RaTHE bbiter RaTHE bbiter Issue 276 November 2020
All the regular features plus • PUB MANAGER WINS AWARD • NEW PLAYERS WANTED • BOROUGH COUNCIL HAVE YOUR SAY and much more The Community Newsletter for Hatch Warren, Beggarwood and Kempshott Park /RRNLQJIRUDWUXVWHG ORFDOEXVLQHVVIRU\RXU QH[WKRPHSURMHFW"
:LQGRZV 'RRUV &RQVHUYDWRULHV 2UDQJHULHV *DUDJH'RRUV *XDUDQWHHG:RUN *UHDW3ULFHV )LQDQFH$YDLODEOH
&DOOULSWRQZLQGRZVFRXN
LQ J V W R D V N H % ï ï ï ï ï :K\QRWYLVLWRXUVKRZURRPLQ&KLQHKDP" ï ï ï :HKDYHORWVRIH[DPSOHFRQVHUYDWRULHVZLQGRZVDQG GRRUVZLWKIUHHSDUNLQJDQGDGHFHQWFXSSD
4XRWHç5$%%,7(5èIRUDSUHIHUHQWLDOTXRWH Printed on recycled or sustainably sourced paper using ecoprint-system4 by Greenhouse Graphics. Hampshire’s only EMAS accredited print center.
5DEELWHU$GYHUW5LSWRQ:LQGRZVLQGG The Rabbiter - November 2020
THE EDITORIAL As the clocks change so our memories of summer 2020 might fade. It has been Rabbiter an unusual year and it looks as if winter will continue the changes. Sadly the annual INSIDE THIS ISSUE fireworks display has been cancelled. However, the Café in the Park has now opened 6 THETH NEWE BEGGARWOOD SURGERY its doors and prebooked tables are available (see page 18 for details). Christmas is 7 COUNCIL NEWS lurking on the horizon and whilst many events have now moved online it is good Rabbiter PORTSMOUTH ARMS to see that the Christmas Fair at the Community Centre will take place on 22 November. The weekly Saturday market at the Portsmouth Arms is a great success BEGGARWOOD WOODLAND PARK – see page 23 for more details. 8 COUNCILLOR’S UPDATE The Rabbiter would like to congratulate Richard Curtis, General Manager of the BASINGSTOKE VOLUNTARY ACTION Portsmouth Arms, for becoming the Charity Champion in the 2020 Great British 10 PHILLIPS SOLICITORS Pub Awards – see page 7 – a truly amazing achievement. BEGGARWOOD BOOKWORMS The proposed development at Junction 7 of a distribution centre continues to be NEW PLAYERS WANTED of great concern (see page 21). It is believed that Amazon will have a base on the MILE STONES site. Whilst many of us have been very grateful for the online service provided by 12 SAINSBURY’S this company during the current crisis, there is considerable concern on the impact RESTAURANT REVIEW of traffic on our already overcrowded roads. With building now starting on the LETTER TO THE EDITOR Hounsome Fields development more and more traffic will be using the A30 which is already struggling to cope with the number of cars and lorries heading to and 14 BASINGSTOKE - OLD BASING U3A from Junction 7. And there are another 1,000 homes planned for the Golf Course PROBUS HEARS ABOUT AN site – more traffic! UNUSUAL HOBBY Welcome to the new doctor at Beggarwood Surgery – see page 6. It is good to read 16 CHILDREN’S CORNER that the surgery is now going from strength to strength. 17 BASINGSTOKE ROTARY Reading through this month’s Rabbiter is rewarding to see so much local news. 18 COMMUNITY CENTRE Beggarwood Bookworms are now meeting via Zoom to discuss the books they are 19 THE WARREN reading – see page 10. The next meeting is on 4 November – see their facebook 20 OLD DOWN AND BEGGARWOOD page for how to join in. The Hatch Warren W.I. also meet regularly via Zoom – see WILDLIFE GROUP page 23. 21 CAGE CAMPAIGN There have been a number of car thefts locally in the last few months and there is SPIRITUALLY SPEAKING advice on what you can do to keep your car safe – see page 23. There is also advice 22 RABBITER CONTACTS regarding recent scams. 23 SATURDAY MARKET AT If you have spent time in the last few months decluttering your house, you can PORTSMOUTH ARMS advertise your unwanted goods in the Rabbiter for free – email to newsdesk@ HATCH WARREN W.I. therabbiter.biz. We recently managed to book a slot at the Basingstoke ‘tip’. It is 24 CLASSIFIED ADS understood that booking a slot at Winchester, Alton or Andover is often quicker than CRIME PREVENTION waiting for an appointment at Wade Road. 25 FREEADS Currently RG22 is a Medium Risk Covid-19 area. Please follow the rules and stay safe 26 HATCH WARREN RUNNERS so that our risk level doesn’t rise.
