequisite: None. Advisory: ENGWR 101 General Education: AA/AS Area V(b); CSU Area D8; IGETC Area 4H Course Transferable to UC/CSU Hours: 54 hours LEC This course is a comparative study and analysis of political systems, ideologies, institutions, policies, cultures, histories, and the development of selected foreign governments. Special emphasis is placed on the impact of both cultural and social dimensions of political behavior and attitudes on the structures DQGIXQFWLRQVRIJRYHUQPHQW7\SLFDOQDWLRQVWDWHVFDVHVZLOOEHLQFOXVLYH of all geographical regions. Instruction will also cover the phenomenon of JOREDOL]DWLRQDQGLWVHIIHFWRQWKHQDWLRQVWDWHVH[DPLQHGWKURXJKRXWWKHFRXUVH POLS 310 INTRODUCTION TO INTERNATIONAL RELATIONS 3 UNITS Prerequisite: None. Advisory: Completion of ENGWR 101 or eligibility for ENGWR 300 is advised. General Education: AA/AS Area V(b); CSU Area D8; IGETC Area 4H Course Transferable to UC/CSU Hours: 54 hours LEC This course is an introduction to international relations and a survey of the QDWLRQVWDWHV\VWHPWHFKQLTXHVRILQWHUDFWLRQWKHLVVXHRIZDUQDWLRQDOLVP power alignments, international actors, transnational movements, diplomacy, political economy, and perceptions in world politics. Particular emphasis is placed on understanding the processes associated with globalization and the impact such processes are having upon the conduct of international relations. POLS 495 INDEPENDENT STUDIES IN POLITICAL SCIENCE 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB POLS 499 EXPERIMENTAL OFFERING IN POLITICAL SCIENCE .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Project Management 237 Project Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Management COUNSELING Rancho Cordova Center - 916-255-0717 CERTIFICATE OF ACHIEVEMENT CERTIFICATE OF ACHIEVEMENT Project Management Project Management REQUIRED PROGRAM ...... Units Project management discipline continues to grow PRJMGT 300 Introduction to Project Management .....3 exponentially and now practiced and highly relevant PRJMGT 310 Project Integration and Scope to the new emerging market of project management in Management ...... 3 professional services like Health Care, Pharmacy, Human PRJMGT 320 Project Time and Cost Management .....3 Resources, Finance, Manufacturing, Construction, and PRJMGT 330 Project Quality Management ...... 3 Information Technology, which is largely being driven by PRJMGT 340 Project Communication and Human government modernization and large scale outsourcing. Resource Mgmt ...... 3 This dynamic curriculum provides advanced skills and PRJMGT 350 Project Risk Management and Project practical instruction on the processes, organizational Procurement Management ...... 3 structure, and tools that assure that project work yields TOTAL UNITS REQUIRED ...... 18 the desired business results. This program is thus ideal for professionals who want to enhance their ability to This dynamic curriculum provides advanced skills and integrate complex projects, motivate people, and achieve practical instruction on the processes, organizational structure, cost-effective results. and tools which assure that project work yields the desired business results in professional services such as Health Career Options Care, Pharmacy, Human Resources, Finance, Manufacturing, The Project Management program is designed for Construction, and Information Technology, which is largely professionals seeking to improve their professional being driven by government modernization and large scale repertoire with knowledge of project management. The outsourcing. This program is thus ideal for professionals who project management practice can be applied to several want to enhance their ability to integrate complex projects, FDUHHUÀHOGVVXFKDVKHDOWKFDUHSKDUPDFHXWLFDOVHUYLFH motivate people, and achieve cost-effective results. outsourcing information technology, manufacturing, FRQVWUXFWLRQ DQG JRYHUQPHQW 7KLV FHUWLÀFDWH LV D Upon completion of this program, the student will be able to: management development program suitable for: $SSO\DVLJQLÀFDQWUDQJHRISURIHVVLRQDODQGEXVLQHVV Graduates who wish to pursue a career in Project skills, practices and techniques in project management. Management. Analyze, plan and undertake effective leadership and Project Managers who wish to develop their executive decision-making. SURIHVVLRQDO SUDFWLFH DQG JDLQ D TXDOLÀFDWLRQ LQ Communicate effectively within a discipline and this specialist area. industry, including both people-related communication People from a range of disciplines who undertake and teamwork. Project Management as part of their job role or Initiate, manage and drive change through the who wish to move into this professional discipline. DSSOLFDWLRQRIVRXQGÀQDQFLDODQGEXVLQHVVFRPSHWHQFH Undertake individual and team research and/or consultancy based projects. Describe the nature and functions of project management as well as understand the project life cycle and processes. Describe the competency model for project managers as well as the project manager job functions. Build a cohesive and productive project team and learn techniques to deal with the practical and emotional issues involved in team building including coordinating efforts across multiple units of the organization. 238 Project Management Folsom Lake College 2011-2012 Apply and use project management software to plan PRJMGT 320 PROJECT TIME AND COST MANAGEMENT 3 UNITS and control a project. Prerequisite: PRJMGT 310 with a grade of “C” or better Use project management techniques to document and Course Transferable to CSU monitor the progress of a project. Hours: 54 hours LEC Evaluate the outcome of a project. This course provides project managers methods to effectively plan and manage Review and apply lessons learned to transfer lessons the project schedule and cost. The time management portion of this course learned back to the real job environment. covers activity breakdown, estimation, sequencing and scheduling. The cost Simulate building a project dealing with performance, management portion discusses how to estimate and develop a budget, and scheduling, and control issues as well as dealing with why any budget is an estimate prior to the reporting of the actual costs. The leadership and management concerns. cost topic also covers resource planning, cost estimation, cost control systems, Analyze methods to control project in a resource- project budgeting and the basic accounting principles you need to know to constrained environment, while balancing competing ensure the success of your project. time versus cost versus resources versus quality and performance. PRJMGT 330 PROJECT QUALITY MANAGEMENT 3 UNITS Prerequisite: PRJMGT 310 with a grade of “C” or better Course Transferable to CSU Hours: 54 hours LEC Project Management (PRJMGT) This course builds on the introductory project management class to explore the PRJMGT 300 INTRODUCTION TO PROJECT MANAGEMENT project quality management processes of quality planning, quality assurance, 3 UNITS and quality control necessary to successfully meet conformance to project Prerequisite: None. UHTXLUHPHQWVDQGÀWQHVVRIXVH4XDOLW\VWDQGDUGVDQGYDULRXVPHWKRGRORJLHV Course Transferable to CSU are explored as tools and techniques used to manage project quality. The cost Hours: 54 hours LEC RISRRUTXDOLW\LVH[SODLQHGDVZHOODVWKHFRVWEHQHÀWDVVRFLDWHGZLWKTXDOLW\ This is an introductory course covering the following topics: fundamental processes and procedures. project management terminology, skills, concepts and techniques, how the project management processes are linked together, and role of stakeholders PRJMGT 340 PROJECT COMMUNICATION AND HUMAN RESOURCE DQGRUJDQL]DWLRQDOLQÁXHQFHVRQSURMHFWV MANAGEMENT 3 UNITS Prerequisite: PRJMGT 310 with a grade of “C” or better PRJMGT 310 PROJECT INTEGRATION AND SCOPE MANAGEMENT Course Transferable to CSU 3 UNITS Hours: 54 hours LEC Prerequisite: PRJMGT 300 with a grade of “C” or better The course explores the multiple communication channels within a project team Course Transferable to CSU and between a project and its various stakeholders. The course also discusses Hours: 54 hours LEC the issues around the management of the performance of all individuals Successful project outcomes depend on an effective project management plan, involved in ensuring project success. development and execution, as well as adherence to a scope management process. They also begin with the proper integration of related project elements PRJMGT 350 PROJECT RISK MANAGEMENT AND PROJECT across project process groups and knowledge areas. The course builds on the PROCUREMENT MANAGEMENT 3 UNITS introductory project management class to explore the project integration Prerequisite: PRJMGT 310 with a grade of “C” or better management processes to successfully integrate processes and activities Course Transferable to CSU UHTXLUHGWRGHÀQHDQGFRRUGLQDWHWKHSURMHFWHIIRUWZLWKLQDQGDFURVVWKHSURMHFW Hours: 54 hours LEC process including: project plan development, project plan execution, and overall This course prepares project managers to gather information to successfully change control. The scope management portion of this course will discuss the manage and respond to risks and opportunities through probability assessment project scope management processes that ensure that all the work necessary and developing mitigation strategies for risks that may impact the project’s to complete the project are included in the scope of the works, but that no triple constraint. The course also equips project managers with tools to research unnecessary work is included, as this would represent an unnecessary risk to and acquire goods and services needed by the project either within or external the project performance, especially in terms of the budget and the schedule. to the organization. Folsom Lake College 2011-2012 Project Management 239 PRJMGT 495 INDEPENDENT STUDIES IN PROJECT MANAGEMENT 1-3 UNITS Prerequisite: None Hours: hours LEC PRJMGT 499 EXPERIMENTAL OFFERING IN PROJECT MANAGEMENT .5-4 UNITS Prerequisite: None Hours: 54 hours LEC 240 Psychology Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Psychology COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE DEGREE A.A. - Psychology A.A. — Psychology Psychology concerns itself with the study of behavior REQUIRED PROGRAM ...... Units and mental processes. Part of its appeal and fascination PSYC 300 General Principles ...... 3 is the fact that it involves both pure science and the PSYC 312 Biological Psychology...... 4 practical application of science to matters of everyday PSYC 320 Social Psychology ...... 3 OLIH7KRVHSXUVXLQJSV\FKRORJ\DVDÀHOGRIVWXG\ZLOO PSYC 330 Introductory Statistics for the Behavioral ÀQGPDQ\FDUHHURSWLRQVFHQWHULQJDURXQGKHOSLQJRWKHUV Sciences ...... 3 understand, predict, and control or modify behavior. PSYC 335 Research Methods in Psychology ...... 3 A minimum of 3 units from the following: Career Options PSYC 340, PSYC 351, PSYC 354, PSYC 356, PSYC Career options as educators, scientists, consultants, 358, PSYC 360, PSYC 368, PSYC 370/FCS 324, practitioners and mental health professionals with some PSYC 372/ECE 312, PSYC 380, PSYC 495, PSYC 499 of the following titles: TOTAL UNITS REQUIRED ...... 19 Administrator; Behavior Analyst; Childcare Worker; College Professor; College Counselor; Social Services This A.A. degree may be obtained by completion of the Counselor; Human Services Specialist; Marketing Required Program, plus General Education Requirements, Specialist; Personnel Analyst; Probation Officer; SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO Psychiatric Tech/Aide; Psychologist; Psychometrist; Public Survey; Research Therapist; Training/Development The psychology degree is designed to facilitate students’ Specialist; Ward Attendant; Youth Supervisor successful transfer to BA programs, completion of which prepares them for advanced study in a variety of graduate Some career options may require more than two years programs. Psychologists with graduate degrees and of college study. SURIHVVLRQDOFHUWLÀFDWHVKDYHDEURDGUDQJHRIHPSOR\PHQW opportunities including, but not limited to, clinical practice, Highlights research, and teaching. Clinical psychologists work in a Exemplary instructional staff that includes authors variety of settings and with a wide range of clients. Research and researchers SV\FKRORJLVWV ZRUN LQ D UDQJH RI ÀHOGV DVVRFLDWHG ZLWK Varied course offerings including psychology of the study of human behavior, including biomedical, sports women and human sexuality psychology, and cognitive neuroscience. Psychology courses complement AA degrees and/ RUFHUWLÀFDWLRQVLQPDQ\RWKHUÀHOGV $GPLQLVWUDWLRQ Upon completion of this program, the student will be able to: of Justice, Anthropology, Communications Media, Demonstrate familiarity with the major concepts, Corrections, Early Childhood Education, Human WKHRUHWLFDO SHUVSHFWLYHV HPSLULFDO ÀQGLQJV DQG Services, Interdisciplinary Studies, Marketing/ historical trends in psychology. Business, Health/Medicine, Consumer Affairs, and Understand and apply basic research methods in the military. psychology, including research design, data analysis, and interpretation Respect and use critical and creative thinking, skeptical LQTXLU\ DQG ZKHQ SRVVLEOH WKH VFLHQWLÀF DSSURDFK to solve problems related to behavior and mental processes. Understand and apply psychological principles to personal, social, and organizational issues. Weigh evidence, tolerate ambiguity, act ethically, DQGUHÁHFWRWKHUYDOXHVWKDWDUHWKHXQGHUSLQQLQJVRI psychology as a discipline. Folsom Lake College 2011-2012 Psychology 241 Recognize, understand, and respect the complexity of PSYC 330 INTRODUCTORY STATISTICS FOR THE BEHAVIORAL socio-cultural and international diversity. SCIENCES 3 UNITS Develop insight into their own and others’ behavior Prerequisite: MATH 120 and PSYC 300 with grades of “C” or better and mental processes and apply effective strategies General Education: AA/AS Area II(b); CSU Area B4; IGETC Area 2 for self-management and self-improvement. Course Transferable to UC/CSU Apply psychological knowledge, skills, and values in Hours: 54 hours LEC occupational pursuits in a variety of settings. This course focuses upon the concepts and applications of descriptive and inferential statistics in psychology and other behavioral sciences. Topics include: descriptive statistics; probability and sampling distributions; parametric and nonparametric statistical methods, hypothesis testing, statistical inference and Psychology (PSYC) SRZHU FRUUHODWLRQDQGUHJUHVVLRQ FKLVTXDUH WWHVWV DQGDQDO\VLVRIYDULDQFH PSYC 300 GENERAL PRINCIPLES 3 UNITS SURFHGXUHV$SSOLFDWLRQRIERWKKDQGFRPSXWDWLRQDQGVWDWLVWLFDOVRIWZDUHWR Prerequisite: None. data in a social science context will be emphasized to include the interpretation General Education: AA/AS Area V(b); CSU Area D9; IGETC Area 4I RIWKHUHOHYDQFHRIWKHVWDWLVWLFDOÀQGLQJV Course Transferable to UC/CSU Hours: 54 hours LEC PSYC 335 RESEARCH METHODS IN PSYCHOLOGY 3 UNITS 7KLVFRXUVHLVDQLQWURGXFWLRQWRWKHVFLHQWLÀFVWXG\RIKXPDQEHKDYLRU6WXGHQWV Prerequisite: PSYC 300 with a grade of “C” or better ZLOOEHLQWURGXFHGWRIRXQGDWLRQDOSULQFLSOHVDQGFXUUHQWWUHQGVLQWKHÀHOGRI Corequisite: PSYC 330; Course may be taken concurrently or