ELK4 antibody - C-terminal region (ARP34379_T100) Data Sheet
Product Number ARP34379_T100 Product Name ELK4 antibody - C-terminal region (ARP34379_T100) Size 100ug Gene Symbol ELK4 Alias Symbols SAP1 Nucleotide Accession# NM_001973 Protein Size (# AA) 431 amino acids Molecular Weight 47kDa Product Format Lyophilized powder NCBI Gene Id 2005 Host Rabbit Clonality Polyclonal Official Gene Full Name ELK4, ETS-domain protein (SRF accessory protein 1) This is a rabbit polyclonal antibody against ELK4. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: PVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT Target Reference Mo,Y., et al., (2001) J. Mol. Biol. 314 (3), 495-506 The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) Description of Target subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8. IKBKB, MCC, RELA, RELA, BTRC, CD3EAP, CHUK, CUL1, IKBKB, IKBKG, KPNA2, LRPPRC, MCC, MTIF2, Partner Proteins NFKB1, NFKB2, NFKBIA, NGFR, NKIRAS1, NKIRAS2, PDCD2, POLR1A, POLR1B, POLR1C, POLR1D, POLR1E, POLR2H, POLR2L, RASAL2, REL, RELA, RXRA, SKP1, BTRC, CHUK, IKBKB, NKIRAS1, REL, RELA, RXRA, Thrb Reconstitution and Add 100 ul of distilled water. Final anti-ELK4 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-ELK4 antibody is Catalog # AAP34379 (Previous Catalog # AAPY00221) Immunogen The immunogen for anti-ELK4 antibody: synthetic peptide directed towards the C terminal of human ELK4 Swissprot Id P28324 Protein Name ETS domain-containing protein Elk-4 Protein Accession # NP_001964 Purification Protein A purified Species Reactivity Pig, Bovine, Rat, Mouse, Horse, Human, Dog, Rabbit, Guinea pig Application WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93% Sequence
Human Jurkat WB Suggested Anti-ELK4 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate
Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.