The Editor Printed by Greenhouse Graphics Ltd www.greenhousegraphics.co.uk
• Heating installations • Breakdowns • Boiler changes/upgrades • Landlord Safety Checks • Servicing • Power flushing • LPG Gas installation/service • Water softeners
Call Jamie Davenport 24hr - 7 Days a Week Tel No: 01256 398611 Mobile No: 07876 687422 212273 An established, family run local business with 20 years’ experience
3 All Seasons Window Cleaning Reliably serving the Hatchwarren / Beggarwood community for over 20 years Additional services include: • Driveway cleaning • • Cladding/signage cleaning • • Gutter/fascia/soffit cleaning • • Conservatory roof cleaning • • Pure water - no chemicals •
Call STEVE on 01256 353727
Email: [email protected] Web: www.allseasonswindowcleaning.com www.facebook.com/allseasonswindowcleaninguk
6KRZHUKHDGV /RFDOWR+DWFK:DUUHQDQG.HPSVKRWW FRQVWDQWO\QHHG )('83:,7+ GHVFDOLQJRWKHUZLVH ZDWHUIORZZLOOEH FRPSURPLVHG SOUTHERN +$5':$7(5 WINDOW ,1<285+20(" 7KH\ZLOOVSUD\ OLNHQHZ INSTALLATIONS 7KH3HUIHFW6ROXWLRQ
6FDOHGHSRVLWVZLOO :LQGRZ 'RRU6SHFLDOLVW IRUPRQWDSV $7ZLQ7HF %L)ROG'RRUVá&RPSRVLWH)URQW'RRUV 1RFUXVW\VFDOH :DWHU6RIWHQHU GHSRVLWVRQWDSV² RQO\DTXLFNZLSH QHHGHGWRNHHS WKHPVSDUNOLQJ
7RSFODVVVHUYLFHDQGZRUNPDQVKLS YHU\LPSUHVVLYH 0U73KLOOLSV)DUQERURXJK¶¶ ´7KHVHUYLFHZHUHFHLYHGZDVH[FHOOHQW WKHSOXPEHUH[SODLQHGHYHU\WKLQJDQG LWZDVHDV\WRXQGHUVWDQG.HYLQUXQVD YHU\SURIHVVLRQDOFRPSDQ\µ :LGH5DQJHá6XSHULRU4XDOLW\á/RZ3ULFHV 0UV$[IRUG%DVLQJVWRNH :LQGRZVá&RQVHUYDWRULHVá5HSDLUV 3URXGPHPEHUVRI :HDUHDORFDOIDPLO\UXQEXVLQHVVRIIHULQJNQRZOHGJHDQG H[SHUWLVHZLWKDIULHQGO\DSSURDFK
Where reputation matters
Covering Hatch Warren, Beggarwood and surrounding areas .HYLQ*RRG\ $XWKRULVHG á 7HO_0RE 7ZLQ7HF'HDOHU NJRRG\#XNZDWHUVRIWHQHUVFRXN_ZZZXNZDWHUVRIWHQHUVFRXN ZZZVRXWKHUQZLQGRZLQVWDOODWLRQVFRXN
4 &KHIWUDLQHGDWWKHSUHVWLJLRXV/HLWK V6FKRRORI)RRGDQG:LQHQRZZRUNLQJORFDOO\ (YHQWFDWHULQJ IRUGLQQHUSDUWLHVELUWKGD\VFDQDS«VFRUSRUDWHOXQFKHVIXQHUDOVDQGPRUH FRQQLH#FDOLFRIRRGFRXN__FDOLFRIRRGFRXN
WŽĐƚŽƌ;,ĂŵƉƐŚŝƌĞͿ>ƚĚ ŶĚLJWĞĂƌĐĞϬϭϮϱϲϴϰϭϮϬϰ ,ŽŵĞΘ^ŵĂůůƵƐŝŶĞƐƐW͛ƐΘƉƌŝŶƚĞƌƐƐƵƉƉůŝĞĚ͘ WƌĞƉĂŝƌƐΘƵƉŐƌĂĚĞƐ͕>ĂƉƚŽƉƐΘĞƐŬƚŽƉƐ͘tŝƌĞůĞƐƐ ŶĞƚǁŽƌŬŝŶŐ͘sŝƌƵƐΘDĂůǁĂƌĞƌĞŵŽǀĂů͘EĞǁWΘdĂďůĞƚ ƐĞƚƵƉ͘ĂƚĂΘŵĂŝůƚƌĂŶƐĨĞƌĨƌŽŵŽůĚƐLJƐƚĞŵ͘ ƉĐĚŽĐ͘ŚĂŵƉƐŚŝƌĞΛďƟŶƚĞƌŶĞƚ͘ĐŽŵ
,#,#-3$-3$// /)-*21(-,0 -+.21$//-!*$+0-+.21$//-!*$+0 /($,#*6./-%$00(-,/($,#*6./-%$00(-, *0$/3("$0%-/!20(,$00*0$/3("$0%-/!20(,$00 ,#'-+$,#'-+$
..*$(..*$( #0$12. 1/#0$12. 1/ (,(,&(,(,& "02..-/1(/20/$+-3-3 *+*+ (*(* -+.21$/.$/%-/+-+.21$/.$/%-/+ ,"$(002$0(/$*$00,1$/,$1,"$(002$0(/$*$00,1$/,$1/-/- #!#! ,#,# /#/#44 /$/$-%14-%14 /$,01/$,01 **** 1(-,20(,$000-*21(-,0 02..-/11(-,20(,$000-*21(-,0 02..-/1
1$1$3$3$//-1'-"-1'-" *./-%$00(-,*./-%$00(-, * 6/0$5.$/($,"$ $$** -/-/02..-/1"02..-/1" ,#-3$/. /)/)0-*21(-,0"-2)0-*21(-,0"-2)
5 The Rabbiter - November 2020
THE NEW BEGGARWOOD SURGERY Karen Blackhall – Practice Manager Dr K Oshigo – Clinical Lead Felicity Greene – NHUC Executive Chris Stark – Director of Nursing It has now been one year since the practice was taken over by North Hants Urgent Care (NHUC) our new NHS partner! Great strides have taken place over this time with 3 new full time doctors being recruited, the last one, Dr Chesters, appointed just over a month ago. A brief Bio of Dr Chesters is attached below. The reception and backroom team seemed to have embraced all of the changes initiated by NHUC and from our PPG perspective and other reports it seems a much happier place to work and indeed to visit. We also know that Karen and the rest of the team are not just content to sit back and rest on their laurels and that we can expect further new initiatives and improvements from the practice. Obviously, a major challenge this year has been the Covid-19 pandemic for not just the practice but Hampshire and the rest of the country. Keeping patients and staff safe has been a major responsibility as well as continuing to offer patients access to the doctors and services required. The introduction of telephone triage calls has helped with this as well as being able to order repeat prescriptions online and video consultations. I know we would all like things to get back to “normal” (whatever that is!) but 01256 688648 patience and understanding is required from us all during these difficult times. The Winter ‘flu season is now upon us and the surgery will be contacting patients eligible for vaccination in the normal way either via text, email or telephone and we are assured that the :HOOHU0DFNULOO practice has adequate stocks of this year’s vaccine. &KDUWHUHG&HUWLILHG$FFRXQWDQWV Introducing our new GP - Dr Chesters DQG7D[$GYLVHUV Dr Chesters studied at the Faculty of Medicine in Leiden, the Netherlands and did her GP training in East Anglia. She has worked both worked as a freelance GP in Hampshire and has significant $FFRXQWV 7D[ 9$75HWXUQV experience as GP working for the Out Of Hours service. She has 3$<( &,6 also worked for Macmillan Cancer Support and Cancer Research &RPSDQ\IRUPDWLRQV UK for a number of years. She currently works for the research ,5DGYLFH unit of Southampton University to promote research in the early 7D[SODQQLQJ )UHHLQLWLDOFRQVXOWDWLRQ detection of cancer. Dr Chesters enjoys hiking, mountains, community building and :HOOHU0DFNULOO6RXWK%XLOGLQJ being outdoors. 8SSHU)DUP:RRWWRQ6W/DZUHQFH%DVLQJVWRNH 5*3( Lastly, for updated information on the Coronavirus situation please go to www.nhs.uk )RUDIULHQGO\DQGVHQVLEO\SULFHGVHUYLFH 3OHDVHULQJ Broadmere Road, Beggarwood, RG22 4AQ 01256 396500 www.beggarwoodsurgery.co.uk [email protected] (PDLO This update is compiled by the Members of the Beggarwood Surgery SDXOXO#ZHOOHUPDFNULOOFRXN Patient Participation Group. The Group (PPG) is open to all patients of the MDPHV#ZHOOHUPDFNULOOFRXN Beggarwood Surgery. If you would like to join us please either give your contact details to one of the Reception staff at the surgery, or fill in the online form on the surgery website. We welcome all new members.