previously. psychology. Concepts that are explored include methods of psychological inquiry, General Education: AA/AS Area II(b); CSU Area D9 the biological basis of behavior, sensation, perception, states of consciousness, Course Transferable to UC/CSU learning, memory, cognition, motivation, emotion, stress and health, personality, Hours: 54 hours LEC developmental psychology, psychological disorders, psychotherapy, and social This course introduces students to the basic principles and methods of psychology. This course is designed for psychology majors, behavioral and social conducting psychological research. The course is designed to expose students VFLHQFHPDMRUVDQGRWKHUVWXGHQWVZKRGHVLUHDEURDGRYHUYLHZRIWKHÀHOG WRWKHGLIIHUHQWH[SHULPHQWDODQGQRQH[SHULPHQWDOUHVHDUFKPHWKRGVXVHGE\ psychologists to study human behavior and thought processes. In this course PSYC 312 BIOLOGICAL PSYCHOLOGY 4 UNITS students will engage in each step of the research process including developing Prerequisite: None. a hypothesis, conducting a literature review, designing a study, collecting data, General Education: AA/AS Area IV; CSU Area B2; CSU Area B3; CSU Area D9; analyzing data, and writing up and presenting the results. IGETC Area 5B Course Transferable to UC/CSU PSYC 340 ABNORMAL BEHAVIOR 3 UNITS Hours: 54 hours LEC ; 54 hours LAB Prerequisite: None. This course will focus on how the brain produces thought and behavior. It will General Education: AA/AS Area V(b); CSU Area D9; CSU Area E1; IGETC Area 4I explore the physiological, biochemical, genetic, and evolutionary mechanisms Course Transferable to UC/CSU underlying fundamental human capacities such as sensory perception, Hours: 54 hours LEC movement, sleep, dreaming, emotion, motivation, memory and language. This course is an exploration of the broad questions of normality and Students will explore the broader ethical and societal implications of recent DEQRUPDOLW\,WLQFOXGHVDQLQYHVWLJDWLRQRIVSHFLÀFPHQWDOHPRWLRQDODQG advances in neuroscience, as well as the variety of research methods used to EHKDYLRUDOGLIÀFXOWLHVDVYLHZHGIURPWKHELRORJLFDOSV\FKRDQDO\WLFEHKDYLRUDO achieve these advances. Students will dissect brains and other nervous tissue FRJQLWLYHKXPDQLVWLFDQGVRFLRFXOWXUDOSHUVSHFWLYHV&XUUHQWDSSURDFKHVWR and record psychophysiological signals to provide a deeper understanding of psychological assessment and treatment modalities will be covered, including nervous system anatomy and physiology. This is a basic course for psychology, current community mental health practices. biological science and allied health majors. PSYC 351 HUMAN BEHAVIOR 3 UNITS PSYC 320 SOCIAL PSYCHOLOGY 3 UNITS Prerequisite: None. Prerequisite: None. General Education: AA/AS Area V(b); CSU Area D9; IGETC Area 4I General Education: AA/AS Area V(b); CSU Area D9; IGETC Area 4I Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC 7KLVFRXUVHLVDQLQWURGXFWLRQWRWKHVFLHQWLÀFVWXG\RIKXPDQEHKDYLRU7KH 7KLVFRXUVHIRFXVHVRQWKHVFLHQWLÀFVWXG\RIKXPDQLQWHUDFWLRQZLWKDQ course provides a comprehensive overview of the subject matter of psychology emphasis on the individual within a social context. Study includes: social while emphasizing the application of psychological thought and research to perception, social cognition, attitudes and attitude change, the self and social personal and social issues. (University of California does not grant credit for LGHQWLW\SUHMXGLFHLQWHUSHUVRQDODWWUDFWLRQFORVHUHODWLRQVKLSVVRFLDOLQÁXHQFH PSYC 351 if PSYC 300 is also taken). prosocial behavior, aggression, and group behavior. 242 Psychology Folsom Lake College 2011-2012 PSYC 354 THE PSYCHOLOGY OF FAMILY LIFE AND INTIMATE PSYC 368 CROSS CULTURAL PSYCHOLOGY 3 UNITS RELATIONSHIPS IN A DIVERSE SOCIETY 3 UNITS Prerequisite: None. Same As: FCS 354 Advisory: PSYC 300 Prerequisite: None. General Education: AA/AS Area V(b); AA/AS Area III(b); AA/AS Area VI; CSU Area General Education: AA/AS Area III(b); CSU Area E1 D9; IGETC Area 4I Course Transferable to CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC Overview of the elements involved in building, maintaining and surviving 7KLVFRXUVHH[SORUHVWKHLPSDFWRIFXOWXUDOLQÁXHQFHVRQWKHSV\FKRORJLFDODQG paired relationships, both traditional and newer partnerships and relationship individual development of ethnic group members. Emphasis will be placed styles. Includes choosing each other, types of commitment (love, romance, sex RQLQWHJUDWLQJWUDGLWLRQDOWKHRUHWLFDODSSURDFKHVDQGFXUUHQWFURVVFXOWXUDO DQGVHFXULW\ GHDOLQJZLWKFRQÁLFWSDUHQWLQJFULVLVDQGIDPLO\GLVRUJDQL]DWLRQ VWDWLVWLFDOUHVHDUFKDQGWKHRU\LQWKHVWXG\RI$IULFDQ$PHULFDQV$VLDQ such as starting over, and changes confronting the individual throughout life’s Americans, Hispanic Americans, Native Americans, gays & lesbians, the elderly, stages. Not open to students who have received credit for FCS 322. and the disabled. PSYC 356 HUMAN SEXUALITY 3 UNITS PSYC 370 HUMAN DEVELOPMENT: A LIFE SPAN 3 UNITS Prerequisite: None. Same As: FCS 324 General Education: AA/AS Area III(b); CSU Area E1; IGETC Area 4I Prerequisite: None. Course Transferable to UC/CSU Advisory: ENGWR 101 or 103 Hours: 54 hours LEC General Education: AA/AS Area V(b); AA/AS Area III(b); CSU Area D9; CSU Area 7KLVFRXUVHRIIHUVDEDODQFHGVFLHQWLÀFXQGHUVWDQGLQJRIWKHELRSV\FKRVRFLDO E1; IGETC Area 4I perspective on human sexual behavior from birth through adulthood. The Course Transferable to UC/CSU FRXUVHSURYLGHVIDFWXDOXSWRGDWHQRQMXGJPHQWDOLQIRUPDWLRQGHVLJQHGWR Hours: 54 hours LEC GLVSHOP\WKVIDFLOLWDWHSUREOHPLGHQWLÀFDWLRQDQGSRVVLEOHVROXWLRQV7KH This course will provide an overview of the physical, cognitive, social, and FRXUVHH[SORUHVWKHLPSDFWRIFXOWXUDOLQÁXHQFHVRQKXPDQVH[XDOEHKDYLRUV emotional development domains from conception through the end of life. of different ethnic groups. A survey of the biological, psychological and social Emphasis will be on examination of theoretical advances and empirical aspects of the diversity of human sexual behavior is compared and contrasted. ÀQGLQJVDSSOLFDEOHWRELRVRFLDOSV\FKRVRFLDODQGFRJQLWLYHKXPDQJURZWK Topics include sexual anatomy and physiology, conception and childbirth, DQGGHYHORSPHQWWKURXJKRXWWKHOLIHVSDQ6FLHQWLÀFÀQGLQJVIURPDUDQJHRI contraception, sexual development, variations and deviations, sex research, disciplines will inform an integrated examination of theory and practice with sexually transmitted diseases, sex therapy, intimacy and relationships, and ORQJWHUPLPSOLFDWLRQVLQPLQG7KLVFRXUVHLVGHVLJQHGWRIXOÀOOUHTXLUHPHQWV sexual victimization. for general education, Nursing degrees and the Psychology degree. This course is not open to students who have completed FCS 324. PSYC 358 PRINCIPLES OF INTERPERSONAL RELATIONS 3 UNITS Prerequisite: None. PSYC 372 CHILD DEVELOPMENT 3 UNITS General Education: AA/AS Area III(b); CSU Area E1 Same As: ECE 312 Course Transferable to CSU Prerequisite: None. Hours: 54 hours LEC Advisory: ENGWR 101 or 103; or ESLL 310, ESLR 320, and ESLW 320. The study of principles involved in effective interpersonal relationships. General Education: AA/AS Area V(b); AA/AS Area III(b); CSU Area D7; IGETC Area 4I ,QFOXGHVVXFKWRSLFVDVLQWHUSHUVRQDOIHHGEDFNVHOIGLVFORVXUHWKHUROHRI Course Transferable to UC/CSU emotions in relationships, the act of listening and the ability to challenge others Hours: 54 hours LEC toward growth and productivity. The focus is on concepts useful to the student This course will examine the physical, cognitive, social and emotional LQKLVKHUIDFHWRIDFHUHODWLRQVKLSVDWKRPHVFKRRORUZRUN GHYHORSPHQWRIWKHFKLOGIURPWKHSUHQDWDOSHULRGWKURXJKDGROHVFHQFH6FLHQWLÀF ÀQGLQJVDQGWKHRUHWLFDOLQVLJKWVIURPDUDQJHRIGLVFLSOLQHVZLOOLQIRUPDQ PSYC 360 PSYCHOLOGY OF WOMEN 3 UNITS integrated examination of development during the childhood years. This course Prerequisite: None. LVGHVLJQHGWRIXOÀOOJHQHUDOHGXFDWLRQ3V\FKRORJ\GHJUHHDQG(DUO\&KLOGKRRG General Education: AA/AS Area III(b); CSU Area E1; IGETC Area 4I Education requirements. This course is not open to those who have previously Course Transferable to UC/CSU taken ECE 312 or FCS 312. Hours: 54 hours LEC A course for men and women that highlights the psychological, biological and VRFLDOLQÁXHQFHVRQWKHEHKDYLRURIZRPHQ Folsom Lake College 2011-2012 Psychology 243 PSYC 495 INDEPENDENT STUDIES IN PSYCHOLOGY 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB PSYC 499 EXPERIMENTAL OFFERING IN PSYCHOLOGY .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 244 Public Management Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Public Management COUNSELING Rancho Cordova Center - 916-255-0717 'HÀQH WKH IXQFWLRQV RI SXEOLF RUJDQL]DWLRQV DQG WKH CERTIFICATE OF ACHIEVEMENT inter-agency relationships between federal, state, and Public Management local public entities. ,QYHVWLJDWH DQG GHÀQH WKH UROH RI YDULRXV SXEOLF CERTIFICATE OF ACHIEVEMENT organizations, and stakeholders in the policy Public Management development process, including the legislative process at the state and federal levels. REQUIRED PROGRAM ...... Units BUS 300 Intro to Business ...... 3 BUS 310 Business Communications ...... 3 CISA 320 Intro to Database Management ...... 3 MGMT 308 Personnel and Human Resources Management ...... 3 MGMT 310 Introduction to Public Management ...... 3 MGMT 311 Introduction to Public Financial Administration ...... 3 MGMT 315 Governmental Relations and Policy Development ...... 3 PRJMGT 300 Introduction to Project Management .....3 TOTAL UNITS REQUIRED ...... 22 This program is designed for students interested in careers in state, county, or municipal governments and community EDVHGQRQSURÀWRUJDQL]DWLRQV7KHFXUULFXOXPIRFXVHVRQ various competency areas for those wishing either to upgrade their managerial skills or enhance their existing abilities. Upon completion of this program, the student will be able to: Identify the various types of public agencies: their administrative structures, lines of authority, roles and accountability. 'HÀQHWKHYDULRXVOHYHOVUROHVDQGFRQFHSWVRISXEOLF management and develop an understanding of how government works. Demonstrate the ability to assess public government issues and evaluate ethical dilemmas in public management. Describe the political, intergovernmental and environmental impacts facing public managers. 'LVWLQJXLVKWKHYDULRXVIHGHUDOVWDWHDQGORFDOÀVFDO planning cycles and their implications for policy making and program evaluation. Research the key stakeholders of the political process and how they impact the functioning and allocation of resources at the management level. Review the development and management of government budgets, including budget formats, budget cycles, budget processes, operating budgets, analysis of revenue and expenditures, and related expenditure controls, cash management and accounting. Folsom Lake College 2011-2012 Real Estate 245 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Real Estate COUNSELING Rancho Cordova Center - 916-255-0717 DEGREE A.A. - Real Estate Accounting 301 Business Law 340 CERTIFICATE OF ACHIEVEMENT Introduction to Escrow Procedures Real Estate Broker Legal Aspects of Real Estate Real Property Management CERTIFICATE OF RECOGNITION Real Estate Appraisal Real Estate Sales Real Estate Economics Real Estate Finance Folsom Lake College offers, in addition to a Real Estate AA Real Estate Practice Degree, a variety of courses available which satisfy State of California prerequisites for Real Estate Salesperson APPLICANTS FOR THE REAL ESTATE BROKER and Real Estate Broker examinations. EXAMINATION An applicant for the Broker examination must have Career Options completed eight college-level courses, in addition to Real estate salesperson; real estate broker; real estate the experience/educational requirements. These eight appraiser; small business owner courses should include the following FLC course offerings: Some career options may require more than two years Real Estate Principles of college study. Real Estate Practice Legal Aspects of Real Estate Highlights Real Estate Finance Instruction by trained, working real estate Real Estate Appraisal professionals Real Estate Economics or Accounting 301 Preparation for State of California real and two courses from the following group: * estate license examinations %XVLQHVV/DZ Training in one of the most lucrative careers in 5HDO3URSHUW\0DQDJHPHQW today’s world ,QWURGXFWLRQWR(VFURZ3URFHGXUHV A lab with tutorial assistance $GYDQFHG$SSUDLVDO APPLICANTS FOR THE REAL ESTATE * If applicant completes both Accounting and Real Estate SALESPERSON EXAM Economics, only one additional course is required. To qualify to take an examination for a Real Estate Salesperson License, an applicant must submit evidence (transcripts) of having completed a college-level course DEGREE in Real Estate Principles. A.A. — Real Estate In addition to Real Estate Principles the applicant must REQUIRED PROGRAM ...... Units also (either when qualifying for the examination, when ACCT 301 Financial Accounting ...... 4 applying for the original license or within eighteen BUS 300 Introduction to Business ...... 3 months after license issuance) submit evidence of having BUS 310 Business Communication ...... 3 completed TWO additional basic real estate courses from BUS 330 Managing Diversity in the Workplace ..3 the following FLC course offerings (it is recommended BUS 340 Business Law ...... 3 that Real Estate Practice be one of the courses selected). BUSTEC 302 Computer Keyboarding ...... 2 CISC 310 Intro to Computer Information Science or Three (3) units to include: ...... 3 CISC 300 Computer Familiarization - (1 unit) and Two (2) additional units selected from: CISA 308, 310, 320, 330, 340, CISC 308, 320 246 Real Estate Folsom Lake College 2011-2012 Plus three (3) units selected from the following: CERTIFICATE OF ACHIEVEMENT ECON 302 Principles of Macroeconomics or Real Estate Broker ECON 320/BUS 320 Concepts of Personal Finance ...... 3 REQUIRED PROGRAM ...... Units MKT 300 Principles of Marketing ...... 3 RE 110 Legal Aspects ...... 3 RE 110 Legal Aspects of Real Estate ...... 3 RE 120 Real Estate Practice ...... 3 RE 120 Real Estate Practice ...... 3 RE 130 Real Estate Financing...... 3 RE 130 Real Estate Finance...... 3 RE 140 Real Estate Appraisal ...... 3 RE 140 Real Estate Appraisal ...... 3 RE 150 Real Estate Economics or RE 300 Principles of Real Estate ...... 3 ACCT 301 Financial Accounting ...... 3-4 TOTAL UNITS REQUIRED ...... 42 RE 300 Principles of Real Estate ...... 3 Plus three (3) units selected from the following: ...... 3 This A.A. degree may be obtained by completion of the BUS 340; RE 141, 161 Required Program, plus General Education Requirements, TOTAL UNITS REQUIRED ...... 