6 The Rabbiter - November 2020
COUNCIL NEWS property portfolio to a renewable energy supply and supporting town and parish councils to work in their areas. Help shape how the borough should be developed in the Cabinet Member for Environment and Enforcement Cllr Hayley future Eachus said: “Climate change remains a huge threat around the Residents, businesses, organisations and local interest groups are world and air quality issues can damage our health. This has a among those being encouraged to have their say on how the significant impact on everybody who lives and works in the borough should be developed over the next 20 years. borough. Basingstoke and Deane Borough Council is updating its Local “Therefore, we must take action now together to tackle these Plan which sets out where different types of future development issues locally to create a healthier place to live and work and to will take place, including new homes, business space and help tackle social issues such as fuel poverty. community facilities. “The council has an important role to play in reducing climate In May 2019 councillors agreed to start the process of updating emissions and enabling and inspiring people in the borough to the local plan, in line with national requirements to review plans work together to achieve the ambitious carbon goals set out a every five years. This important planning document considers the year ago. We are really keen for people to read this strategy and borough’s changing needs and sets out how these will be met. share their views as everyone needs to play their part and work While the current plan has performed well against targets this is together to achieve the borough’s carbon neutral goals.” an opportunity to strengthen the plan in a number of key areas To read the full draft strategy and have your say visit www. including tackling the climate emergency, creating places which basingstoke.gov.uk/climate-consultation Alternatively, call 01256 protect and enhance biodiversity where people live and ensuring 844844 to request the survey in a paper version or different the right infrastructure is in place to support new homes. The new readable format. plan will cover the period up to at least 2038. People have until Monday 9 November 2020 to have their say on the key issues identified by the council and the possible options PORTSMOUTH ARMS CROWNED for addressing them during a six week consultation. CHARITY CHAMPION IN GREAT Cabinet Member for Planning, Infrastructure and the Natural BRITISH PUB AWARDS Environment Cllr Mark Ruffell said: “It is important that, even at Richard Curtis, General Manager of the Portsmouth Arms in this very early stage of updating the local plan, people who live Basingstoke, has won the Charity Champion accolade at the and work in the borough give their thoughts on the important 2020 Great British Pub Awards. issues we need to consider when deciding how it is developed The win comes after Richard raised nearly £50,000 for local in the future. We need a strong framework in place that protects causes during the nationwide lockdown, by hosting daily our borough and its environment from random development and virtual pub quizzes. creates the kind of place we want this to be. During this time, Richard also broke the Guinness World “I encourage everyone to take the time to look through the issues Record for the world’s longest marathon as a quiz master. The and options we have identified and to put forward their views to quiz ran for a record-breaking 34 hours and 11 minutes online. help shape how the borough should be developed over the next 20 years.” Commenting on his award win, Richard said: “To be recognised on a national scale for my charity fundraising, is something People can view the key issues and comment on possible options which I am really proud of. I am grateful to have the support for addressing them at www.basingstoke.gov.uk/Issues-and- of my whole community, they have been behind me every Options Paper copies can also be sent by calling 01256 844844. step of the way. Without the backing of the community, as well as my friends, family and team, I wouldn’t have been able to Have your say on borough’s climate change goals turn our temporary closure during lockdown, into something Residents, local businesses, interest groups and organisations have so positive.” an opportunity to give their views on local action plans to tackle climate change and air quality issues. The Portsmouth Arms is part of the Hall & Woodhouse family, an independent family company that brews award-winning From Monday 5 October up to Sunday 15 November, Basingstoke Badger ales and runs a collection of around 180 beautiful and Deane Borough Council is asking people to have their say on pubs and inns across the south of England. the council’s draft plan to make Basingstoke and Deane carbon neutral by 2030. The Climate Change and Air Quality Strategy has been produced BEGGARWOOD WOODLAND PARK in response to the council’s Climate Emergency Declaration and I am proud to announce the massive improvements of Beggarwood sets out how the council can lead, enable and inspire others to woodland park. The children play park being extended. The maze help achieve its targets. being replace with several activities. The bike area being enhanced. The draft strategy will set the agenda for the next 10 years, The footpaths within the park being resurfaced. with clear goals focussing on six key areas: action by all; buildings; I do regret that because of Covid-19 the works were held up for transport; zero carbon electricity; waste and consumption; and the so long. natural environment. I am pleased that the works are progressing now. Let’s hope that it It sets out where the council can make changes, where it can help will be completed for Christmas and we can all enjoy the delights others to make changes and where it can encourage and inspire of the Park fully next summer. change. I would welcome for all our residents of Hatch Warren and Since the Climate Emergency was declared in 2019 progress has Beggarwood to stay safe and healthy. included: holding a climate emergency summit; making climate change at the heart of all decision making; carrying out work HANDS-FACE-SPACE to install an EV charging hub; choosing to switch the council’s Cllr Dan Putty JP.