21-22 SOXVVXIÀFLHQWHOHFWLYHVWRPHHWDXQLWWRWDO 7KLVFHUWLÀFDWHLQWURGXFHVVWXGHQWVWRDGYDQFHGFRQFHSWVRI The associate degree program in real estate focuses on the WKHUHDOHVWDWHFDUHHUÀHOG7RSLFVLQFOXGHWKHSULQFLSOHVRI practical application and concepts utilized in real estate UHDOHVWDWHODZHFRQRPLFVÀQDQFHSUDFWLFHDQGDSSUDLVDO PDUNHWVDQGFDUHHUÀHOGV&RXUVHZRUNLQFOXGHVUHDOHVWDWH property management, and real estate economics SULQFLSOHVOHJDODVSHFWVSUDFWLFHÀQDQFHHFRQRPLFVDQG appraisal Upon completion of this program, the student will be able to: Apply advanced knowledge of the fundamental concepts Upon completion of this program, the student will be able to: RIUHDOHVWDWH²LQFOXGLQJÀQDQFHLQYHVWPHQWDSSUDLVDO Identify and explain the major functional areas of real property management, sales and construction–necessary HVWDWHLQFOXGLQJOHJDODVSHFWVÀQDQFHHFRQRPLFVUHDO WRPDQDJHDUHDOHVWDWHVDOHVRIÀFH estate practice and appraisal. Describe the relevant technical terminology, laws and Demonstrate leadership skills and abilities that are regulations, and industry standards required in the real effective in a real estate environment. HVWDWHÀHOG Analyze practical real estate problems. Interpret and apply knowledge of the basic principles ,QWHJUDWHUHDOHVWDWHSULQFLSOHVUHODWHGWRÀQDQFHODZ QHFHVVDU\LQRSHQLQJDQGVWDIÀQJDUHVLGHQWLDOUHDO products, services and information. HVWDWH EURNHU·V RIÀFH LQFOXGLQJ RIÀFH PDQDJHPHQW Assess current real estate market conditions. tools and techniques. Recommend appropriate sales strategies, based on Qualify for the California Real Estate Broker’s License market conditions. Examination. Qualify for the California Real Estate Brokers and Apply advanced problem solving and leadership Salesperson license examinations. techniques needed to manage real estate transactions. Utilize research and critical thinking to evaluate and recommend alternative solutions to real estate problems. CERTIFICATE OF RECOGNITION Real Estate Sales REQUIRED PROGRAM ...... Units RE 120 Real Estate Practice ...... 3 RE 300 Principles of Real Estate ...... 3 Plus three (3) units selected from: ...... 3 RE 110, 130, 140 TOTAL UNITS REQUIRED ...... 9 7KLV FHUWLÀFDWH LQWURGXFHV WKH EDVLF FRQFHSWV RI WKH UHDO HVWDWH FDUHHU ÀHOG 7RSLFV LQFOXGH WKH SULQFLSOHV RI UHDO HVWDWHODZHFRQRPLFVÀQDQFHSUDFWLFHDQGDSSUDLVDO Folsom Lake College 2011-2012 Real Estate 247 Upon completion of this program, the student will be able to: RE 130 REAL ESTATE FINANCE 3 UNITS Apply a basic knowledge of the fundamental concepts Prerequisite: None of real estate. Hours: 54 hours LEC 'HÀQHWKHWHFKQLFDOWHUPLQRORJ\LQYROYHGLQWKHUHDO 7KLVFRXUVHLVDQDQDO\VLVRIUHDOHVWDWHÀQDQFLQJLQFOXGLQJOHQGLQJSROLFLHVDQG HVWDWHÀHOG SUREOHPVLQÀQDQFLQJWUDQVDFWLRQVLQUHVLGHQWLDODSDUWPHQWFRPPHUFLDODQG Interpret and apply a knowledge of real estate VSHFLDOSXUSRVHSURSHUWLHV0HWKRGVRIÀQDQFLQJSURSHUWLHVDUHHPSKDVL]HG transactions. Successful completion of the course applies toward the educational requirements Qualify for the California Real Estate Salesperson’s for the Broker’s Examination. License Examination. Analyze real estate situations and property, interpret RE 140 REAL ESTATE APPRAISAL 3 UNITS the data, and properly complete deposit receipts. Prerequisite: None. Hours: 54 hours LEC This course covers the purposes of appraisals; the appraisal process; and the different approaches, methods and techniques used to determine the value of Real Estate (RE) various types of property. The course emphasizes residential single family RE 110 LEGAL ASPECTS OF REAL ESTATE 3 UNITS properties and applies toward the educational requirement for the Real Estate Prerequisite: None. Broker’s License, and Licensed and General Appraiser’s License. Hours: 54 hours LEC RE 141 ADVANCED APPRAISAL 3 UNITS This course is a study of California real estate law. Topics include: the Prerequisite: RE 140. Grade of “C” or better required to meet prerequisite. sources of law and the judicial system; agency; duties and responsibilities of Hours: 54 hours LEC licensees; contracts and their application to real estate; property ownership This course discusses advanced appraisal concepts with an emphasis on market and management; real estate security devices; property rights, liens and and income analysis, capitalization techniques, rate derivation, compound KRPHVWHDGV ODQGORUGWHQDQWODZODQGXVHFRQWUROVDQGWLWOHLQVXUDQFHDQG interest tables, cost and sales comparison approaches; and the appraisal of escrow. Completion of the course applies toward the California Department of VSHFLÀFLQFRPHSURSHUWLHVVXFKDVDSDUWPHQWVRIÀFHEXLOGLQJVVKRSSLQJFHQWHUV Real Estate education requirements for the broker’s examination. and industrial properties. RE 120 REAL ESTATE PRACTICE 3 UNITS RE 150 REAL ESTATE ECONOMICS 3 UNITS Prerequisite: None. Prerequisite: None Hours: 54 hours LEC Hours: 54 hours LEC This course covers practices and techniques of residential real estate brokerage 7KLVFRXUVHFRYHUVQDWXUHDQGFODVVLÀFDWLRQRIUHDOHVWDWHDQGUHDOHVWDWH and sales, including ethics, fair housing agency, goal setting, prospecting, investments, economic development of real property, real estate cycles and OLVWLQJDGYHUWLVLQJHVFURZSURFHGXUHVÀQDQFLQJWD[DWLRQPDUNHWLQJSURSHUW\ PDUNHWWUHQGV*RYHUQPHQWDODQGSULYDWHVHFWRULQÁXHQFHRQWKHHFRQRPLFV management, leasing and business opportunities. This course applies toward of real estate is covered. It is recommended that this course be taken last in California Department of Real Estate education requirements for the broker’s the real estate course series. examination. RE 161 ADVANCED ESCROW PROCEDURES 3 UNITS RE 121 HOME STAGING 2 UNITS Prerequisite: RE 160. Grade of “C” or better required to meet prerequisite. Prerequisite: None. Hours: 54 hours LEC Hours: 36 hours LEC 7KLVFRXUVHFRYHUVXQXVXDODQGGLIÀFXOWW\SHVRIHVFURZLQFOXGLQJWKHHYDOXDWLRQ This course is an introduction to the best practices for preparing the interior and RISRVVLEOHVROXWLRQVZLWKHPSKDVLVRQUHDOHVWDWHORDQVÀQDQFLQJLQVWUXPHQWV exterior of a home for sale. This course is an elaboration of some techniques and exchanges. introduced in RE 120, Real Estate Practice, but with an eye to the design issues apparent in successfully marketing a home for sale. Subject matter includes RE 295 INDEPENDENT STUDIES IN REAL ESTATE 1-3 UNITS creating curb appeal, decluttering and depersonalizing interior spaces, Prerequisite: None DSSHDOLQJWRDEX\HUV·ÀYHVHQVHVDQGFUHDWLQJDSRVLWLYHHPRWLRQDOUHDFWLRQ Hours: 18 hours LEC ; 54 hours LAB in a potential buyer. Successful students will be able to employ these techniques within their profession as a real estate agent, as professional home stagers, RE 299 EXPERIMENTAL OFFERING IN REAL ESTATE .5-4 UNITS or as principals selling their own homes. Prerequisite: None Hours: 18 hours LEC ; 54 hours LAB 248 Real Estate Folsom Lake College 2011-2012 RE 300 CALIFORNIA REAL ESTATE PRINCIPLES 3 UNITS Prerequisite: None. Course Transferable to CSU Hours: 54 hours LEC This fundamental real estate course covers the basic laws and principles of California real estate, introducing students to the background and terminology necessary for advanced study in specialized real estate courses. Topics include UHDOHVWDWHUHJXODWLRQWLWOHSRVVHVVLRQHQFXPEUDQFHVDQGÀQDQFLQJ7KLVFRXUVH is required by the California Department of Real Estate prior to taking the real estate salesperson’s examination. RE 495 INDEPENDENT STUDIES IN REAL ESTATE 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB RE 499 EXPERIMENTAL OFFERING IN REAL ESTATE .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Science 249 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Science COUNSELING Rancho Cordova Center - 916-255-0717 Areas of Study: PRE-PROFESSIONAL HEALTH SCIENCE EDUCATION Biology Chemistry Students planning to attend a dental, medical, veterinary or Environmental Technology optometry school are not required to complete a prescribed Geography undergraduate major. Many students have the misconcep- Geology tion that “predental,” “pre-med,” etc., are academic majors. Physics, Physical Science, Astronomy They are not. A student’s undergraduate degree might be achieved in anything, as long as appropriate courses required Folsom Lake College students may choose courses in for dental/medical/veterinary/optometry school admission the various disciplines of science to meet any of several are completed. Professional schools are looking for well- objectives. Courses are designed to: rounded students who have taken courses in the humanities Prepare students for transfer and continuation of and social sciences and who have participated in school studies at other colleges or universities (chemistry, activities and community work. Generally, admission criteria biology, medicine, etc.) include: completion of required courses; cumulative GPA; Meet general education requirements for non- science courses GPA only; extracurricular activities, including science majors work experience related to the health science specialization; Prepare students for immediate entry into a test scores; application, which includes a personal statement; science-based technology career letters of recommendation; and an interview. Provide for career advancement and continuing education In addition to a good GPA, a student must be self-motivated, have social concern, communication skills and maturity. An Many courses include hands-on practical experience and/ applicant, however, does not need a 4.0 GPA for admission, or opportunities for work experience in local industry DVD*3$LVDQLPSHUVRQDOUHÁHFWLRQRIDVWXGHQW·VDELOLW\ and business. to handle university work. The student, in consultation with a counselor, should choose Students planning to enroll in a professional health science science courses to meet his/her program, transfer, or school may complete at Folsom Lake College: general education requirements. The Counseling Center 1. transfer general education courses, also has information regarding science requirements for 2. transfer courses for the student’s chosen major, transfer to other 4-year institutions. 3. a basic core of courses which is required for all health science students, and 4. other courses required for the chosen speciality, i.e., dental, medical, optometry, and/or veterinary. The basic core courses are: BIOL 400, 420 CHEM 400, 401 ENGWR 300, 301, 302 PHYS 350, 360 MATH 335, 350 (or high school equivalent) 250 Science Folsom Lake College 2011-2012 Pre-Dental Pre-Physical Therapy Although a student may be admitted to a dental school Students may take general education and a basic core of upon completion of 90 units, a baccalaureate degree is prerequisite courses at Folsom Lake College and transfer to recommended. A student should have at least a 3.0 GPA. California State University, Fresno, Long Beach or Northridge. The Dental Aptitude Test (DAT) is a requirement. Admission into a physical therapy program is very competitive with great weight given to relevant work experience and In addition to the basic core courses, the required PSYC 300 grade point average earned in the prerequisite courses. (1) and 320 (3) and a minimum of 12 units of social sciences, Because admission requirements vary among the programs, humanities, and foreign languages may be completed at students are advised to work closely with a counselor to plan Folsom Lake College. for the completion of work experience, general education and a core of basic program courses. Many Physical Therapy Pre-Medical programs will be offered at the Master’s Degree level only. Although a student may be admitted to a medical school Check with the counseling department. upon completion of 90 units, a baccalaureate degree is recommended. The usual stated minimum GPA is 2.5. In reality, The core courses may include: a student with a GPA below 3.0 is almost never accepted, BIOL 400, 420, 430, 431 and it is rare to be admitted with a GPA below 3.4. The CHEM 400, 401 or CHEM 305, 306 Medical College Admission Test (MCAT) is a requirement. PHYS 350, 360 PSYC 300 In addition to the basic core courses, the required MATH 350 and 351 and a full year of organic chemistry (CHEM 420 Pre-Nursing Option, see BIOLOGY and 421) may be completed at Folsom Lake College. Pre-Optometry Although a student may be admitted to an optometry school upon completion of 90 units, a baccalaureate degree is recommended. The usual stated minimum GPA is 2.0; however, a more realistic minimum is a 3.0 GPA. The Optometry College Admission Test (OCAT) is a requirement. In addition to the basic core courses, other courses such as BIOL 440, 430, 431; MATH 350, 351; PSYC 300; STAT 300; humanities courses and social science classes may be required. Please check with your counselor. These courses can be completed at Folsom Lake College. Pre-Veterinary ,WLVH[WUHPHO\GLIÀFXOWWRJDLQDGPLVVLRQWRDYHWHULQDU\ school without being a resident of the state in which the school is located. A California resident, therefore, is virtually restricted to attending the University of California School of Veterinary Medicine at Davis. Although a student may be admitted to the School of Veterinary Medicine upon completion of 90 units, a baccalaureate degree is recommended. A student with a 2.5 GPA may be considered for admission; however, rarely is a student admitted with a GPA below 3.0. Experience with animals is given heavy consideration. The Graduate Record Examination General Aptitude Section and Advanced Test in Biology are requirements. In addition to the basic core courses, the required STAT 300 may be completed at Folsom Lake College. Folsom Lake College 2011-2012 Sign Language Studies 251 Sign Language Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Studies COUNSELING Rancho Cordova Center - 916-255-0717 SILA 306 AMERICAN SIGN LANGUAGE 2 4 UNITS Folsom Lake College offers courses in Sign Language Prerequisite: SILA 305 with a grade of “C” or better Studies designed to introduce students to American General Education: AA/AS Area I; IGETC Area 6 Sign Language. Students learn basic conversational Course Transferable to UC/CSU skills to communicate with members of the deaf Hours: 72 hours LEC community. Moreover, students learn about deaf culture This is the second in a series of four courses in American Sign Language. The such as cultural behaviors and values. SILA courses HPSKDVLVLVRQQRQYHUEDOFRPPXQLFDWLRQ7RSLFVSUHVHQWHGLQFOXGHJUDPPDWLFDO are transferable to UC and CSU. Students who are features such as descriptors, differentiation between cardinal/ordinal numbers, LQWHUHVWHGLQSXUVXLQJWKHLQWHUSUHWLQJÀHOGZRXOGEH contrastive structure, temporal aspect markers and temporal sequencing. able to transfer to American River College’s Interpreting Training Program. SILA 315 AMERICAN SIGN LANGUAGE 3 4 UNITS Prerequisite: SILA 306 with a grade of “C” or better Career Options General Education: AA/AS Area I; CSU Area C2; IGETC Area 6 ADA Specialist; Audiologist; Childcare Worker; Group Course Transferable to UC/CSU Home Worker; Human Services Worker; Independent Hours: 72 hours LEC Skills Instructor; Interpreter; Linguist; Mental Counselor; This course is the third in a series of four courses in American Sign Language. Rehabilitation Counselor; Teacher; Teacher Aide; ,WHPSKDVL]HVH[SUHVVLYHDQGUHFHSWLYHQRQYHUEDOFRPPXQLFDWLRQVNLOOV Telecommunications Operators between signers who have preliminary American Sign Language syntactical and lexical skills. It provides an understanding of deaf cultural processes by Some career options may require more than two years identifying behaviors and several norms from activities assigned in the class. of college study. It also includes dialogues that involve asking, empathizing, negotiation and agreeing or disagreeing. Highlights Dedicated, well-trained instructors SILA 316 AMERICAN SIGN LANGUAGE 4 4 UNITS Highly interactive learning environment Prerequisite: SILA 315 with a grade of “C” or better Close relationship with the deaf community General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B; IGETC Area 6 Practical tools provided for communication Course Transferable to UC/CSU opportunities Hours: 72 hours LEC This course is the fourth in a series of four courses in American Sign /DQJXDJH7KHHPSKDVLVLVRQQRQYHUEDOFRPPXQLFDWLRQDWDGYDQFHGOHYHOV Sign Language Studies (SILA) of competency. Topics presented included advance grammatical features, such DVGHVFULSWRUVFODVVLÀHUXVHYDULRXVQXPEHULQJV\VWHPVLQ$PHULFDQ6LJQ SILA 305 AMERICAN SIGN LANGUAGE 1 4 UNITS Language, cultural features of the language and the diverse aspects of the Prerequisite: None. American Deaf Community. General Education: AA/AS Area I; IGETC Area 6 Course Transferable to UC/CSU SILA 345 FINGERSPELLING 1 UNIT Hours: 72 hours LEC Prerequisite: None 7KLVLVWKHEHJLQQLQJFRXUVHLQDVHULHVRIIRXUFRXUVHVLQYLVXDOJHVWXUDO Corequisite: SILA 305. Grade of “C” or better required to meet corequisite. processing of sign language. It provides instructional activities for people who Course Transferable to CSU wish to become competent in communication with deaf people. This emphasis Hours: 18 hours LEC ; 9 hours LAB LVRQQRQYHUEDOFRPPXQLFDWLRQ A basic course in use of the manual alphabet designed to augment expressive DQGUHFHSWLYHÀQJHUVSHOOLQJVNLOOVLQWURGXFHGLQ$PHULFDQ6LJQ/DQJXDJH $6/ courses. Perceptual strategies of use to hearing adults stressed. Emphasis on UHFRJQLWLRQRIÀQJHUVSHOOLQJLQFRQWH[W%DVLFNQRZOHGJHRI$PHULFDQ6LJQ Language required. 252 Sign Language Studies Folsom Lake College 2011-2012 SILA 495 INDEPENDENT STUDIES IN SIGN LANGUAGE STUDIES 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB SILA 499 EXPERIMENTAL OFFERING IN SIGN LANGUAGE STUDIES .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Sociology 253 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Sociology COUNSELING Rancho Cordova Center - 916-255-0717 SOC 321 RACE, ETHNICITY AND INEQUALITY IN THE UNITED Sociology courses are concerned with the study of systems STATES 3 UNITS and how individuals live, work and interact within them. Prerequisite: None. Career options: Sociologist; Social Worker; Instructor; General Education: AA/AS Area V(b); AA/AS Area VI; CSU Area D3; IGETC Area 4J 3UREDWLRQ2IÀFHU (PSOR\PHQW&RXQVHORU 8UEDQ3ODQQHU Course Transferable to UC/CSU (some career choices may require courses beyond the Hours: 54 hours LEC Associate Degree). This course uses the sociological perspective to examine the relationship between race, ethnicity, and inequality in the U.S. and covers topics including: Highlights prejudice, discrimination, ethnocentrism, individual and institutional racism, Practical courses valuable to all students and well- privilege, assimilation, civil rights, and other related issues. This course includes trained and interesting instructional staff. an analysis of the social and historical experiences of major minority groups in the U.S. and how these experiences impact current socioeconomic conditions. SOC 335 SOCIOLOGY OF AGING 3 UNITS Sociology (SOC) Same As: GERON 300 SOC 300 INTRODUCTORY SOCIOLOGY 3 UNITS Prerequisite: None. Prerequisite: None. General Education: CSU Area D0; CSU Area E1 General Education: AA/AS Area V(b); CSU Area D0; IGETC Area 4J Course Transferable to CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This introductory course examines the aged and the aging process, with This course introduces the social and cultural bases that impact human behavior, emphasis on social factors affecting and affected by an aging population. It social interaction, and life opportunities. This course will cover sociological includes an analysis of demography and history of aging in America; individual FRQFHSWVWKHRUHWLFDODSSURDFKHVDQGPDMRUÀHOGVRIVRFLRORJLFDOLQTXLU\ aging and adaption; needs, resources, and social support systems; employment including culture, socialization, social structures and institutions, inequalities and retirement; and social class/cultural differences. Not open to students who DQGVWUDWLÀFDWLRQGHYLDQFHDQGVRFLDOFKDQJH have received credit for GERON 300. SOC 301 SOCIAL PROBLEMS 3 UNITS SOC 495 INDEPENDENT STUDIES IN SOCIOLOGY 1-3 UNITS Prerequisite: None. Prerequisite: None General Education: AA/AS Area V(b); CSU Area D0; IGETC Area 4J Course Transferable to CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC SOC 499 EXPERIMENTAL OFFERING IN SOCIOLOGY .5-4 UNITS This course investigates current social problems in the United States. It examines Prerequisite: None these problems through sociological and ideological perspectives and evaluates Course Transferable to CSU KRZWKHVHSHUVSHFWLYHVLQÁXHQFHERWKGHÀQLWLRQVRISUREOHPVDVZHOODV Hours: 18 hours LEC ; 54 hours LAB proposed solutions. Topics include: racism, economic inequality, sexism and heterosexism, as well as problems arising in the areas of education, marriage and family, crime, health and healthcare, and the environment. Particular attention is paid to the impact of media on perceptions of social problems. SOC 310 MARRIAGE AND THE FAMILY 3 UNITS Prerequisite: None. Advisory: Eligibility for ENGWR 101 General Education: AA/AS Area III(b); CSU Area E1 Course Transferable to CSU Hours: 54 hours LEC This course will examine the social, psychological, historical and economic IDFWRUVUHODWLQJWRWKHFKDQJLQJIDPLO\PDUULDJHUHPDUULDJHDQGVLJQLÀFDQW relationships. Exploration of the changing gender roles, the meaning of love and sexuality, dating, communication skills and parenting will also be included. 254 Spanish Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Spanish COUNSELING Rancho Cordova Center - 916-255-0717 SPAN 102 CONVERSATIONAL SPANISH, ELEMENTARY 3 UNITS Folsom Lake College offers the basic grammar and Prerequisite: SPAN 101. Grade of “C” or better required to meet prerequisite. conversation courses in Spanish. Students will be able to Hours: 36 hours LEC ; 54 hours LAB understand the spoken language, to speak with reasonable This is second semester Elementary Spanish. It is designed for students who have ÁXHQF\DQGWRZULWHDWWKHLUVSHDNLQJOHYHO FRPSOHWHG63$1RUWZR\HDUVRIKLJKVFKRRO6SDQLVK,WSURYLGHVUHÀQHPHQW of skills begun in 101. Students will gain increased accuracy and ability to Career Options understand and produce appropriate responses in high frequency situations Airlines/Travel; Banking; Bilingual Education/Teacher’s utilizing learned materials. Speaking and writing will be comprehensible to a Aide; Bilingual Telecommunications; Emergency Services; sympathetic listener. Verbal and written expression will be limited to short, Foreign Service; Foreign Language Teacher; Import culturally appropriate communication on a broader scale than at the 101 & Export; Intelligence/Military Service; International level. Students will acquire a knowledge of the geography, culture and people Business; IRS/State Franchise Tax Board; Overseas RIUHJLRQVZKHUH6SDQLVKLVVSRNHQDQGRI6SDQLVKVSHDNHUV·FRQWULEXWLRQWR Employment: Business & Commerce; Law Enforcement/ North American and world cultures. This class consists of two hours lecture and &RUUHFWLRQDO 2IÀFHU 6RFLDO 6HFXULW\ 2IÀFHU 6RFLDO one hour of laboratory work conducted in the classroom each week and two Service; Translating & Interpreting; Tourism hours of laboratory work conducted in the Language Laboratory each week. Some career options may require more than two years of SPAN 311 CONVERSATIONAL SPANISH, INTERMEDIATE 2 UNITS college study. Prerequisite: SPAN 102. Grade of “C” or better required to meet prerequisite. Course Transferable to CSU Highlights Hours: 18 hours LEC ; 54 hours LAB Multimedia, interactive language lab with Internet 7KLVFRXUVHSURYLGHVUHÀQHPHQWRIVNLOOVDWWDLQHGLQ6WXGHQWVZLOOZRUN capabilities toward the ability to create with the language without relying on learned Internationally trained faculty and staff responses, to understand main ideas in routine speech and to understand main ideas in written texts. Listening and reading comprehension continue to develop; Native speakers who have high school-equivalent reading speaking and writing will be comprehensible to a somewhat sympathetic and writing skills in their native language should enroll in the native speaker. Students will develop the ability to respond in an unrehearsed 411 (2A) level course (or above) of their native language. manner on concrete topics in known situations. Written expression will meet limited personal needs in culturally appropriate language at a higher level of accuracy than found in 102. Students will continue acquisition of knowledge of geography, culture and people of regions where Spanish is spoken and Spanish (SPAN) RI6SDQLVKVSHDNHUV·FRQWULEXWLRQVWR1RUWK$PHULFDQDQGZRUOGFXOWXUHV SPAN 101 CONVERSATIONAL SPANISH, ELEMENTARY 3 UNITS This course will consist of one hour of lecture and two hours of laboratory Prerequisite: None. work conducted in the classroom each week and one hour of laboratory work General Education: AA/AS Area I conducted in the Language Laboratory each week. Hours: 36 hours LEC ; 54 hours LAB 7KLVLVDÀUVWVHPHVWHULQWURGXFWLRQWRWKH6SDQLVKODQJXDJH,WLVGHVLJQHGIRU beginning students with little or no previous exposure to the language. It is characterized by an emerging ability to understand and produce appropriate UHVSRQVHVLQKLJKIUHTXHQF\VLWXDWLRQVXWLOL]LQJOHDUQHGPDWHULDOV6SHDNLQJ and writing will be comprehensible to a sympathetic listener. Verbal and written expression is limited to short, culturally appropriate communication. Students will acquire a knowledge of the geography, culture and people of UHJLRQVZKHUH6SDQLVKLVVSRNHQDQGRI6SDQLVKVSHDNHUV·FRQWULEXWLRQVWR North American and world cultures. This class consists of two hours lecture and one hour of laboratory work conducted in the classroom each week and two hours of laboratory work conducted in the Language Laboratory each week. Folsom Lake College 2011-2012 Spanish 255 SPAN 312 CONVERSATIONAL SPANISH, INTERMEDIATE 2 UNITS SPAN 411 INTERMEDIATE SPANISH 4 UNITS Prerequisite: SPAN 311 or 411. Grade of “C” or better required to meet Prerequisite: SPAN 402 with a grade of “C” or better prerequisite. General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B; IGETC Area 6 Course Transferable to CSU Course Transferable to UC/CSU Hours: 18 hours LEC ; 54 hours LAB Hours: 54 hours LEC ; 54 hours LAB This is second semester Intermediate Spanish. It is designed for students 7KLVLVÀUVWVHPHVWHU,QWHUPHGLDWH6SDQLVK,WLVGHVLJQHGIRUVWXGHQWVZKR who have completed Spanish 311 or four years of high school Spanish. It have completed SPAN 402 or three years of high school Spanish. It provides provides continued development of skills attained in 311. The focus will be UHÀQHPHQWRIVNLOOVDWWDLQHGLQ63$16WXGHQWVZLOOZRUNWRZDUGWKHDELOLW\ the development of written narrative and expository prose combined with to create with the language without relying on learned responses, to understand increased cultural awareness. Emphasis will be placed on culturally authentic main ideas in routine speech and to understand main ideas in written texts. reading and writing through the introduction of basic literary analysis. Students Listening and reading comprehension continue to develop; speaking and writing will develop the ability to handle complicated situations using past and future will be comprehensible to a somewhat sympathetic native speaker. Students time frames. Students will continue acquisition of knowledge of geography, will develop the ability to respond in an unrehearsed manner on concrete topics FXOWXUHDQGSHRSOHRIUHJLRQVZKHUH6SDQLVKLVVSRNHQDQGRI6SDQLVK in known situations. Written expression will meet limited personal needs and speakers’ contributions to North American and world cultures. This course will culturally appropriate language at a higher level of accuracy than found in consist of one hour of lecture and two hours of laboratory work conducted in SPAN 402. The student will continue acquisition of knowledge of geography, the classroom each week and one hour of laboratory work conducted in the FXOWXUHDQGSHRSOHRIUHJLRQVZKHUH6SDQLVKLVVSRNHQDQGRI6SDQLVKVSHDNHUV· Language Laboratory each week. contributions to North American and world cultures. SPAN 401 ELEMENTARY SPANISH 4 UNITS SPAN 412 INTERMEDIATE SPANISH 4 UNITS Prerequisite: None. Prerequisite: SPAN 411 with a grade of “C” or better; or placement through General Education: AA/AS Area I; CSU Area C2; IGETC Area 6 the assessment process. Course Transferable to UC/CSU General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B; IGETC Area 6 Hours: 54 hours LEC ; 54 hours LAB Course Transferable to UC/CSU 7KLVLVWKHÀUVWVHPHVWHULQWURGXFWLRQWRWKH6SDQLVKODQJXDJH,WLVGHVLJQHG Hours: 54 hours LEC ; 54 hours LAB for beginning students with little or no previous exposure to the language. It This course will provide continued development of the Intermediate low is characterized by an emerging ability to understand and produce appropriate and Intermediate Mid Level listening/speaking skills attained in 411 while UHVSRQVHVLQKLJKIUHTXHQF\VLWXDWLRQVXWLOL]LQJOHDUQHGPDWHULDOV6SHDNLQJ helping the student work toward the Intermediate High level. The course will and writing will be comprehensible to a sympathetic listener. Verbal and written focus on development of written narratives and expository prose along with expression is limited to short, culturally appropriate communication. Students LQFUHDVHGDZDUHQHVVRIFXOWXUDOFRQFHUQVQRUPVYDOXHVDQGFXOWXUHVSHFLÀF will acquire knowledge of the geography, culture and people of regions where customs and events, with emphasis placed on culturally authentic reading and 6SDQLVKLVVSRNHQDQGRI6SDQLVKVSHDNHUVFRQWULEXWLRQVWR1RUWK$PHULFDQ writing through th introduction and application of basic literary analysis. The and world cultures. course will help develop the student’s emerging ability to handle complicated situations, to discuss topics beyond immediate personal needs (e.g., current SPAN 402 ELEMENTARY SPANISH 4 UNITS events, media, politics, values, history, traditions, social issues and customs), Prerequisite: SPAN 401 with a grade of “C” or better; or two years of high and to use forms indicating past and future time frames. The student will also school Spanish. acquire knowledge and an appreciation of the geography, culture and people General Education: AA/AS Area I; CSU Area C2; IGETC Area 6 of regions where Spanish is spoken and of Spanish Speakers’ contributions to Course Transferable to UC/CSU 1RUWK$PHULFDQDQGZRUOGZLGHFXOWXUH Hours: 54 hours LEC ; 54 hours LAB This is the second semester of elementary Spanish. It is designed for students SPAN 425 ADVANCED READING AND CONVERSATION 3 UNITS who have completed SPAN 401 or two years of high school Spanish. It provides Prerequisite: None. refinement of skills acquired in SPAN 401. Utilizing learned materials, General Education: AA/AS Area I; CSU Area C2; IGETC Area 3B students will gain increased accuracy and ability to understand and produce Course Transferable to UC/CSU DSSURSULDWHUHVSRQVHVLQKLJKIUHTXHQF\VLWXDWLRQV6SHDNLQJDQGZULWLQJZLOO Hours: 54 hours LEC be comprehensible to a sympathetic listener. Verbal and written expression Advanced reading and conversation in Spanish with emphasis on building will be limited to short, culturally appropriate communication on a wider vocabulary and review of grammar. Introduction to literature of the Hispanic range of topics than at the SPAN 401 level. Students will acquire knowledge of world. May be taken two times for credit. the geography, culture and people of regions where Spanish is spoken and of contributions to North American and other world cultures. 