7 The Rabbiter - November 2020
COUNCILLOR’S BEGGARWOOD LANE near the Holly I have responded, arguing that the UPDATE Blue had not been resolved at the Council should complete its strategy time of writing. The County Council’s document for the South West of The schools have gone back and Highways department has told me that Basingstoke before making a decision generally everything has run smoothly, they suspect an overflow pipe from that might compromise it. I am also albeit with some careful work from the a soakaway on the development site. concerned that if the favoured site for teaching and support staffs. One knock- There appears to be a channel that has the hospital is across the A30 (and it is on effect has been that the timings of been worn in the bank down to the an ‘if’ – the Hospital Trust has not said lorries to and from the ANAEROBIC road. The HCC Officers are seeking a anything), the two developments could DIGESTER need to be reviewed. With meeting with the developers but so far prove to be incompatible in terms of schools now having staggered start and two attempts have proved unsuccessful. traffic generation. stop times, the previously-agreed ‘no- TRAFFIC RESTRICTIONS are now in go’ restrictions no longer match the I attended a meeting that discussed place on the A30 leading to the M3. The movements of the pupils. One of the TRAFFIC OPTIONS for Basingstoke, Hounsome Fields side of the road looks Liaison panel members is discussing the going forward. It was a conceptual very bare as trees have been removed new situation with the operators to see discussion rather than something to make way for the new roundabout. if anything can be done. concrete, but I came away concerned The work is scheduled to last a year. Work is continuing apace on the that infrastructure improvements being In a very high profile decision, the Borough improvements to the play area at considered for this side of the town Council has turned down development BEGGARWOOD PARK and is expected appear to be less inadequate for the plans for the Camrose ground. This to complete this month (November). amount of development being discussed. complicates the scheme for improving On a lighter note, I am delighted to see The Borough Council is investing over the BRIGHTON HILL ROUNDABOUT that the Beggarwood CAFÉ IN THE PARK £250,000 on this along with new with a link road through the site. There is has re-introduced indoor service on the benches, bins and improved footpaths. no indication yet as to how this issue will days it is open (please book in advance A new eco-friendly wild zone is resolve: the owners of the ground may and consult the website for details). replacing the old timber maze, designed appeal against the decision. to encourage children to explore the The PORTSMOUTH ARMS has been A full planning application has now natural world. The BMX facility will also been submitted for the DISTRIBUTION a tower of strength to our community be usable by skateboarders. DEPOT at Oakdown Farm. One of during the lockdown and its new One hiccup on the way is that some of the plans indicates that the eventual Saturday craft markets have been very the new INFORMATION BOARDS in user will be Amazon, as many people well received. It is now introducing Beggarwood Park were installed in the had suspected. This full application has breakfasts. wrong places. The Borough Council is come in before the outline permission Stephen Reid aware and the error is being corrected. has been considered, indicating that the County Councillor. The situation with FLOODING OF applicants intend to progress quickly. Basingstoke South West 07976 310206
BASINGSTOKE DBS checking service to the community we supported our members and the VOLUNTARY ACTION and voluntary sector! work of the community hubs. Annual General Meeting... Hampshire County Council BDDF Survey... Helpline... Keep an Eye Out! Have Your Say! Changes Are Being Made! In line with other charities this year, we Hantshelp4vulnerable phoneline name Basingstoke & District Disability Forum will be holding a virtual AGM. Members is changing to ‘Hampshire Coronavirus – the local charity for our disabled will receive an email during October with Support and Helpline’. The new name community is seeking the views of their our digital AGM pack. This will include reflects that the helpline has broadened members and from the wider disabled a video from our trustees, our annual its purpose since the initial launch during community to understand the impact of report & resolutions for our members lockdown. to vote on. If any of your contact details the last lock down. have changed, please let us know. Covid-19 Impact Report... The Orchard, White Hart Lane, What impact did covid-19 have on the Basingstoke, Hampshire RG21 4AF Volunteers Are Go... community? www.bvaction.org.uk Platform Reopened! Since March we have focused all our [email protected] The North Hampshire volunteering energies in to supporting organisations platform has reopened following the and community hubs right across the long pause due to covid. See website for borough. BVA have produced a covid-19 details. BVA also offer a comprehensive impact report, including more on how