256 Spanish Folsom Lake College 2011-2012 SPAN 434 SPANISH FOR THE PROFESSIONS - INTERMEDIATE 3 UNITS Prerequisite: SPAN 102 or 402. Grade of “C” or better required to meet prerequisite. Course Transferable to CSU Hours: 54 hours LEC This is an intermediate course designed for persons in law enforcement, business DQGÀQDQFHVRFLDOVHUYLFHVDQGWKHPHGLFDOSURIHVVLRQV7KHHPSKDVLVRIWKH course is on acquiring verbal facility in interviewing, collecting data, giving instructions and general courtesies. The course will help students acquire ODQJXDJHSURÀFLHQF\ZKLOHUHYLHZLQJDQGEURDGHQLQJWKHJUDPPDUIRXQGDWLRQ DWWDLQHGLQHOHPHQWDU\6SDQLVK,WZLOOLQWURGXFHVSHFLÀFYRFDEXODU\QHFHVVDU\ for professionals to communicate successfully in a professional situation. Cultural and behavioral attitudes appropriate for relating to persons of Hispanic heritage will be suggested. This course may be taken twice for credit. SPAN 495 INDEPENDENT STUDIES IN SPANISH 1-3 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB SPAN 499 EXPERIMENTAL OFFERING IN SPANISH .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB Folsom Lake College 2011-2012 Student Government 257 Student Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Government COUNSELING Rancho Cordova Center - 916-255-0717 These courses are designed for those students interested Student Government (SGVT) in developing their leadership skills and participating in planning and organizing campus activities. They are SGVT 300 INTRODUCTION TO STUDENT GOVERNMENT 2 UNITS open to all students. Student Government is recognized Prerequisite: None as the voice of the students, and students enrolling in this Course Transferable to CSU class are voting members of the Student Senate. They Hours: 18 hours LEC ; 54 hours LAB will also have the opportunity to serve on a variety of This class provides a study of the legal, educational and philosophical basis of college committees and attend statewide leadership student government. May include travel to other campuses, area conferences conferences. and state conferences. Will include the opportunity to participate on faculty and administrative committees. Designed to teach leadership skills and to give Highlights SUDFWLFDOH[SHULHQFHLQWKHÀHOGRIVWXGHQWJRYHUQPHQW0D\EHWDNHQWKUHH Develop leadership skills by working with student times for credit. activities, clubs and Student Government Participate on college committees to help develop SGVT 495 INDEPENDENT STUDIES IN STUDENT GOVERNMENT and determine policy as it relates to student issues 1-3 UNITS Attend leadership conferences and workshops Prerequisite: None Represent the student voice to the campus and Course Transferable to CSU community Hours: 18 hours LEC ; 36 hours LAB SGVT 499 EXPERIMENTAL OFFERING IN STUDENT GOVERNMENT .5-4 UNITS Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 258 Theatre Arts Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Theatre Arts COUNSELING Rancho Cordova Center - 916-255-0717 TA 303 HISTORY AND THEORY OF THE THEATRE II 3 UNITS The Theatre Arts courses are designed to provide students Prerequisite: None. with a basic understanding of activities involved in theatre Advisory: ENGWR 300 and TA 300; or placement through the assessment presentations and production. The basic program also process. provides an opportunity for students to apply skills General Education: CSU Area C1; IGETC Area 3A associated with the course offerings. Course Transferable to UC/CSU Hours: 54 hours LEC Career Options This course is a study of the principal types of twentieth century theatre. The Acting; Theatre Arts Management; Publicity and Public KLVWRULFDODQGFXOWXUDOHQYLURQPHQWLQZKLFKVLJQLÀFDQWWUHQGVDQGWKHSOD\VWKDW 5HODWLRQV 7HDFKLQJ %R[2IÀFH0DQDJHPHQW exemplify them were written will be examined. Plays will be read focusing on their relevance in history and their lasting impact upon contemporary audiences. Some career choices may require an Associate Degree or course work beyond. TA 304 WOMEN IN THEATRE 3 UNITS Prerequisite: None. Highlights Advisory: ENGWR 300 and TA 300; or placement through the assessment Dedicated faculty with a passion for the theatre process. with professional experience in directing and General Education: AA/AS Area I (effective Fall 2009); CSU Area C1; IGETC Area 3A playwriting as well as considerable teaching Course Transferable to UC/CSU experience at the undergraduate level. Hours: 54 hours LEC Opportunity for some students to gain access to This course is an exploration of women’s contributions to the performing arts four-year college and university theatre programs as actors, playwrights, directors, designers, and theorists. Studies will include as well as internships in major regional theatres. understanding creative interpretations by women artists and will be approached from a western cultural perspective. TA 310 INTRODUCTION TO FILM 3 UNITS Theatre Arts (TA) Prerequisite: None. TA 300 INTRODUCTION TO THE THEATRE 3 UNITS Advisory: ENGWR 300 Prerequisite: None. General Education: AA/AS Area I; CSU Area C1 General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 54 hours LEC Hours: 54 hours LEC This course explores the artistic, business, and social elements of modern This art survey course focuses on the relationship of theatre to various cultures cinema. It examines components of movie making, such as acting, directing, WKURXJKRXWKLVWRU\DQGRQWKHFRQWULEXWLRQVRIVLJQLÀFDQWLQGLYLGXDODUWLVWV cinematography, writing and editing. Film making techniques are analyzed, This course introduces students to elements of the production process including along with the impact of motion pictures and the movie business. playwriting, acting, directing, design, and criticism. Students will also survey different periods, styles, and genres of theatre through play reading, discussion, TA 320 CINEMA GENRES 3 UNITS ÀOPVDQGYLHZLQJDQGFULWLTXLQJOLYHWKHDWUHLQFOXGLQJUHTXLUHGDWWHQGDQFHRI Same As: FMS 320 theatre productions. Prerequisite: None. Advisory: ENGWR 300 TA 302 HISTORY AND THEORY OF THE THEATRE I 3 UNITS General Education: AA/AS Area I Prerequisite: None. Course Transferable to UC/CSU Advisory: ENGWR 300 and TA 300; or placement through the assessment Hours: 54 hours LEC process. This course is designed to explore in depth one or more motion picture genres. General Education: AA/AS Area I; CSU Area C1; IGETC Area 3A Special attention is paid to development, aesthetics, popularity and artists of Course Transferable to UC/CSU WKHVSHFLÀFIRUP7KLVFRXUVHPD\EHWDNHQIRXUWLPHVIRUFUHGLWLIWKHVXEMHFW Hours: 54 hours LEC PDWWHULVQRWUHSHDWHG6HHWKH6FKHGXOHRI&ODVVHVIRUVSHFLÀFLQIRUPDWLRQ This course follows the development of the theatre arts from ancient Greece Not open to students who have received credit for FMS 320. through the 17th Century. The history and evolution of theatre is studied in UHODWLRQVKLSWRWKHVRFLRSROLWLFDODQGFXOWXUDOFRQGLWLRQVRIWKHWLPH3OD\VZLOO be read that exemplify major trends and prominent artists. Folsom Lake College 2011-2012 Theatre Arts 259 TA 331 FILM MAKING 3 UNITS TA 351 THEORY AND TECHNIQUES OF ACTING II 3 UNITS Prerequisite: FMS 300 with a grade of “C” or better Prerequisite: TA 350 with a grade of “C” or better Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 54 hours LEC This course covers contemporary methods of motion picture production, This course continues the exploration of contemporary concepts in scene study LQFOXGLQJORZEXGJHWFLQHPDZLWKDFRQFHQWUDWLRQRQWKHDHVWKHWLFVRIPRWLRQ and the creation of a character for a modern realistic play begun in TA 350. pictures. Stressed are techniques of direction, lighting, photography, editing, Students stage and perform memorized scenes and monologues from modern and other aspects of the motion picture theatre arts. Equipment and supplies for realistic plays in class. individual projects must be furnished by each student. Supplies and equipment are furnished for students working on group projects. TA 356 ACTING FOR THE CAMERA I 3 UNITS Prerequisite: TA 340 with a grade of “C” or better TA 339 SCREENWRITING 3 UNITS Course Transferable to UC/CSU Prerequisite: TA 300 with a grade of “C” or better Hours: 36 hours LEC ; 54 hours LAB Advisory: ENGWR 101 or eligibility for ENGWR 300 This is an introductory course in the theories and techniques of acting for the Course Transferable to UC/CSU camera. This course compares the differences between acting on the stage and Hours: 54 hours LEC acting for the camera. Scenes and commercials will be rehearsed, performed, This course explores the motion picture theatre art of screenwriting. Students and critiqued. will view and analyze motion pictures, participate in exercises and workshops, FRPSRVHDVFUHHQSOD\IRUDVKRUWÀOPDQGSORWDIHDWXUHOHQJWKSURIHVVLRQDOO\ TA 395 PLAYWRITING 3 UNITS formatted screenplay. Prerequisite: TA 300 with a grade of “C” or better Advisory: ENGWR 101 or eligibility for ENGWR 300 TA 340 BEGINNING ACTING 3 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 54 hours LEC Advisory: TA 300 This course explores the writing, reading, performing, and critiquing of original Course Transferable to UC/CSU plays for the theatre. Students will write plays and revise their work continually Hours: 36 hours LEC ; 54 hours LAB throughout the semester. Plays written by students will be read, performed, This course is an introduction to stage performance. Included is a classroom DQGGLVFXVVHGLQFODVV6WXGHQWVZLOOFRPSOHWHDIXOOOHQJWKSOD\E\WKHHQGRI investigation of performance through the use of theatre games, movement, the semester. voice, sensory awareness, and improvisation. Students will practice basic acting theory through scene study. The course is designed for students new to acting TA 420 STAGECRAFT 3 UNITS ZLVKLQJWRH[SORUHVHOIH[SUHVVLRQWKURXJKSHUIRUPDQFHDQGIRUWKRVHPRUH Prerequisite: None. experienced students wishing to begin the degree sequence. Advisory: Students should be able to climb a ladder and lift a minimum of 30 pounds. TA 344 IMPROVISATION AND THEATRE GAMES 2 UNITS Course Transferable to UC/CSU Prerequisite: None. Hours: 36 hours LEC ; 72 hours LAB Course Transferable to UC/CSU 7KLVFRXUVHZLOOVHUYHDVDQLQWURGXFWLRQWRWHFKQLFDOWKHDWUHVSHFLÀFDOO\UHODWHG Hours: 18 hours LEC ; 54 hours LAB WRVWDJHFUDIWDQGWKHHOHPHQWVRIVFHQLFFRQVWUXFWLRQFRQVWUXFWLRQWRROVW\SHV This class introduces students to improvisational acting styles and theatre of theatres, and theatre safety. Practical experience is gained by working on JDPHVIRUSHUIRUPDQFH,PSURYLVDWLRQSUDFWLFHZLOOIRFXVRQWUXVWDQGFRQÀGHQFH GHSDUWPHQWSURGXFWLRQV6WDJHFUDIWZRUNRIWHQUHTXLUHVPRYLQJVHPLKHDY\ EXLOGLQJWHDPZRUNVHOIH[SUHVVLRQDQGFUHDWLYHIDFLOLW\6WXGHQWVDOVRZLOO objects, tools, and ladders, and the carrying of scenic elements or lighting SUDFWLFHPRUHDGYDQFHGZRUNLQQRQVFULSWHGSHUIRUPDQFHWKURXJKWKHDWUH instruments up to a height. games. This class culminates in a public performance. TA 422 STAGE LIGHTING 3 UNITS TA 350 THEORY AND TECHNIQUES OF ACTING I 3 UNITS Prerequisite: None. Prerequisite: TA 340 with a grade of “C” or better; or Instructor consent Advisory: Students should be able to climb a ladder and lift a minimum of 30 Advisory: TA 300 pounds. General Education: AA/AS Area I Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 72 hours LAB Hours: 36 hours LEC ; 54 hours LAB This course is an introduction to the basic concepts of lighting the stage, motion This course explores contemporary concepts in scene study and the creation pictures, and television. The course covers the planning of lighting from the of a character in the style of Realism for a modern play. Students stage and basics of electricity, equipment and control, to the design elements of color, perform memorized scenes from the Modern Realism period in class. space, scenery, and movement to produce a lighting design. Stage lighting work RIWHQUHTXLUHVPRYLQJVHPLKHDY\REMHFWVWRROVDQGODGGHUVDQGFDUU\LQJ lighting equipment up to a height. 260 Theatre Arts Folsom Lake College 2011-2012 TA 423 INTRODUCTION TO SCENE DESIGN FOR THE STAGE TA 452 ONE-ACT PLAY WORKSHOP 3 UNITS 3 UNITS Prerequisite: TA 340 with a grade of “C” or better. Prerequisite: ART 300 and TA 420 with grades of “C” or better Course Transferable to UC/CSU Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB Hours: 36 hours LEC ; 72 hours LAB This class explores the play production process. Class members collaborate in This course will serve as an introduction to the techniques and procedures of WKHDQDO\VLVSUHSDUDWLRQDQGSURGXFWLRQRIRQHDFWSOD\VWKURXJKSDUWLFLSDWLRQ designing and painting scenery for the stage including design, color, perspective, as either directing writers, actors or technicians. The process culminates in tool use, notation, and drafting. It will consist of developing design plans, public performances. methods of visual representation of ideas, scale drawings and models, and practice in scenic painting. TA 461 REHEARSAL AND PERFORMANCE - DRAMA .5-3 UNITS Prerequisite: None. TA 424 ADVANCED TECHNICAL THEATRE 3 UNITS Enrollment Limitation: Audition or Interview Prerequisite: TA 420, 422, and 423 with grades of “C” or better Course Transferable to UC/CSU Advisory: Students should be able to climb a ladder and lift a minimum of 30 Hours: 162 hours LAB pounds. 