8 )RHSWGST]7IVZMGIW
3YV.EKEGGVIHMXIH)RHSWGST]7YMXIMWVIGSKRMWIHJSV HIPMZIVMRKLMKLUYEPMX]WEJIERHIJJIGXMZIGEVIXSTEXMIRXW 4EXMIRXWEVIXVIEXIHF]ERIX[SVOSJWTIGMEPMWX GSRWYPXERXWMRGPYHMRKKEWXVSIRXIVSPSKMWXWGSPSVIGXEP WYVKISRWKIRIVEPWYVKISRWYVSPSKMWXWERHERYVWMRK XIEQ;ITVSZMHII\GITXMSREPPIZIPWSJTEXMIRXGEVI ERHWYTTSVXXSXLIMVJEQMPMIW
&1-8LI,EQTWLMVI'PMRMG IRHSWGST]YRMXMWEGGVIHMXIHF]
1/8437
BB0.7326B(QGVFRS\B+$0B$LQGG The Rabbiter - November 2020
Dealing with a divorce is never easy but Elizabeth down what you can recall about the financial Ford, a family law solicitor and mediator at Phillips arrangements during the marriage. Solicitors offers six tips to help make the process 4. Keep communicating with each other as smooth and amicable as possible. This will be a very difficult time but maintaining 1. Try relationship counselling open channels for communication can make Consider Relationship Counselling to see if there planning your futures much easier. Make a SIX TIPS WHEN is anything you can do to make your relationship written note of what you have talked about to CONSIDERING work, as after all, starting divorce proceedings or remind you both. entering into a separation agreement is a life- 5. Mediation is often helpful DIVORCE changing decision which should not be made quickly. For many people, mediation is a quicker and 2. Get legal advice cheaper option for resolving family difficulties about children or finances than going to court. It is important to have a full understanding of It empowers separating couples to make their your legal rights and responsibilities. Having an own decisions together. idea of what the divorce process involves will help you feel much more in control and less anxious. We can refer you to a local mediation service or Write a list of questions to take to your first you can choose to come directly to Haymarket appointment; no question is trivial or irrelevant. Family Mediation, which is part of Phillips 3. Gather your financial information Solicitors instead if you prefer. You and your spouse will need to share financial 6. Update your personal details information with each other. If possible, work You should check to see whether you are together to gather details about your income, making the right claims for benefits including property valuations, mortgages, savings, pensions Child Benefit, the council tax reduction if you are and debts. If you cannot do this together, write living separately and Universal Credit.
If you are considering divorce, please contact Elizabeth by emailing elizabeth.ford@phillips-law. Elizabeth Ford co.uk or by calling 01256 854628. Alternatively visit www.phillips-law.co.uk/family
NEW PLAYERS WANTED The Successful Hatch Warren Phoenix Heat, twice finalist in cups competition, are starting the recruitment drive for the 2020/21 season for our U12s (children SEPTEMBER ZOOM Whilst Queenie didn’t appeal to moving Year 7 in September 2020) whilst MEETING everyone we all agreed we loved ‘Where we also continue to build for 11-a-side the Crawdads Sing’ by Delia Owens. The football in 2021/22. The team has great The focus of our September meeting plot was intriguing with a real surprise spirit, friendship, hardworking and above all was ‘Queenie’ by Candice Carty- ending and the descriptions of the fun training and playing games. Williams. Although this novel has natural world were charming. been described as an updated Please get in contact with us via heat@ A highly recommended read. Bridget Jones being a description hatchwarrenphoenix.co.uk and we will of a young woman navigating October’s read is ‘The Farm’ arrange a time to discuss everything in her way through the world that by Joanne Ramos. This will more detail with you and arrange a trial. is where the similarities end. challenge thinking about All coaches are FA qualified and fully DBS Queenie is a twenty five year motherhood and money. Read checked. old a Jamaican girl living a chaotic along with us ! life in London. She deals with many issues in her life including MILE STONES a devastating break up with her Hello. My son and I have cleaned the partner, mental breakdown, beautiful Mile stone by the entrance harassment in the workplace to Basingstoke golf course. I do hope and discrimination. This book its preservation has been considered certainly took us to places by the council with all the housing unfamiliar to us and we found developments starting there. Next the story thought provoking and we will clean the one near Kempstott revealing. roundabout. David Hawkins
10 +/$(",$(",-)% !)+)/ + +,
(2- ',$(,-)%!)+ ,- + &$/ +2 !,294220 ",)2/(!6&6-211(28)4 ( &./):&5-1+562.) ")/ .", ).+,$3 &0 30% %!$!% !"# %&0 30 (" )! ,,)+$ ,( ( 0 && +2 9992&./):*741-5,-1+'27. +$-$,#' ,%)(#)0 + &$/ +2**+)10 %
&DOOXVRQ
$WUXO\ORFDOFRPSDQ\LPSURYLQJWKHTXDOLW\RI WKHZDWHULQWKLVDUHDIRURYHU\HDUV
7KLVLVDYHU\KDUGZDWHUDUHDVR\RX¶OONQRZDERXWVFDOHG XSNHWWOHVVKRZHUV WDSV7KHEXLOGXSRIVFDOHRQKHDW H[FKDQJHUVERLOHUV DSSOLDQFHVFDXVHVFRVWO\EUHDNGRZQV