7KLVFRXUVHSURYLGHVDZRUNVKRSVW\OHWUDLQLQJH[SHULHQFHLQWKHSUHSDUDWLRQ Course Transferable to UC/CSU and performance of a dramatic theatre production. Prospective student actors Hours: 36 hours LEC ; 72 hours LAB audition for roles in the production. Prospective student designers, technicians, Description: This course will explore advanced technical theatre and production artisans, managers, and administrators interview for positions on the design techniques in the areas of scenery, properties, lighting, sound, scenic painting, team and production staff. This course may be taken four times for credit. rigging, and stage management. Practical experience is gained by working on productions for the Department of Theatre and Cinema Arts, Department of TA 462 REHEARSAL AND PERFORMANCE - COMEDY .5-3 UNITS Music, Dance program, and/or the guest speaker series. Technical theatre often Prerequisite: None. UHTXLUHVPRYLQJVHPLKHDY\REMHFWVWRROVDQGODGGHUVDQGFDUU\LQJVFHQLF Enrollment Limitation: Audition or Interview elements or lighting instruments up to a height. Course Transferable to UC/CSU Hours: 162 hours LAB TA 426 STAGEHAND PRACTICES 3 UNITS 7KLVFRXUVHSURYLGHVDZRUNVKRSVW\OHWUDLQLQJH[SHULHQFHLQWKHSUHSDUDWLRQ Prerequisite: TA 424 with a grade of “C” or better and performance of a comedic theatre production. Prospective student actors Advisory: Students should be able to climb a ladder and lift a minimum of 30 audition for roles in the production. Prospective student designers, technicians, pounds. artisans, managers, and administrators interview for positions on the design Course Transferable to CSU team and production staff. This course may be taken four times for credit. Hours: 36 hours LEC ; 72 hours LAB Description: This course will serve as an introduction to union stagehand TA 464 REHEARSAL AND PERFORMANCE - CHILDREN’S SHOW practices. Topics include concepts of trade unionism and the function and .5-3 UNITS services of the various professional unions involved in theatrical and motion Prerequisite: None. picture production. The class will focus on developing basic skills of professional Enrollment Limitation: Audition or Interview stagehand work and on trade safety. Practical experience is gained by working Course Transferable to UC/CSU RQGHSDUWPHQWSURGXFWLRQV6WDJHKDQGZRUNRIWHQUHTXLUHVPRYLQJVHPLKHDY\ Hours: 162 hours LAB objects, tools, and ladders, and carrying scenic elements or lighting instruments 7KLVFRXUVHSURYLGHVDZRUNVKRSVW\OHWUDLQLQJH[SHULHQFHLQWKHSUHSDUDWLRQ up to a height. and performance of a children’s theatre production. Prospective student actors audition for roles in the production. Prospective student designers, technicians, TA 427 STAGEHAND PRE-APPRENTICESHIP 2 UNITS artisans, managers, and administrators interview for positions on the design Prerequisite: TA 426 with a grade of “C” or better team and production staff. Field trips may be required. This course may be Advisory: Students must be able to climb a ladder and lift a minimum of 30 taken four times for credit. pounds. Course Transferable to CSU Hours: 108 hours LAB Description: This course will serve as practical stagehand experience for students working alongside professional union stagehands on department and visiting productions. Students will earn apprenticeship hours towards the required minimum for the professional stagehand union’s apprenticeship SURJUDP6WDJHKDQGZRUNRIWHQUHTXLUHVWKHPRYLQJRIVHPLKHDY\REMHFWV tools, and ladders, and carrying scenic elements or lighting instruments up to a height. Folsom Lake College 2011-2012 Theatre Arts & Viticulture 261 TA 465 REHEARSAL AND PERFORMANCE - MUSICAL .5-3 UNITS Prerequisite: None. Viticulture (VITI) Enrollment Limitation: Audition or Interview Course Transferable to UC/CSU VITI 300 VITICULTURE AND ENOLOGY 3 UNITS Hours: 162 hours LAB Prerequisite: None. 7KLVFRXUVHSURYLGHVDZRUNVKRSVW\OHWUDLQLQJH[SHULHQFHLQWKHSUHSDUDWLRQ Course Transferable to UC/CSU and performance of a musical theatre production. Prospective student actors, Hours: 36 hours LEC ; 54 hours LAB dancers, and musicians audition for roles in the production. Prospective student The course is an introduction to viticulture and enology practices and will designers, technicians, artisans, managers, and administrators interview for explore the history, principles, and practices of wine grape production and an positions on the design team and production staff. This course may be taken introduction to enology. Additional topics will cover the history of wine grapes, four times for credit. WKHFXUUHQWVWDWXVRIZLQHJUDSHLQGXVWU\DQGWKHFODVVLÀFDWLRQRIZLQHJUDSHV The basic principles of vineyard establishment and management will be covered TA 494 TOPICS IN THEATRE ARTS .5-4 UNITS as well as the basic principles of enolgy. Field trips may be required. Prerequisite: None Course Transferable to CSU VITI 301 VITICULTURE PRACTICES SPRING AND SUMMER 3 UNITS Hours: 108 hours LEC ; 108 hours LAB Prerequisite: VITI 300 with a grade of “C” or better This course is designed to give students an opportunity to study a variety Course Transferable to CSU of topics dealing with performance and/or production aspects of theatre not Hours: 36 hours LEC ; 54 hours LAB included in current course offerings. This course may be repeated for credit, This course will cover viticulture practices for the spring and summer growing providing there is no duplication of topics. seasons. The course will explore planning and planting a vineyard, vegetative propagation, trellising, pruning, pest control, soils, irrigation practices, quality TA 495 INDEPENDENT STUDIES IN THEATRE ARTS 1-3 UNITS control measures, and basic vineyard equipment. The basic principles of Prerequisite: None vineyard maintenance and management will be covered, as well anatomy and Course Transferable to CSU physiology of vine growth and grape production during these seasons. This Hours: 18 hours LEC ; 54 hours LAB course is a continuation of VITI 300, Viticulture and Enology. Field trips may be required. TA 498 WORK EXPERIENCE IN THEATRE ARTS 1-4 UNITS Prerequisite: None. VITI 304 WINE COMPONENT TASTING AND APPRECIATION Advisory: ENGWR 101 1.5 UNITS General Education: AA/AS Area III(b) Prerequisite: None. (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS Enrollment Limitation: Students must be 21 years of age or older. volunteer opportunity, or job related to theatre arts. Students are advised Course Transferable to CSU WRFRQVXOWZLWKWKH7KHDWUH$UWV'HSDUWPHQWWRUHYLHZVSHFLÀFFHUWLÀFDWHDQG Hours: 27 hours LEC degree work experience requirements. A sensory course designed for individuals to learn organoleptic tasting Course Transferable to CSU techniques of wine including varietal characteristics and wine styles, designed +RXUV KRXUV/$% for wine industry personnel and wine enthusiasts. A materials fee of $50.00 This course provides students with opportunities to develop marketable skills is required and payable upon registration. in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; VITI 305 WINES OF THE WORLD 1.5 UNITS completion of required forms, which document the student’s progress and hours Prerequisite: None. spent at the work site; and developing workplace skills and competencies. Enrollment Limitation: Students must be 21 years of age or older. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU Course Transferable to CSU orientation and 75 hours of related paid work experience, or 60 hours of Hours: 27 hours LEC unpaid work experience, for one unit. An additional 75 or 60 hours of related An introductory examination of some of the most popular wine varietals work experience is required for each additional unit. The course may be taken of the world compared and contrasted to their California counterparts. Each four times for credit, when there is new or expanded learning on the job, for week we will examine a different grape or related group of grapes and their a maximum of 16 units. expression in wine, e.g., California Cabernet Sauvignon, to a similar Chilean varietal, or French Bordeaux. A materials fee of $75 is required and payable TA 499 EXPERIMENTAL OFFERING IN THEATRE ARTS .5-4 UNITS XSRQUHJLVWUDWLRQ$ÀHOGWULSPD\EHUHTXLUHG Prerequisite: None Course Transferable to CSU Hours: 18 hours LEC ; 54 hours LAB 262 Viticulture Folsom Lake College 2011-2012 VITI 306 WINES OF CALIFORNIA 1.5 UNITS VITI 499 EXPERIMENTAL OFFERING IN VITICULTURE .5-4 UNITS Prerequisite: None. Prerequisite: None Enrollment Limitation: Must be 21 years of age. Course Transferable to CSU Course Transferable to CSU Hours: 72 hours LEC ; 108 hours LAB Hours: 27 hours LEC An introduction to some of the wine varietals grown and produced in California will be examined. Each week we will examine a different grape or related group of grapes and their expression in different regions or appellations of California. A materials fee of $50.00 is required and payable upon registration. Field trips may be required. VITI 307 WINES OF THE SIERRA FOOTHILLS 1.5 UNITS Prerequisite: None. Enrollment Limitation: Students must be 21 years of age or older. Course Transferable to CSU Hours: 27 hours LEC This course covers an introduction to some of the wine varietals grown and produced in California’s Sierra Foothills appellation. Each week the class will examine the expression in wine of different varietals of grape, related group of grapes, or a particular vintners varietals of wines produced in the Sierra Foothills. A materials fee of $50.00 is required and payable upon registration. Field trips may be required. VITI 308 FRUIT TO WINE - ENOLOGY 3 UNITS Prerequisite: None. Enrollment Limitation: Must be 21 years of age. Course Transferable to UC/CSU Hours: 36 hours LEC ; 54 hours LAB An introduction to the science of wine production from grapes and other fruits to the bottle. Topics covered include the history of wine production; grape YDULHWLHVDQGZLQHW\SHV LQÁXHQFHRIFOLPDWHDQGVRLO ZLQHIHUPHQWDWLRQ including assessment of wine qualities, handling, racking, aging, bottling, wine disorders and remedies; and legal compliance. The production of fruit wines may DOVREHFRYHUHG6RPHODEVLQYROYHORFDOÀHOGWULSV$ODEIHHPD\EHDVVHVVHG to cover the costs of grapes and bottling. Students will have the opportunity to take wine home with them made during the semester. VITI 309 WINE SERVICE, HOSPITALITY AND FOOD PAIRINGS 1.5 UNITS Prerequisite: None. Enrollment Limitation: Students must be 21 years of age or older. Course Transferable to CSU Hours: 27 hours LEC 7KLVFRXUVHLVGHVLJQHGIRUZLQHLQGXVWU\SHUVRQQHODQGKRPHZLQHDÀFLRQDGRV to learn appropriate wine service and food pairings with wine. Wine service and hospitality are covered including serving, decanting, storing, handling and displaying wines in restaurants, tasting rooms, and at home, while food and wine pairings will be explored through sensory evaluations of wine and food that will complement each other. A materials fee of $75.00 is required and SD\DEOHXSRQUHJLVWUDWLRQ$ÀHOGWULSPD\EHUHTXLUHG Folsom Lake College 2011-2012 Waste Water Management 263 Waste Water Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Management COUNSELING Rancho Cordova Center - 916-255-0717 analyze and perform the role and responsibilities of a CERTIFICATE OF ACHIEVEMENT treatment plant operator. Waste Water Management demonstrate an understanding of the prevention of pollution, types of waste, discharges and the types CERTIFICATE OF ACHIEVEMENT and effects of solids in wastewater by applying the Waste Water Management responsibilities in industry lab settings required in the FHUWLÀFDWHSURJUDP REQUIRED PROGRAM ...... Units examine the actual collection of wastewater, and ENVT 351 Math for Water and Wastewater ...... operations and maintenance of wastewater treatment Operators ...... 3 IDFLOLWLHV SURFHVVHV WKURXJK SHULRGLF YLVLWDWLRQVÀHOG ENVT 353 Science for Water and Wastewater ...... trips to industry facilities. Operators ...... 4 research and report on the prevention of pollution, ENVT 354 Waste Water Management: Basic ...... types of waste and the need for different types of Instrumentation and Electrical Controls 4 disinfection. ENVT 355 Introduction to Water, Wastewater and calculate basic wastewater math calculations and Recycled Water Management ...... 3 conversions, troubleshoot various electrical circuits, and ENVT 356 Wastewater Operations and Maintenance apply a basic understanding of control circuits, circuit I ...... 3 interpretation and the theories related to electrical ENVT 357 Wastewater Operations and Maintenance phenomenon. II ...... 3 research and report on the prevention of pollution, ENVT 361 Wastewater Collection Systems Operation types of waste and the need for different types of and Maintenance ...... 3 disinfection. CISA 300 Beginning Word Processing (1) or apply personal safety practices which demonstrate CISA 308 Exploring Word Processing and ...... an understanding of personal safety practices in the Presentation Software ...... 1 water, wastewater and recycled water industries. CISA 310 Introduction to Electronic Spreadsheets 1 seek employment in the water and wastewater BUS 224 Customer Service ...... 1 industries in the region. BUS 100 English for the Professional or MGMT 308 Personnel and Human Resources ...... Management (3) or MGMT 360 Management Communication ...... 3 TOTAL UNITS REQUIRED ...... 29 This program is designed to meet the competency areas IRUVWXGHQWVLQWHUHVWHGLQHQWHULQJLQWRWKHÀHOGRI:DVWH Water Management and to enhance the existing abilities of DQLQGLYLGXDODOUHDG\HPSOR\HGLQWKHÀHOG. Upon completion of this program, the student will be able to: identify regulatory agencies, applicable regulations and permits to apply general concepts for the successful operation of water, wastewater and recycled water systems and facilities. evaluate the general management and operational challenges associated with water, wastewater, and recycled water industries. 264 Water Management Folsom Lake College 2011-2012 Folsom campus - 916-608-6510 ACADEMIC El Dorado Center - 530-642-5645 Water Management COUNSELING Rancho Cordova Center - 916-255-0717 demonstrate an understanding of the prevention of CERTIFICATE OF ACHIEVEMENT pollution, types of waste, discharges and the types Water Management and effects of solids in wastewater by applying the responsibilities in industry lab settings required in the FHUWLÀFDWHSURJUDP CERTIFICATE OF ACHIEVEMENT examine the actual collection of wastewater, and Water Management operations and maintenance of wastewater treatment IDFLOLWLHV SURFHVVHV WKURXJK SHULRGLF YLVLWDWLRQVÀHOG REQUIRED PROGRAM ...... Units trips to industry facilities. ENVT 351 Math for Water and Wastewater ...... research and report on the prevention of pollution, Operators ...... 3 types of waste and the need for different types of ENVT 353 Science for Water and Wastewater ...... disinfection. Operators ...... 4 calculate basic wastewater math calculations and ENVT 354 Waste Water Management: Basic ...... conversions, troubleshoot various electrical circuits, and Instrumentation and Electrical Controls 4 apply a basic understanding of control circuits, circuit ENVT 355 Introduction to Water, Wastewater and interpretation and the theories related to electrical Recycled Water Management ...... 3 phenomenon. ENVT 358 Water Treatment Operation and ...... research and report on the prevention of pollution, Maintenance I ...... 3 types of waste and the need for different types of ENVT 359 Water Treatment Operation and ...... disinfection. Maintenance II ...... 3 apply personal safety practices which demonstrate ENVT 360 Water Distribution Operation and ...... an understanding of personal safety practices in the Maintenance ...... 3 water, wastewater and recycled water industries. CISA 300 Beginning Word Processing (1) or seek employment in the water and wastewater CISA 308 Exploring Word Processing and ...... industries in the region. Presentation Software ...... 1 describe and use various methods of sampling and CISA 310 Introduction to Electronic Spreadsheets 1 analysis for water treatment. BUS 224 Customer Service ...... 1 BUS 100 English for the Professional or MGMT 308 Personnel and Human Resources ...... Management (3) or MGMT 360 Management Communication ...... 3 TOTAL UNITS REQUIRED ...... 