7KHQWKHUH¶VWKHFRQVWDQWFOHDQLQJPRQH\VSHQWRQGHVFDOHUV FKHPLFDOVDQGGU\VNLQ (F]HPDDJJUDYDWHGE\KDUGZDWHU %ORFN6DOW 5HQWDVRIWHQHUIRU WLYTVU[K (OLPLQDWHKDUGZDWHULQ\RXUKRPHIRUJRRG ZZZEDVLQJVWRNHVRIWHQHUVFRP Est.1987 11 The Rabbiter - November 2020 removed the brochures and switched off A NEW LOOK the digital terminals – which resulted in a A huge thank you on behalf of all our huge rise of online deliveries. colleagues, for your patience and support Our Values Make us Different With our Town Centre store relocating as we improved the offer for customers to the Sainsbury’s stor at The Malls, visits across our Fresh Food range and our CHRISTMAS FOOD to the store at Kempshott will increase. General Merchandising/Tu Clothing area. ORDERING Your patience in adhering to social Our Fresh Food offer has been refreshed Our popular Christmas Food to Order distancing will be very much appreciated. for the first time in ten years, with over offer is now live. Brochures can be found 300 new products added to the range. located at the Customer Services. Desk ROYAL BRITISH and online. LEGION POPPY You may also have noticed that we have APPEAL increased the number of fresh meat and www.sainsburys.co.uk/christmasfood fish offers available, following the temporary We’re still proudly supporting the Poppy The final day for ordering is midnight, closure of our Counters, so you can shop Appeal and, have introduced several 16th December 2020 safer for different cuts of meat/fish. new initiatives to support donating to Collections start on 22nd December the appeal, in the absence of the Poppy through until 24th December CAFÉ sellers this year. It’s great to see our café re-open for ARGOS Customers can make donations at at all customers. We’re working hard. To We’re working hard to improve our offer our tills – including Smart Shop – and increase the offers for customers so, be for customers visiting Argos. During the we’ll have a collection point also at our sure to check out how we’re adapting to height of the pandemic, our Argos offer Customer Services Desk, for Poppy the latest government guidance for cafes switched entirely to an online offer – we purchases. and pay our colleagues a visit. RESTAURANT REVIEW LONGBRIDGE MILL Letter... Sherfield on Loddon RG27 ODL Tel: 01256 883483 to the editor In September, we joined 22 of the UK’s It can be a problem these days meeting baked mushrooms, salt and pepper squid, major retailers and associations in for a family birthday celebration but as while two shared a plate of pâte. publishing an open letter in The Sunday there were four of them from Reading, Main courses were two fish and chips, a Times to the Prime Minister calling for plus Madam and I, meant we could sirloin steak, a vegetable pizza while I had more effective legal protection for our follow the rule of six. We met around Hunter’s chicken schnitzel and Madam colleagues from an ever-rising tide of halfway at the Longbridge Mill. You know the fishcakes and poached egg. Naturally, abuse, threats and violence. the one, just off the oval roundabout all dishes came with either tripled cooked We now need your reader’s direct support heading north up the A33 at Sherfield chips or skin on fries. to keep this momentum going. on Loddon. Desserts chosen were a raspberry Our store colleagues have been working We dined early and perhaps because it cheesecake, two had double chocolate tirelessly to protect customers during was a Friday night the place became quite brownies while three of us had a the pandemic. Despite their hard work, busy. The entrance had hand sanitisers and mini pudding of apricot crème brûlée violence and threats have become part of the job - they do not deserve this. the need to use the QR code for track accompanied with a cappuccino coffee. and trace requirements. We were relieved As a regional, independent co-operative, The cost, including drinks, worked out to remove our face masks at the table we’ve been tackling crime from every angle as an average of £30. Not a cheap meal but they were needed when visiting the - causes, prevention, reporting and justice. but the quality of fare was good for all toilet and when entering and leaving the Although there have been some positive concerned and it proved to be a pleasant premises. The staff, of course, kept theirs steps forward, more needs to be done. family get together. I just wish that the on permanently but were careful not to Please consider writing to your MP, signing pathway to the carpark could be better reach across the table with the drinks, the national petition or viewing the illuminated now that dark nights have cutlery, condiments or plates of food. film we put together of our colleagues’ returned as the light from phones was experiences. This is a hard-hitting video we Like many restaurants these days the necessary to ensure our safe footing. felt was essential to highlight the severity Longbridge Mill has a reduced menu of the issue. Information on all of these offering but had selections that covered actions can be found here: https://coop. the mixed requirements of our party. ly/2GmP0MB. Drinks were simple enough with lagers, If we all play our part we can stop this ciders, draft cola and gin and tonic wave of violence. We need politicians, being our choice. Madam started with police and the rest of society to remember King prawn and mango cocktail while I these crimes are not victimless. had chargrilled lamb koftas. Others had Mark Smith Chief Executive, Southern Co-op 12 The Rabbiter - November 2020 BASINGSTOKE - OLD BASING U3A Having Fun Despite the Virus! a socially distanced Mystery Coach All our activities continue to follow Tour, wearing face masks. Our government guidelines, and our groups members love being in a coach, have been taking full advantage of the looking over hedges, enjoying freedoms we’re allowed. Our Excursions the countryside and panoramic & Holidays Group is no exception. views. The coach finally arrived in Arundel, with three hours to 2020 looked marvellous for the Group. explore its castle, cathedral and some their ‘bubble’ seems to be thoroughly So many things planned, and all well lovely gardens. And to have some lunch enjoying itself. supported by our members. Then came amongst its quaint streets and interesting Lockdown. Cancellation of the holiday shops. Members were so pleased to Come with us to Croatia, the trips to Stratford on see each other ‘face to face’ again