29 This program is designed to meet the competency areas IRUVWXGHQWVLQWHUHVWHGLQHQWHULQJLQWRWKHÀHOGRI:DWHU Management and to enhance the existing abilities of an LQGLYLGXDODOUHDG\HPSOR\HGLQWKHÀHOG. Upon completion of this program, the student will be able to: identify regulatory agencies, applicable regulations and permits to apply general concepts for the successful operation of water, wastewater and recycled water systems and facilities. evaluate the general management and operational challenges associated with water, wastewater, and recycled water industries. analyze and perform the role and responsibilities of a treatment plant operator. Folsom Lake College 2011-2012 Work Experience 265 Folsom campus - 916-608-6510 Work Experience (Co-op) ACADEMIC El Dorado Center - 530-642-5645 COUNSELING Rancho Cordova Center - 916-255-0717 Education With employer’s assistance, establish new or expanded Cooperative Work Experience Education (Co-op) is a on-the-job skills that will be documented. unique, experiential, academic program that allows Attend a one-hour weekly career management class... individuals to apply what they’ve learned in the classroom or qualify for the “Returning Co-op Student” status. to a work environment. Upon completion of their Co-op However, attendance is required for everyone for the experience, students may earn 1-4 units of transferable ÀUVWWZRRULHQWDWLRQVHVVLRQV credit with a letter grade. Co-op serves: College interns, Register for 1, 2, 3, or 4 units. One unit of credit may volunteers, and employees. It is also one of several Living be earned for each 75 hours of paid work experience Skills graduation requirements for an associate degree. or for 60 hours of non-pay experience. A total of 16 units may be earned in Vocational Work Experience. Co-op Internships and Opportunities Students working in their college majors and taking, or Internships and volunteer experiences provide an have taken a course in that area, should enroll in that opportunity for students to obtain work experience in their area’s work experience class (e.g. - a sales clerk should major. This activity assists students to develop technical enroll in Business).* VNLOOVFKHFNRXWFDUHHUFKRLFHEXLOGFRQÀGHQFHQHWZRUN ZLWKSHRSOHLQWKHÀHOGDQGWUDQVLWLRQIRUHQWU\LQWRD * Interested students may earn college credit in the competitive labor market. following majors: Interested students must apply two or more weeks before Accounting classes start and are required to take a weekly one hour Administration of Justice career management class. College credit is earned and Automotive Mechanics Technology internships may be paid or non-paid. Business Communications Media Employees Computer Information Science Co-op also assists our busy employed students who Construction Management Technology are interested in advancing within their existing work Dance environment. Through Co-op and the approval of the Early Childhood Education student’s employer supervisor, students can apply what Environmental Technology they have learned in the classroom to their job. Fire Technology Gerontology College credit is earned. Horticulture Human Services How the Program Works Management There are two types of Co-op Programs: Vocational and Marketing General. Photography Theatre Arts Vocational Work Experience (298/498) provides students with opportunities to develop or add marketable skills General Work Experience (198): related to their vocational study programs. * General work experience education assists students in learning about the world of work and is open to all students Eligible students must: regardless of major or job. Like vocational work experience, Be working in a paid job, internship, or volunteer it is designed for students wanting to apply skills learned opportunity. Students not currently in an internship in the classroom to their actual job. opportunity who would like assistance should contact WKH &RRSHUDWLYH :RUN ([SHULHQFH (GXFDWLRQ 2IÀFH College credit (1-3 units) will be earned for working in the Students must have a cooperating employer by the students’ current job per semester. No more than six units HQGRIWKHWKLUGZHHNRIWKHVHPHVWHUÀUVWZHHNRID may be earned in the program. One unit of credit may nine week, or summer session to remain in the program. be earned for each 75 hours of paid work experience or 266 Work Experience Folsom Lake College 2011-2012 for 60 hours of volunteer experience. Students must have a cooperative employer by the end of the third week of the Work Experience (WEXP) VHPHVWHU HQGRIWKHÀUVWZHHNRIDQLQHZHHNRUDVXPPHU session) to remain in the program. WEXP 198 WORK EXPERIENCE - GENERAL 1-3 UNITS Prerequisite: None. Register for “General Work Experience” (Work Advisory: ENGWR 101 Experience 198) and attend weekly career management General Education: AA/AS Area III(b) class. (QUROOPHQW/LPLWDWLRQ %HLQDSDLGRUQRQSDLGLQWHUQVKLSYROXQWHHURSSRUWXQLW\ or job related to career goals. +RXUV KRXUV/$% Co-op Work Experience (198/298/498) This course provides students with opportunities to develop marketable skills Co-op has two different ways to qualify for the program: in preparation for employment or advancement within their current job. Course content will include understanding the application of education to the workforce; New (1st Time Co-op) Students: completion of required forms, which document the student’s progress and hours A. You are working a paid or non-paid job, internship, spent at the work site; and developing workplace skills and competencies. or volunteer opportunity. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODQKRXU B. You must attend the class that meets each week. orientation and 75 hours of related paid work experience, or 60 hours of unpaid This class will cover workforce/career transition work experience for one unit. An additional 75 or 60 hours of related work issues. experience is required for each additional unit. This course may be taken again C. Your grade and units are earned based on your when there is new or expanded learning on the job for a maximum of 6 units. performance in the workplace (developing new skills) and classroom assignments. WEXP 498 WORK EXPERIENCE IN (SUBJECT) 1-4 UNITS Prerequisite: None. Returning Students: Advisory: ENGWR 101 A. You have completed a Co-op class at FLC. General Education: AA/AS Area III(b) B. You are working a paid or non-paid job, internship, (QUROOPHQW/LPLWDWLRQ 6WXGHQWPXVWEHLQDSDLGRUQRQSDLGLQWHUQVKLS or volunteer opportunity. volunteer opportunity, or job related to career interests. C. No class attendance is required for this program Course Transferable to CSU H[FHSW IRU WKH ÀUVW WZR ´RULHQWDWLRQµ VHVVLRQV +RXUV KRXUV/$% However, you must establish new on-the-job skills This course provides students with opportunities to develop marketable skills with your employer and complete the necessary in preparation for employment or advancement within their current job. Course forms. content will include understanding the application of education to the workforce; D. Your grade and units are earned based on completion of required forms, which document the student’s progress and hours your work performance and outside homework spent at the work site; and developing workplace skills and competencies. assignments that emphasize career transition. 'XULQJWKHFRXUVHRIWKHVHPHVWHUWKHVWXGHQWLVUHTXLUHGWRIXOÀOODKRXU orientation and 75 hours of related paid work experience, or 60 hours of For more information, call (916) 608-6552. unpaid work experience, for one unit. An additional 75 or 60 hours of related work experience is required for each additional unit. The course may be taken four times for credit, when there is new or expanded learning on the job, for a maximum of 16 units. Folsom Lake College 2011-2012 267 Student Clubs & Organizations Administration of Justice Club ECO Club SIFE (Students in Free Enterprise) Advisor: Ben Krohn Advisor: Steve Holzberg $GYLVRU &DQG\6PLWK NURKQE#ÁFORVULRVHGX KRO]EHV#ÁFORVULRVHGX VPLWKF#ÁFORVULRVHGX &RDGYLVRU 7RQ\'L&LFFR Co-advisor: David Reese GLFLFFD#ÁFORVULRVHGX UHHVHG#ÁFORVULRVHGX Ski and Snowboard Club: Full Shred Afro-Cuban Funk EDC Student Activities Club $GYLVRU 5RQ5LFKDUGVRQ Advisor: Philip Angove Advisor: Deanne Repetto ULFKDUU#ÁFORVULRVHGX DQJRYHS#ÁFORVULRVHGX UHSHWWG#ÁFORVULRVHGX Co-advisor: Sarah Aldea DOGHDV#ÁFORVULRVHGX Ballroom Dance International Life Advisor: Don Hopkins $GYLVRU 7HG6DXU SODA (Student Organization for KRSNLQG#ÁFORVULRVHGX VDXUW#ÁFORVULRVHGX Developing Arts) Co-advisor: Lizette Hopkins &R$GYLVRU 'LDQD7LQRFR $GYLVRU (XQ\RXQJ+ZDQJ KRSNLQH#ÁFORVULRVHGX WLQRFRG#ÁFORVULRVHGX KZDQJH#ÁFORVULRVHGX Bike Club Martial Arts Club Spanish Club $GYLVRU 7LP0F+DUJXH Advisor: Frank Gaviola $GYLVRU -XDQ&DUORV0RUDJD PFKDUJW#ÁFORVULRVHGX HQRGRMR#DROFRP PRUDJDM#ÁFORVULRVHGX &RDGYLVRU 0DUF2OVHQ ROVHQP#ÁFORVULRVHGX Mathematics Society Veterans’ Club $GYLVRU 'HDQ3LHWURPRQDFR $GYLVRU *RUGDQ/DP Cast of Falcons (Theatre Club) SLHWURG#ÁFORVULRVHGX ODPJ#ÁFORVULRVHGX Advisor: David Harris Co-advisor: Larry Fernandez Co-advisor: Bernard Gibson KDUULVG#ÁFORVULRVHGX IHUQDQM#ÁFORVULRVHGX JLEVRQE#ÁFORVULRVHGX &RDGYLVRU 3HWHU0RKUPDQ PRKUPDS#VFFORVULRVHGX MOSAIC Dance Club Volunteer Club Advisor: Debi Worth Advisor: Gerry Tryhane Chemistry Club ZRUWKG#ÁFORVULRVHGX WU\KDQJ#ÁFORVULRVHGX Advisor: Shawn Reese UHHVHV#ÁFORVULRVHGX Outdoors Club Women in Action Advisor: Sarah Pender $GYLVRU 5HEHFFD'HYLOOH Debate Society SHQGHUV#ÁFORVULRVHGX GHYLOOU#ÁFORVULRVHGX $GYLVRU -HUHP\0RULRND PRULRNM#ÁFORVULRVHGX Phi Theta Kappa $GYLVRU $OLFH7H[WRU WH[WRUD#ÁFORVULRVHGX Co-advisor: Wayne Jensen MHQVHQZ#ÁFORVULRVHGX 268 Folsom Lake College 2011-2012 Phi Theta Kappa Honor Society Beta Mu UpsilonLVDQRIÀFLDOFKDSWHURIWKHPhi Theta Kappa ,QWHUQDWLRQDO+RQRU6RFLHW\IRUWZR\HDUFROOHJHV3KL7KHWD.DSSD KRQRUVWXGHQWVPHHWWKHVHFULWHULD &XPXODWLYH*UDGH3RLQW$YHUDJHRIRUKLJKHU )XOOFLWL]HQVKLSRIDQ\FRXQWU\ (QUROOPHQWLQD\HDUFROOHJH &RPSOHWLRQRIXQLWVDW)/&OHDGLQJWRDQ$VVRFLDWH·VGHJUHH 2QHWLPHUHJLVWUDWLRQIHHRI +RZGR\RXMRLQPhi Theta Kappa",I\RXPHHWWKHUHTXLUHPHQWV PHQWLRQHGDERYH\RXPD\SLFNXSDQDSSOLFDWLRQLQWKH)DOFRQ·V 5RRVWRQWKH)ROVRPFDPSXVORZHUOHYHOURRP)52ULIWKH(O 'RUDGR&HQWHULVFORVHU\RXPD\SLFNXSDQDSSOLFDWLRQDW6WXGHQW 6HUYLFHV BENEFITS OF JOINING: %XLOGUHVXPHIRUVFKRODUVKLSDSSOLFDWLRQVWUDQVIHURUMREVHDUFK 0DQ\VFKRODUVKLSVDUHRSHQRQO\WR3KL7KHWD.DSSDQV /HDUQOHDGHUVKLSVNLOOV 3DUWLFLSDWHLQFRPPXQLW\VHUYLFH 1HWZRUNDQGHQMR\IHOORZVKLS Leadership 3KL7KHWD.DSSDHQFRXUDJHVPHPEHUVWRWDNHOHDGHUVKLSUROHVLQVLGHDQGRXWVLGHWKHFKDSWHUVSHDUKHDGLQJ HIIRUWVWRPDNHDGLIIHUHQFHIRUERWKPHPEHUVDQGWKHZLGHUFRPPXQLW\ Fellowship )HOORZVKLSLQFOXGHVQXUWXULQJRILQWHOOHFWXDOIHOORZVKLSDPRQJPHPEHUVSURYLGLQJHQMR\DEOHDFWLYLWLHVIRUPHPEHUV WREDODQFHVWXG\LQJDQGZRUN)HOORZVKLSDFWLYLWLHVSURPRWHFKDSWHUGHYHORSPHQWIDFLOLWDWHFRPPXQLFDWLRQ EHWZHHQFKDSWHUVDQGSURYLGHRSSRUWXQLWLHVIRUFKDSWHUVWRJDWKHUWRJHWKHUDQGGLVFXVVFKDSWHUSURJUDPV )HOORZVKLSDFWLYLWLHVFDQDOVRLQFOXGHWKRVHWKDWGHYHORSFDPSXVRUUHJLRQDOXQLW\RUVKRZFDVHWKHFKDSWHUDVD SDUWLFLSDQWLQWKHFROOHJHDQGFRPPXQLW\ Service $VWURQJFRPPLWPHQWWRVHUYLFHKDVDOZD\VEHHQDPDMRUIRFXVRI3KL7KHWD.DSSD·VPLVVLRQV7KH6RFLHW\ HPSKDVL]HVWKHFRUUHODWLRQEHWZHHQVFKRODUVKLSDQGVHUYLFHDQGHQFRXUDJHVFKDSWHUVWREHFRPHDJHQWVIRU FKDQJHRQWKHLUFROOHJHFDPSXVHVDQGLQWKHLUFRPPXQLWLHV )RUPRUHLQIRUPDWLRQFRQWDFW&KDSWHU$GYLVRU $OLFH7H[WRUDW Folsom Lake College 2011-2012 269 FIND OUT what’s happening ON CAMPUS Check out the events calendar @ Folsom Lake College I 916-608-6500 El Dorado Center I 530-642-5644 Rancho Cordova Center I 916-255-0717 10 College Parkway, Folsom CA 95630 6699 Campus Drive, Placerville, CA 95667 10378 Rockingham Drive, Sacramento, CA 95827 Los Rios Community College District 270 Folsom Lake College 2011-2012 )ROVRP/DNH&ROOHJH)RXQGDWLRQ%XLOGLQJ'UHDPVWKURXJKVWXGHQW VFKRODUVKLSVHGXFDWLRQDOSURJUDPVXSSRUWDQGIDFLOLW\HQKDQFHPHQWV 7KH )ROVRP /DNH &ROOHJH )RXQGDWLRQ ZDV HVWDEOLVKHG LQ WR DGYDQFHHGXFDWLRQDWWKHWKUHH)ROVRP/DNH&ROOHJHFDPSXVHVE\ SURYLGLQJ ÀQDQFLDO UHVRXUFHV DQG HQKDQFLQJ FRPPXQLW\ VXSSRUW *RYHUQHGE\DYROXQWHHU%RDUGRI'LUHFWRUVWKH)RXQGDWLRQZRUNV WR 3URYLGHVWXGHQWVFKRODUVKLSV 'HYHORS EXVLQHVV SDUWQHUVKLSV WR VXSSRUW WKH SURJUDPV DQG DFWLYLWLHVRIWKHFROOHJH 3URYLGH D PHDQV IRU WKH FRPPXQLW\ WR HQJDJH ZLWK WKH FROOHJH WKURXJKVSHFLDOHYHQWVYROXQWHHURSSRUWXQLWLHVDQGSKLODQWKURS\ :HLQYLWH\RXWRMRLQXVLQRXUHIIRUWVWRVXSSRUWWKHVWXGHQWVIDFXOW\ DQGVWDIIRI)ROVRP/DNH&ROOHJH )RU PRUH LQIRUPDWLRQ FRQWDFW .ULVWLQ +DDV DW RU KDDVN#ÁFORVULRVHGX 7KH)ROVRP/DNH&ROOHJH)RXQGDWLRQLVDQDIÀOLDWHRIWKH/RV5LRV)RXQGDWLRQ D&DOLIRUQLDQRQ SURÀWSXEOLFEHQHÀWFRUSRUDWLRQDQGLVWD[H[HPSWDVSURYLGHGE\,566HF F Folsom Lake College 2011-2012 271 College Administration 7KHOPD6FRWW6NLOOPDQ $LGHQ(O\ President Dean, Student Development and Enrollment Management .DWKOHHQ.LUNOLQ 0RQLFD3DFWRO Vice President, Administration Dean, Instruction, Folsom Lake College main campus 6XVDQ//RULPHU *DU\+DUWOH\ Vice President, Instruction Dean, Instruction & Technology 'HQLVH1ROGRQ 'DOHYDQ'DP Vice President, Student Development and Dean, Instruction, El Dorado Center Enrollment Management 6WXDUW9DQ+RUQ 'DYH3LHU Dean, Instruction, Career & Technical Education Executive Director, Three Stages 5RE0XOOLJDQ Bookstore Manager Degrees - Faculty and Administration NOTE: Year in parentheses refers to date of %-(5.($QQ/\QQ &/$5.&KULVWRSKHU6 full-time hiring at Los Rios Community College (QJOLVKDVD6HFRQG/DQJXDJH &RXQVHORU7UDQVIHU District or Folsom Lake College. %$ &68 6DFUDPHQWR 0$ 8& 'DYLV $$:HVW9DOOH\&ROOHJH %$066DQ 0$&686DFUDPHQWR )UDQFLVFR6WDWH8QLYHUVLW\ $%5$+$0/LQGD 0LFURELRORJ\ %2 '2:(//=DFKDU\ *5((1(&DOYLQ' +2/=%(5*6WHYH ,QVWUXFWLRQDO 'HVLJQ 'HYHORSPHQW 0DWKHPDWLFV %LRORJ\ &RRUGLQDWRU %6/RXLVLDQD6WDWH8QLYHUVLW\ 060$ %68&,UYLQH 3K'8&%HUNHOH\ %$0$&68/RV$QJHOHV 8&'DYLV +:$1*(XQ\RXQJ (&.0$16SHQFHU +$/('DQLHO $UW (QJOLVKDVD6HFRQG/DQJXDJH $VWURQRP\3K\VLFV %$:DJQHU&ROOHJH 0)$ %$0$&686WDQLVODXV %66RQRPD6WDWH8QLYHUVLW\ 060LFKLJDQ :HVW7H[DV$ 0 0$8QLYHUVLW\RI1RUWK 6WDWH8QLYHUVLW\ 7H[DV (,7(/-RVHSK( 0DWKHPDWLFV +$16(10DU\ -(16(1:D\QH 0$)UHVQR3DFLÀF8QLYHUVLW\ &ROOHJH1XUVH 0DWKHPDWLFV %61&686DFUDPHQWR 061'RPLQLFDQ $6 $PHULFDQ 5LYHU &ROOHJH %$ &68 (//(50$1&+RZHOO 8QLYHUVLW\RI&$ 6DFUDPHQWR 0$8QLYHUVLW\ %XVLQHVV RI&RORUDGR $%2FFLGHQWDO&ROOHJH -'/R\ROD/DZ +$55(//.LPEHUO\ 6FKRRO ,(0&HUWLÀFDWH+DUYDUG8QLYHUVLW\ 3K\VLFDO(GXFDWLRQ -,0(1(=5HJLQD$ %$0$8&'DYLV /LEUDULDQ (/<$LGHQ %$&686RQRPD 0/68&%HUNHOH\ 'HDQ 6WXGHQW 'HYHORSPHQW (QUROOPHQW +$55,6'DYLG 0DQDJHPHQW 7KHDWUH$UWV .,5./,1.DWKOHHQ %6 *HRUJH :LOOLDPV &ROOHJH 0$ %)$ 8QLYHUVLW\ RI ,OOLQRLV 8UEDQD 9LFH3UHVLGHQWIRU$GPLQLVWUDWLRQ &KDSPDQ8QLYHUVLW\ &KDPSDLJQ 0)$8&6DQ'LHJR %$ 1DWLRQDO 8QLYHUVLW\ 0%$ *ROGHQ *DWH8QLYHUVLW\ )$11216HDQ +$57/(<*DU\ 3V\FKRORJ\ 'HDQRI,QVWUXFWLRQ 7HFKQRORJ\ .5$(0(5-HQQLIHU/ %$ 7KH &DWKROLF 8QLYHUVLW\ RI $PHULFD %$7ULQLW\&ROOHJH 0$7ULQLW\(YDQJHOLFDO (DUO\&KLOGKRRG(GXFDWLRQ 3K''XNH8QLYHUVLW\ 'LYLQLW\ 6FKRRO $%' 1RUWKHUQ ,OOLQRLV %$&686WDQLVODXV 0$&686DFUDPHQWR 8QLYHUVLW\ )/(7&+(5)UDQFLV .52(1&.(0LNDHO (QJOLVK +$8*3DXOD 0DWKHPDWLFV3K\VLFV %$0$&686DFUDPHQWR &RPPXQLFDWLRQ6WXGLHV 0$6DQ)UDQFLVFR6WDWH8QLYHUVLW\ 06 %$0$&68)UHVQR %68&'DYLV )/25(6-XDQ- &RXQVHORU(23 6&$5(&RRUGLQDWRU +(*1(53DXOD( /$*$/$'DYLG %$06&686DFUDPHQWR $FFRXQWLQJ %LRORJ\ 06&686DFUDPHQWR $$ 9HQWXUD &ROOHJH %$ 8& 6DQWD )267(57HG) %DUEDUD '&:HVWHUQ6WDWHV&KLURSUDFWLF &KHPLVWU\ +,//'DYLG+ &ROOHJH %6&DUOHWRQ&ROOHJH 063K'8&6DQ &RXQVHORU 'LHJR $$ 5LFNV &ROOHJH %$ +XPEROGW 6WDWH /$0*RUGRQ 8QLYHUVLW\ 0(G (G' %ULJKDP /(11(570LFKHOOH 12/'21'HQLVH 5$86&+.2/%7UDF\ $PHULFDQ6LJQ/DQJXDJH6WXGLHV 9LFH3UHVLGHQW6WXGHQW'HYHORSPHQWDQG (QJOLVK %$ *DOODXGHW 8QLYHUVLW\ :DVKLQJWRQ (QUROOPHQW0DQDJHPHQW %60$&HUWLÀFDWHLQ7HDFKLQJ&ROOHJH '& 06&DSHOOD8QLYHUVLW\0LQQHVRWD %$06&68/RQJ%HDFK 3K'8QLYHUVLW\ &RPSRVLWLRQ&686DFUDPHQWR RI0DU\ODQG&ROOHJH3DUN /23(=&DUORV 5((6('DYLG 6SDQLVK 2%(57+&KULVWD 3ROLWLFDO6FLHQFH %$0$8&'DYLV &KHPLVWU\ %$8&6DQWD%DUEDUD 0$6DQ'LHJR %63K'8&'DYLV 06&686DFUDPHQWR 6WDWH 3K'&RORUDGR /25,0(56XVDQ/ 6WDWH8QLYHUVLW\ 9LFH3UHVLGHQWIRU,QVWUXFWLRQ 2/6(10DUF %6 8& 6DQ )UDQFLVFR 06 &68 0DWKHPDWLFV 5((6(6KDZQ 6DFUDPHQWR (G'2UHJRQ %6&68&KLFR 0$78&'DYLV &KHPLVWU\ 6WDWH8QLYHUVLW\ $$*OHQGDOH&RPPXQLW\&ROOHJH$UL]RQD 2/76+:D\QH %63K'%ULJKDP 6$<$*20DULVD 7(;725$OLFH 9$1'$0'DOH $UW 6WXGHQW/LIH3K\VLFDO(GXFDWLRQ 'HDQRI,QVWUXFWLRQ(O'RUDGR&HQWHU %)$ : 7H[DV $ 0 8QLYHUVLW\ 0)$ %$:HVWHUQ:DVKLQJWRQ8QLYHUVLW\ 06 %$8&6DQWD%DUEDUD 068QLYHUVLW\ 8QLYHUVLW\RI1R7H[DV 8QLYHUVLW\RI$UL]RQD RI8WDK 6&+0,'+HLNH 7+,(66(16WDFLD6 9$1+2516WXDUW $UW /LEUDULDQ 'HDQRI&DUHHU 7HFKQLFDO(GXFDWLRQ %$7HFKQLVFKH8QLYHUVLWlW%HUOLQ*HUPDQ\ %60RUQLQJVLGH&ROOHJH 0/,66DQ-RVH $$2UDQJH&RDVW&ROOHJH %68QLYHUVLW\ 0$&686DFUDPHQWR 6WDWH8QLYHUVLW\ RI *UHDW )DOOV 0H' $]XVD 3DFLILF 8QLYHUVLW\ (G' 8QLYHUVLW\ RI 3KRHQL[ 6&2776.,//0$17KHOPD 7,.