and Any member of our U3A is welcome to Avon and Buckingham Palace. But Group everyone went home very happy. join the Excursion & Holiday Group trips, Leader Joyce takes every obstacle in her always following government guidelines. way as a challenge to overcome. Next Stop Greece Check our website for details. https:// At the end of September, a group left for www.basingstokeu3a.org/visits A Mystery Coach Tour a planned 10-day holiday in Greece, using You will be looked after and made very In early September, she booked a 48 ‘bubbles’ rather than social distancing. welcome. seater coach and 27 members set off on And from the photo they’ve sent back, www.probusbasingstoke.club Further afield and needing more walking effort are the tops of Dorset, Lewesdown PROBUS HEARS ABOUT AN UNUSUAL HOBBY Hill near Beaminster, and in Wiltshire, Milk Probus Club of Basingstoke member David There is limited access to Hill near Alton Barnes and west of Pewsey. Rawden is a retired chemistry teacher who two tops in military training Perhaps when we come out also had an interest in geography. He set areas: Mickle Fell in County of lockdown some of the a mini quiz before embarking on his story. Durham and High Wilhays more active readers might like Firstly, to test your knowledge of British in Devon and its near to visit a few of the local tops. geography based upon his exploration of neighbour Yes Tor. Both are They will be rewarded with a Great Britain that has taken him to the four on Dartmoor and are the splendid view. only mountains (hills above “corners” of the country. Answers to the quiz: 2000 feet) in England south Can you name the most northerly, easterly, of the Peak District. Most northerly: Dunnet Head. westerly and southerly points of mainland NOT John O’Groats, which is Britain? Proper walking gear is Dunkery Hill is the highest point essential to reach the about 10 miles to the east. Answers are at the end of this report. in Somerset. Given to the National majority of tops. However, Trust in 1935. Most easterly: Lowestoft Some people collect items as a hobby: there are a number of Ness, Suffolk. A splendid stamps, books, antiques and so forth. David tops fairly near Hampshire ground marker (geoscope) collected hills. They don’t take up room in which can be accessed by denotes the spot. Distances the house and they don’t need dusting. a simple walk from a car marked show that, for a crow, After ascending all the Wainwright listed park. One of these is Leith Amsterdam is lot closer than Lake District Fells he turned his attention Hill not far from Dorking Cardiff or Newcastle. to the Pennines and county tops. He visited in Surrey and another is the highest point of all the English counties Whitehorse Hill which can Most westerly: Point of which gave him the Heineken experience be found west of Wantage Ardnamurchan. It can be – he reached those parts of the country in Oxfordshire. Easiest of all reached by crossing Loch that people would not normally reach. is Ditchling Beacon, not far Linnhe by the Corran Ferry The highest top is Scarfell Pike at 3209 from Lewes in East Sussex. The summit of Snaefel, the highest (SW of Fort William in the point (2063 feet) of the Isle of Man. feet situated in the Cumbrian mountains; If you can find it amongst Western Highlands) then the lowest is in Norfolk, Beacon Hill at 345 a myriad of unsignposted roads, there heading west with a short stop in Strontian feet found just west of Cromer. Most tops is a large pleasant summit area at Black – the only place in Britain with an element are surmounted by a trig point or cairn Down, in West Sussex, south of Haslemere (strontium) named after it. so that you know you have succeeded. (Surrey). Walbury Hill in Berkshire, near Most southerly: Lizard Point, Cornwall. However, this does not happen in most Combe to the south west of Newbury, NOT Land’s End which is the most eastern counties or those near to London. can easily be reached from the cark park On one occasion he wandered through at Inkpen Beacon. Continuing east along westerly point of mainland England. Pavis Wood near Tring trying to decide the Wayfarer’s Walk brings you to Pilot Hill, If you correctly answer this quiz it proves which hump was the highest point of the highest point of Hampshire, situated that your GCE “O” level in Geography was Hertfordshire. just west of Highclere. not wasted. 14 and will be exploring lots of sounds for firework night too. You can see weekly updates from Hatch Warren Under Fives on our Facebook page “Hatch Warren Under 5s Preschool”, where you will see lots of photos and learn our Makaton signs of the week. We still have a few spaces remaining for immediate starts, to enquire about a HATCH WARREN preschool place at Hatch Warren Under UNDER FIVES Fives, please contact Angela Blomquist, been enjoying the hammock to rock or Manager, on 01256 322788, or email relax, role playing pirates, looking for bugs, We’ve had hugely successful first half [email protected]. term at Hatch Warren Under Fives – our chalking, playing tic-tac-toe and using string We also manage another lovely preschool, little ones have adjusted well to our new to wind along logs they have found. Kempshott Under Fives, located a short routines and are thoroughly enjoying all of distance away at St. Mark’s Church in Visitors are always very welcome so if you our topics and activities. Kempshott. would like to see Pre-School, we are offering Our most recent topic has been socially distanced show-rounds after hours “Autumn”. We’ve been making the most www.hatchwarrenunderfives.co.uk and we also have some short videos on our of our outdoor time and discovering all CANDOVER VALLEY website for a quick look at CVP. the autumn colours, patterns and the PRE-SCHOOL changes