+2129,QQD 6FKRRORI$GYDQFHG6WXGLHV 3UHVLGHQW &RXQVHORU %$ 06 &686 +D\ZDUG (G' 1RYD $6 &RVXPQHV 5LYHU &ROOHJH %$ 06 :$'$(ULF 8QLYHUVLW\ &686DFUDPHQWR %LRORJ\ %$%68&%HUNHOH\ 3K'8&'DYLV 6+,5/(<-RKQ$ 7,12&2'LDQD&KDQJ &RPSXWHU,QIRUPDWLRQ6FLHQFH (QJOLVKDVD6HFRQG/DQJXDJH :$7621%HWKDQ\ %%$0%$06(G1DWLRQDO8QLYHUVLW\ $$ 6DFUDPHQWR &LW\ &ROOHJH %$ 0DWKHPDWLFV 6DFUDPHQWR 8& 'DYLV 0$ &ROXPELD ,QWHUQDWLRQDO %$0$&686DFUDPHQWR 8QLYHUVLW\ 60,7+&DURO\Q :,//621-DPLH* %XVLQHVV0DQDJHPHQW 7255(=0DWW 3K\VLFDO(GXFDWLRQ 0$1DWLRQDO8QLYHUVLW\ 3K\VLFDO(GXFDWLRQ %$ &68 &KLFR 0$ 06 &68 %60$&68)UHVQR 6DFUDPHQWR 61(//.HQQHWK/ 3V\FKRORJ\ 75,(8/H/H :257+'HEL $$*ROGHQ:HVW&ROOHJH %$06&68 0DWKHPDWLFV 'DQFH.LQHVLRORJ\ )XOOHUWRQ 0$&686DFUDPHQWR %6&DO3RO\6DQ/XLV2ELVSR 0$&68 %$8&,UYLQH 0$8QLYHUVLW\RI6XUUH\ 6DFUDPHQWR 5RHKDPSWRP(QJODQG 6:,7+(1%$1.(OL]DEHWK %XVLQHVV7HFKQRORJ\ 75<+$1(*HUU\ :5,*+70DWW %66DQWD&ODUD8QLYHUVLW\ 0%$*ROGHQ $FFRXQWLQJ%XVLQHVV +HDOWK(GXFDWLRQ.LQHVLRORJ\ *DWH8QLYHUVLW\ %6/RQJ,VODQG8QLYHUVLW\ 0%$+RIVWUD %$0$&68&KLFR 8QLYHUVLW\ 7(//(6-DPHV /LEUDULDQ 7 $%%277.DWLH &21$175RQ *26$/%REE\ Extended Opportunity Programs Custodial Services Extended Opportunity Programs and Services )ROVRPFDPSXV and Services 5DQFKR&RUGRYD&HQWHU )ROVRPFDPSXV &248(5,//(6DP $/'($6DUDK Three Stages *8==,.DWK\ Outreach )ROVRPFDPSXV Bookstore )ROVRPFDPSXV )ROVRPFDPSXV &26(17,12-LP $1'(5621-DH Information Technology Services +$$6.ULVWLQ Instructional Services )ROVRPFDPSXV College Advancement )ROVRPFDPSXV )ROVRPFDPSXV &2<.(1'$//0LFKHOOH $1'(5621-DPHV´$QG\µ Distance Education/AV Services +$%,%$IVKDQ Receiving )ROVRPFDPSXV Instructional Services )ROVRPFDPSXV )ROVRPFDPSXV &52:6FRWW $1'5(:6$GULHQQH Public Information Services +$1(<%UHQGD Administrative Services )ROVRPFDPSXV Business Services (O'RUDGR&HQWHU )ROVRPFDPSXV &811,1*+$0&KULV %$+16&DQGDFH Maintenance +$16(1+XJK Instructional Support Services )ROVRPFDPSXV Custodial Services (O'RUDGR&HQWHU )ROVRPFDPSXV '($5<'HPHWULD %$51(6/,*825,.DWK\$ Instructional Support Services +$50$1-RDQ\ Printing/Mailroom Services )ROVRPFDPSXV Business Services )ROVRPFDPSXV )ROVRPFDPSXV (5,&.621'LDQD %$77(56+(//0DWWKHZ Administrative Services +$57.ULVW\ Public Information Services/Webmaster (O'RUDGR&HQWHU Public Information Services )ROVRPFDPSXV )ROVRPFDPSXV )5$1&25RFKHOOH %,(/(),(/'9RQ Admissions & Records +(,/$1'-R\FH Outreach )ROVRPFDPSXV Admissions & Records (O'RUDGR&HQWHU 5DQFKR&RUGRYD&HQWHU )5(,/,1*%LOO %52:1*D\OH Custodial Services +(00(1:$<7UDF\ Admissions & Records (O'RUDGR&HQWHU Admissions & Records )ROVRPFDPSXV (O'RUDGR&HQWHU *(25*(7DQ\D %855$*(/LVD Learning Resources +(1'5,&.67HVV Three Stages )ROVRPFDPSXV Instructional Support Services )ROVRPFDPSXV )ROVRPFDPSXV *,/0(5.DUHQ &$//$:$<5RQGD Administrative Services +(67(5-RKQ Student Services )ROVRPFDPSXV Custodial Services )ROVRPFDPSXV )ROVRPFDPSXV *2))7KRPDV &$55,//2.LP Instructional Support Services +,//6DUDK Instructional Services )ROVRPFDPSXV Distance Education/AV Services )ROVRPFDPSXV )ROVRPFDPSXV *22'0$13DW &/,1&+'LQR Custodial Services +,1','DYLG Maintenance )ROVRPFDPSXV Distance Education/AV Services )ROVRPFDPSXV )ROVRPFDPSXV 276 Folsom Lake College 2011-2012 +,17=(-HDQQH 0F'21$/'=KULQQD 3$/20$5(6.DUHQ Instructional Support Services Financial Aid Extended Opportunity Programs and )ROVRPFDPSXV )ROVRPFDPSXV Services )ROVRPFDPSXV +26/(<5REHUW 0(528;/LQGD$ Custodial Services Instructional Support Services 3$55,6+'HQLVH )ROVRPFDPSXV )ROVRPFDPSXV Financial Aid (O'RUDGR&HQWHU +<'(55HQHH 0,//(57UDYLV Student Services Maintenance 35,'(025(%LOO )ROVRPFDPSXV )ROVRPFDPSXV Instructional Support Services )ROVRPFDPSXV -$&.621'RQ 0217(='RPLQLF Receiving Custodial Services 5(77(5(YHO\Q (O'RUDGR&HQWHU (O'RUDGR&HQWHU Admissions & Records (O'RUDGR&HQWHU -(11,1*6*LQD 025*$1'HQLVH Instructional Support Services Business Services 586625HQHH (O'RUDGR&HQWHU )ROVRPFDPSXV Instructional Services )ROVRPFDPSXV -2+1621&ROOHHQ 0255,65RJHU College Operations Information Technology Services 6$$'7LQD )ROVRPFDPSXV )ROVRPFDPSXV Instructional Support Services )ROVRPFDPSXV .(//</DXUD 026.$//LQGVH\ Printing/Mailroom Services Admissions & Records 6$+7DVQHHP )ROVRPFDPSXV )ROVRPFDPSXV Disabled Student Programs and Services )ROVRPFDPSXV .5$)7/RWD 028$7KHQJ Custodial Services Financial Aid 6$17252/LQGD )ROVRPFDPSXV )ROVRPFDPSXV Instructional Services )ROVRPFDPSXV /$1*)25'%HFN\ 08//,*$17HUU\ Bookstore Custodial Services 6+$1(9RQQLH )ROVRPFDPSXV )ROVRPFDPSXV Instructional Services (O'RUDGR&HQWHU /(('HQQLV 1,(/6(15XWK Custodial Services Instructional Services 6,5$&86$'DZQ )ROVRPFDPSXV )ROVRPFDPSXV Student Services )ROVRPFDPSXV /((+DR 1257+523-HDQQH Instructional Support Services Instructional Services 60$//.LP )ROVRPFDPSXV )ROVRPFDPSXV Information Technology Services )ROVRPFDPSXV /(:,6-HII 2/621&KULV Information Technology Services Institutional Research 626$.LUN )ROVRPFDPSXV )ROVRPFDPSXV Information Technology Services )ROVRPFDPSXV /,67*D\OH 2:(16&ROLQ Learning Resources Bookstore 635,1.(/%HWK (O'RUDGR&HQWHU )ROVRPFDPSXV Assistant to the President )ROVRPFDPSXV 0$586,&+*HQQDGL\ 3$'$6+$OL Information Technology Services Financial Aid 6:$16210DU\ )ROVRPFDPSXV )ROVRPFDPSXV Business Services )ROVRPFDPSXV Folsom Lake College 2011-2012 277 7$.(0272'DUUHQ :(%%.HYLQ :85=(5&KULVWLQH Instructional Support Services Instructional Support Services Admissions & Records (O'RUDGR&HQWHU )ROVRPFDPSXV )ROVRPFDPSXV 7$ 7+20$6&DURO :+,71(<'HERUDK$ =6&+2..(-RKQ Financial Aid Counseling Services Instructional Support Services )ROVRPFDPSXV )ROVRPFDPSXV 5DQFKR&RUGRYD&HQWHU 72/('2.LP :,//,$06$QJLH =:(5(1=.LP Extended Opportunity Programs and Instructional Support Services Instructional Support Services Services )ROVRPFDPSXV (O'RUDGR&HQWHU (O'RUDGR&HQWHU :,//,$061LFROH 9$1(*$6&OHPHQWLQD Admission & Records Custodial Services 5DQFKR&RUGRYD&HQWHU (O'RUDGR&HQWHU :2))25'(GJDU 9,6(17,1'HH Custodial Services Business Services )ROVRPFDPSXV )ROVRPFDPSXV 278 Folsom Lake College 2011-2012 2011 - 2012 Catalog Index )RUDOLVWRI'HJUHHVDQG&HUWLÀFDWHVVHHSDJH $%287)2/620/$.(&2//(*( %DVLF6NLOOV(GXFDWLRQ $FDGHPLF$FFRPPRGDWLRQV %LRORJ\ $&$'(0,&&$/(1'$5LQVLGHIURQWFRYHU %LRORJLFDO6FLHQFHV'HJUHH $FDGHPLF'LVPLVVDO %RDUGRI7UXVWHHV $FDGHPLF)UHHGRP %2*%RDUGRI*RYHUQRUV)HH:DLYHU $FDGHPLF+RQRUV %RRNVWRUH $FDGHPLF,QWHJULW\DQG5HVSRQVLELOLW\3ODJLDULVPDQG %XVLQHVV &KHDWLQJ3ROLF\ $GPLQLVWUDWLYH$VVLVWDQW'HJUHH $FDGHPLF3UREDWLRQ *HQHUDO'HJUHH $FDGHPLF5HQHZDOZLWKRXW&RXUVH5HSHWLWLRQ *HQHUDO7UDQVIHU'HJUHH $FFHVV&DUG 2IÀFH$VVLVWDQW&HUWLÀFDWH $FFRXQWLQJ 2IÀFH7HFKQLFLDQ&HUWLÀFDWH $FFRXQWLQJ&HUWLÀFDWH 6PDOO%XVLQHVV0DQDJHPHQW $FFRXQWLQJ'HJUHH (QWUHSUHQHXUVKLS&HUWLÀFDWH $GYDQFHG&HUWLÀFDWH 6PDOO%XVLQHVV0DQDJHPHQW &OHUN&HUWLÀFDWH (QWUHSUHQHXUVKLS'HJUHH &RPSXWHU$SSOLFDWLRQV&HUWLÀFDWH %XVLQHVV7HFKQRORJ\ $FFUHGLWDWLRQ $GPLQLVWUDWLRQ&ROOHJH $GPLQLVWUDWLRQRI-XVWLFH &$/*UDQWV $GPLQLVWUDWLRQRI-XVWLFH'HJUHH &DOLIRUQLD6WDWH8QLYHUVLW\ &68 7UDQVIHU5HTXLUHPHQWV $GPLQLVWUDWRU·V&RGHRI(WKLFV $GPLVVLRQ(OLJLELOLW\ &DO:25.V $'0,66,210$75,&8/$7,21$1'5(*,675$7,21 &$03860$36 $GYDQFHG(GXFDWLRQIRU+LJK6FKRRO6WXGHQWV &$03866$)(7<$1'6(&85,7< $GYDQFHG3ODFHPHQW7HVWV &DPSXV7UDIÀF5HJXODWLRQV $GYLVRULHV &$5( &RRSHUDWLYH$JHQFLHV5HVRXUFHVIRU(GXFDWLRQ $OFRKRODQG'UXJ3ROLF\ &DWDORJ5LJKWV $OOLHG+HDOWK &HUWLÀFDWH3URJUDPV $/7(51$7,9(&5(',7678'<237,216 &KDQJHRI$GGUHVV1DPH $PHULFDQ6WXGLHV'HJUHH &KHDWLQJ3ROLF\ $QWKURSRORJ\ &KHPLVWU\ $SSHDO2SWLRQ &ODVVLÀHG6WDII $SSOLFDWLRQ3URFHGXUHV &ODVVLÀHG6WDII&RGHRI(WKLFV $UFKLWHFWXUH &OHU\6WDWLVWLFV $UW &OXEV 2UJDQL]DWLRQV $UW+LVWRU\'HJUHH &RGHRI(WKLFV 'HVLJQ'HJUHH $GPLQLVWUDWRU·V 6WXGLR$UW'HJUHH &ODVVLÀHG6WDII $UW+LVWRU\ )DFXOW\ $VVHVVPHQW6HUYLFHV &2//(*($'0,1,675$7,21 $VVRFLDWHG6WXGHQW*RYHUQPHQW &2//(*($1'$&$'(0,&5(*8/$7,216 $662&,$7(6'(*5((*5$'8$7,215(48,5(0(176 &ROOHJH%RRNVWRUH $VVRFLDWHV'HJUHHVDQG&HUWLÀFDWHV &ROOHJH/HYHO([DPLQDWLRQ3URJUDP &/(3 $VWURQRP\ &ROOHJH3ROLFH $WWHQGDQFH &RPPHQFHPHQW([HUFLVHV $XGLWLQJ&RXUVHV &RPPXQLFDWLRQ6WXGLHV $SSOLHG&RPPXQLFDWLRQ6NLOOV&HUWLÀFDWH 2UJDQL]DWLRQDO&RPPXQLFDWLRQ'HJUHH Folsom Lake College 2011-2012 279 &RPPXQLFDWLRQV0HGLD )LOPDQG0HGLD6WXGLHV (DUO\&KLOGKRRG(GXFDWLRQ &RPPXQLW\(GXFDWLRQ $VVLVWDQW7HDFKHU&HUWLÀFDWH &RPSXWDWLRQV $VVRFLDWH7HDFKHU&HUWLÀFDWH *UDGH3RLQW$YHUDJH *3$ (DUO\&KLOGKRRG(GXFDWLRQ'HJUHH 3URJUHVV3HUFHQWDJH )DPLO\&KLOG&DUH&HUWLÀFDWH &RPSXWHU,QIRUPDWLRQ6FLHQFH ,QIDQW6SHFLDOLVW&HUWLÀFDWH &RPSXWHU3URJUDPPHU64/&HUWLÀFDWH 0DVWHU7HDFKHU&HUWLÀFDWH &RPSXWHU6FLHQFH'HJUHH 6FKRRO$JH6SHFLDOLVW&HUWLÀFDWH 'DWDEDVH$QDO\VW64/&HUWLÀFDWH 6LWH6XSHUYLVRU&HUWLÀFDWH 0,6$SSOLFDWLRQ'DWD(QWU\&HUWLÀFDWH 6LWH6XSHUYLVRU'HJUHH 0,6$SSOLFDWLRQ7HFKQLFLDQ&HUWLÀFDWH 7HDFKHU&HUWLÀFDWH 0,6,QIRUPDWLRQ3URFHVVLQJ&HUWLÀFDWH (FRQRPLFV 3URJUDPPLQJ&HUWLÀFDWH (GXFDWLRQ7HDFKLQJ 5HODWLRQDO'DWDEDVH$GPLQLVWUDWLRQ&HUWLÀFDWH /LEHUDO6WXGLHVIRU(OHPHQWDU\(GXF'HJUHH &RPSXWHU/DEV (O'RUDGR&HQWHU &RPSXWHU8VH3ROLF\ (O'RUDGR&HQWHU3DWURQ·V&OXE6FKRODUVKLS &RQVWUXFWLRQ0DQDJHPHQW7HFKQRORJ\ (PHUJHQF\0HGLFDO7HFKQRORJ\ &RQWLQXLQJ(GXFDWLRQ (PSOR\PHQW2SSRUWXQLWLHV &RQWUDFW(GXFDWLRQ&RQWUDFW7UDLQLQJ (QHUJ\ &RRSHUDWLYH$JHQFLHV5HVRXUFHVIRU(GXFDWLRQ &$5( (QJLQHHULQJ &RRSHUDWLYH &223 :RUN([SHULHQFH (QJOLVK &RS\ULJKWHG0DWHULDOV,OOHJDO'LVWULEXWLRQ (QJOLVK'HJUHH &RUHTXLVLWH (QJOLVK6HTXHQFH &RXQVHOLQJ (QJOLVKDVD6HFRQG/DQJXDJH (6/ &2856('(*5(( &(57,),&$7(2))(5,1*6 (6/6HTXHQFH &2856(180%(5,1*35(5(48,6,7(6 025( (QJOLVK&HQWHU('& &RXUVH5HSHWLWLRQ (QUROOPHQW)HHV &2856(62)678'<$1'35(),;(6 (QYLURQPHQWDO7HFKQRORJ\ &UHGLWE\([DPLQDWLRQ ([WHQGHG2SSRUWXQLW\3URJUDPVDQG6HUYLFHV (23 6 &UHGLWIRU0LOLWDU\6HUYLFH &ULPH6WDWLVWLFV &687UDQVIHU5HTXLUHPHQWV )DFXOW\6WDWHPHQWRI3URIHVVLRQDO(WKLFV )DFXOW\/LVWLQJV )DOOVHPHVWHUFDOHQGDULQVLGHIURQWFRYHU 'HDQV$FDGHPLF )DPLO\DQG&RQVXPHU6FLHQFH 'HEWV2ZHGWRWKH&ROOHJH )HGHUDO'LUHFW/RDQ3URJUDP 'HJUHH3URJUDPV )HGHUDO(GXFDWLRQ7D[&UHGLWV '(*5((6$1'&(57,),&$7(6 )HGHUDO)LQDQFLDO$LG 'HQLDORI)LQDQFLDO$LG )HGHUDO3HOO*UDQW 'LUHFW/RDQ3URJUDP )HGHUDO6XSSOHPHQWDO(GXFDWLRQDO2SSRUWXQLW\*UDQWV 'LVDELOLW\ )6(2* 'LVDEOHG6WXGHQW3URJUDPV 6HUYLFHV '63 6 )HGHUDO:RUN6WXG\3URJUDP 'LVFLSOLQH3URFHVV )HH5HIXQGV 'LVPLVVDO )((6 'LVWDQFH(GXFDWLRQ )LOLQJD*ULHYDQFH 'LVWULFW3ROLFH )LOPDQG0HGLD6WXGLHV 'LYHUVLW\(TXLW\&RPPLWPHQW )LQDO([DPLQDWLRQV 'URSV ),1$1&,$/$,' See Withdrawal from Class or the College )LUH7HFKQRORJ\ 'UXJDQG$OFRKRO3ROLF\ )LUH7HFKQRORJ\&HUWLÀFDWH )LUH7HFKQRORJ\'HJUHH 280 Folsom Lake College 2011-2012 )RUHLJQ/DQJXDJHV ,QGHSHQGHQW6WXG\ )UHQFK ,QVWUXFWLRQDO0DWHULDO)HHV 6SDQLVK ,QWHUGLVFLSOLQDU\6WXGLHV )RXQGDWLRQ $PHULFDQ6WXGLHV'HJUHH )RXQGDWLRQ6FKRODUVKLSV $UHDVRI(PSKDVLV'HJUHH )UHQFK +XPDQLWLHV'HJUHH :RPHQ·V6WXGLHV'HJUHH ,QWHUQDWLRQDO6WXGHQW$GPLVVLRQV *HQHUDO(GXFDWLRQ ,QWHUQDWLRQDO6WXGHQW&DSLWDO2XWOD\)HH *HQHUDO(GXFDWLRQ7UDQVIHU ,QWHUQHW8VH3ROLF\ &68*HQHUDO(GXFDWLRQ&HUWLÀFDWH ,QWHUVHJPHQWDO*HQHUDO(GXFDWLRQ7UDQVIHU&XUULFXOXP ,*(7&&HUWLÀFDWH ,*(7& *(1(5$/,1)250$7,21$1'27+(55(6285&(6 *HRJUDSK\ *HRORJ\ -HDQQH&OHU\'LVFORVXUH *HRORJ\'HJUHH -RXUQDOLVP *HURQWRORJ\ +XPDQ6HUYLFHV *RRG6WDQGLQJ *UDGH3RLQW$YHUDJH *3$ &RPSXWDWLRQ /HDUQLQJ'LVDELOLWLHV *UDGHVDQG*UDGH3RLQW$YHUDJHV /HDYHRI$EVHQFH *UDGXDWLRQ$SSO\)RU /,%5$5,(6 *5$'8$7,215(48,5(0(176 /LEUDU\FRXUVHV *UDQWV /LIHWLPH/HDUQLQJ&UHGLW *UDSKLF&RPPXQLFDWLRQ /RDQV :HE*UDSKLFV3URGXFWLRQ&HUWLÀFDWH /RV5LRV&RPPXQLW\&ROOHJH'LVWULFW /5&&' *UHDWHU6DFUDPHQWR6PDOO%XVLQHVV'HYHORSPHQW&HQWHU *ULHYDQFH3ROLF\6WXGHQW *XDUDQWHHG$GPLVVLRQZLWK)RXU 1DWXUDO5HVRXUFHV ,*(7& ,QWHUVHJPHQWDO*HQHUDO(GXFDWLRQ7UDQVIHU 1RQ'LVFULPLQDWLRQ3ROLF\ &XUULFXOXP 1RQ3URÀW0DQDJHPHQW ,QFRPSOHWH*UDGLQJ 1RQ3URÀW0DQDJHPHQW&HUWLÀFDWH ,QGHSHQGHQW&DOLIRUQLD&ROOHJHDQG8QLYHUVLWLHV 1RQ5HVLGHQW6WXGHQW 7UDQVIHU5HTXLUHPHQWV 1RQ5HVLGHQW7XLWLRQ Folsom Lake College 2011-2012 281 1RUWK)DU1RUWK5HJLRQDO(QYLURQPHQWDO%XVLQHVV 5DQFKR&RUGRYD&HQWHU 5HVRXUFHDQG$VVLVWDQFH&HQWHU 1)15(%5$& 5HDGLQJ:ULWLQJDQG0DWK&HQWHU)/& 1R6PRNLQJ3ROLF\ 5HDO(VWDWH 1XWULWLRQDQG)RRGV 5HDO(VWDWH%URNHU&HUWLÀFDWH 5HDO(VWDWH'HJUHH 5HDO(VWDWH6DOHV&HUWLÀFDWH 2QOLQH(GXFDWLRQ 5HIXQG3ROLF\ 2UJDQL]DWLRQDO&RPPXQLFDWLRQ'HJUHH 5HJLVWUDWLRQ 5HJLVWUDWLRQ6WHSVIRU6WXGHQWV 5HPRYDOIURP3UREDWLRQ 3DUNLQJ)HHV 5HSRUWLQJ6H[XDO$VVDXOW 3DVV1R3DVV*UDGLQJ 5HTXLUHPHQWVIRU)HGHUDO6WDWH)LQDQFLDO$LG 3HOO*UDQW 5HVLGHQF\5HTXLUHPHQWVIRU$GPLVVLRQ 3KLORVRSK\ 3KL7KHWD.DSSD 3KRQH1XPEHUVLQVLGHIURQWFRYHU 6DIHW\$ZDUHQHVVDQG&ULPH3UHYHQWLRQ 3KRWRJUDSK\ 6DIHW\(GXFDWLRQ 3K\VLFDODQG3V\FKRORJLFDO'LVDELOLWLHV 6FKHGXOHRI)HHV 3K\VLFDO(GXFDWLRQ 6FKRODUVKLSV $'$37$GDSWHG3(&RXUVHV 6FLHQFH '$1&('DQFH&RXUVHV 3UH3URIHVVLRQDO+HDOWK6FLHQFH(GXFDWLRQ ),716)LWQHVV&RXUVHV 6H[XDO+DUDVVPHQW3ROLF\ *URXS)LWQHVV,QVWUXFWRU&HUWLÀFDWH 6LJQ/DQJXDJH6WXGLHV .,1(6.LQHVLRORJ\&RXUVHV 6PRNLQJ3ROLF\ 3$&73HUVRQDO$FWLYLW\&RXUVHV 6RFLRORJ\ 3HUVRQDO7UDLQHU&HUWLÀFDWH 6SDQLVK 632576SRUWV&RXUVHV 6SULQJVHPHVWHUFDOHQGDULQVLGHIURQWFRYHU 3K\VLFDO6FLHQFH 6WDII 3K\VLFV 6WDWH)LQDQFLDO$LG 3ODJLDULVP3ROLF\ 6WDWHPHQWRI3ULQFLSOHVRQ$FDGHPLF)UHHGRP 3ROLFH&ROOHJH 6WDWLVWLFV 32/,&,(6217+(5,*+762),1',9,'8$/6 6WXGHQW$FDGHPLF5LJKWV 3ROLWLFDO6FLHQFH 6WXGHQW$FFHVV 3UH/DZ(GXFDWLRQ 678'(17$&&(66&$5' 3UH3URIHVVLRQDO+HDOWK6FLHQFH(GXFDWLRQ 6WXGHQW&RQGXFW6WDQGDUGV 3UH'HQWDO 678'(17'(9(/230(17352*5$06 3UH0HGLFDO $1'6(59,&(6 3UH1XUVLQJ 6WXGHQW*RYHUQPHQW 3UH2SWRPHWU\ 6WXGHQW*ULHYDQFH3ROLF\ 3UH3K\VLFDO7KHUDS\ 6WXGHQW5HSUHVHQWDWLRQ)HH 3UH9HWHULQDU\ 6WXGHQW5LJKWWR.QRZ3URJUDP&RPSOHWLRQ 3UHUHTXLVLWH&KDOOHQJH3URFHGXUH)RU6WXGHQWV 678'(175,*+76$1'5(63216,%,/,7,(6 3UHUHTXLVLWHV 6WXG\$EURDG3URJUDPV 3ULYDWH&ROOHJHV7UDQVIHU5HTXLUHPHQWV 6XPPHUVHVVLRQFDOHQGDULQVLGHIURQWFRYHU 3UREDWLRQ 3URJUHVV'LVPLVVDO 3URJUHVV3UREDWLRQ 7$%/(2)&217(176 3URMHFW0DQDJHPHQW 7HDFKLQJ 3URMHFW0DQDJHPHQW&HUWLÀFDWH 7HOHYLVHG,QVWUXFWLRQ 3V\FKRORJ\ 7KHDWUH$UWV 3V\FKRORJ\'HJUHH 7LWOH,; 3XEOLFDWLRQV:HEVLWH 7UDQVFULSWV)/& 3XEOLF0DQDJHPHQW 7UDQVFULSWVIURPRWKHU&ROOHJHV 3XEOLF0DQDJHPHQW&HUWLÀFDWH 75$16)(5,1)250$7,21 282 Folsom Lake College 2011-2012 7UDQVLWLRQ&HQWHU6HUYLFHV 7XWRULDO6HUYLFHV 8QLW/LPLWDWLRQ 8QLWRI&UHGLW 8QLYHUVDO7UDQVLW3DVV 873 IHH 8QLYHUVLW\RI&DOLIRUQLD 8& 7UDQVIHU5HTXLUHPHQWV 8VHDQG5HOHDVHRI6WXGHQW,QIRUPDWLRQ 9DOHGLFWRULDQV 9DOXHV/5&&' 9HWHUDQV(GXFDWLRQDO%HQHÀWV 9LVLRQ6WDWHPHQW)/& 9LWLFXOWXUH :DVWH:DWHU0DQDJHPHQW :DVWH:DWHU0DQDJHPHQW&HUWLÀFDWH :DWHU0DQDJHPHQW :DWHU0DQDJHPHQW&HUWLÀFDWH :LWKGUDZDOIURP&ODVVRUWKH&ROOHJH :RPHQ·V6WXGLHV :RUN([SHULHQFH Folsom Lake College 2011-2012 283 T e El Dorado Center 284 Folsom Lake College 2011-2012 T e Ranc o Cordova Center Folsom Lake College 2011-2012 285 Main olso Ca us Site Ma 286 Folsom Lake College 2011-2012 Main olso Ca us Classroo s Folsom Lake College 2011-2012 287 288 Folsom Lake College 2011-2012 FOLSOM LAKE COLLEGE 10 College Parkway | Folsom, CA 95630-6798 (916) 608-6500 EL DORADO CENTER 6699 Campus Drive | Placerville, CA 95667-7744 (530) 642-5644 RANCHO CORDOVA CENTER 10378 Rockingham Drive | Sacramento, CA 95827-2502 (916) 255-0717 ǯĚǯǯ Los Rios Community College District www.flc.losrios.edu Los Rios Community College District