that we see in the environment Lisa Collisson as the seasons change. Our messy tray has Just a reminder that we currently offer been full of lots of autumnal resources and FOREST SCHOOL SESSIONS – SPACES CUCKOO MEADOW textures and we have also been making CURRENTLY AVAILABLE! PRESCHOOL pumpkin pictures, hammering golf tees 8.30 am STARTS, into butternut squashes and using broccoli This term we are learning different nursery 15- and 30-HOUR FUNDING PLACES, as our paint brushes to create autumn rhymes starting with one of favourites, tree pictures. SOCIALLY DISTANCED SHOW- ROUNDS AFTER HOURS The Wheels on The Bus. We have made We are also looking at animals that individual buses at the craft table. We hibernate as part of our autumn topic. Lots SETTLING-IN SESSIONS and went for a lovely walk to see the No.16 of children have spoken about hedgehogs, GARDEN VISITS bus arrive from Basingstoke on its way to so we have been collecting lots of lovely What a lovely start to Autumn we have natural resources to build hedgehog had at CVP! The little ones have been Steventon. We also made a stop to say houses. Hedgehog has also been one of listening to The Gingerbread Man story, hello to the ducks at the pond. The children our words to learn in our weekly Makaton busy baking and decorating Gingerbread walked very well and waited patiently for signing lessons. Men, painting, and cutting gingerbread the bus. The children have all settled into While we’ve been outdoors, we’ve been bunting and role playing the story with preschool life very well and we have had a looking out for conkers, pine cones their friends. fantastic first few weeks back. and leaves, which are all great natural It has been wonderful to welcome our resources to use in preschool at this time new little ones to the setting this term. About Cuckoo Meadow Pre-School: We of year. After half term we will be on more They have all settled in so well after some are a small, friendly, Ofsted Outstanding autumn walks where the children can get slightly new style play and stays to follow ranked pre-school located in the Rathbone their listening ears on and listen out for Government guidance and a garden visit Pavillion, North Waltham. The children the wonderful sounds of autumn such as to the family instead of the usual home who attend come from within the village crunching leaves, wind in the trees, splashy visit this year. puddles and lots more. and the surrounding areas including Oakley, Come rain or shine we have been at the Our weekly science experiments are still ‘forest school sessions. The children have Dummer, Hatch Warren, Kempshott and going strong – our favourite this half term Beggarwood and all agree the location has been creating lava lamps in wine glasses. and wonderful caring staff mean it is more The children loved watching the chemical reaction of oil, water, food colouring and than worth the short journey. To find out alka seltzer - they enjoyed recreating the more please contact Jo or Fiona on 01256 experiment by themselves too! 398172. www.cuckoomeadow.org Coming up, we will be getting creative ‘’I love how happy my daughter is to go to with clay when we celebrate Diwali, the preschool every day and how happy she is Hindu festival of lights, and with bonfire to tell me about it.’’- Cuckoo Meadow Parent night coming up we’ll be using lots of colour to create our own fireworks Hayley Thomas 16 The Rabbiter - November 2020 If you would like to support us and become part of the committee, you will need to write a short personal statement via email [email protected]. uk which will go out to the pre-school A HEALTHIER members (parents) prior to the AGM. HAMPSHIRE IN As a few of our current Committee are no A HEARTBEAT DANDELIONS longer parents and may not continue, we “Have a heart and help a heart!” It’s been a happy and enjoyable start to do need new parents to volunteer. the Autumn term here at Dandelions. Atrial Fibrillation (AF) is a debilitating If you are interested or would like to find Our new starters have settled in quickly heart condition. You may not have heard to their new surroundings and the older out more please contact the office on of it but it is more common than you may children are enthusiastically taking part in 01256 818857 Or alternatively Email think. If you ask around your friends and our Thursday’s ‘Lions’ (Rising Five) session. [email protected] family you may be surprise by how many We have so much to look forward to We have limited spaces available therefore people are affected. over the coming weeks. We will be talking if your child was born between 1st AF means living with persistent abnormal to the children about safety around September 2017 and 31st August 2018 heart rhythm, palpitations, chest pains, fireworks and creating our own fireworks please do contact us for a registration and breathlessness and of course anxiety. through craft and cooking activities. To form on Daily life becomes very difficult and people enhance our physical development we live in constant fear of another episode. will act out being fireworks by moving in 01256 818857 or alternatively e-mail Sufferers never know when they may have a range of different ways supported with [email protected] scarves and ribbons. an episode, so working is difficult as is going SHOOTING STARS out for the day or on holiday. An episode Following on from this we will be talking to means a trip to A & E and possibly a stay in the children in an age appropriate manner What makes us different and unique? about Remembrance Day and sharing What we do – Our purpose is to provide hospital and being sent home with drugs to some War time medals. We will also highly effective teaching experiences hopefully temporarily control the condition attempt a 2 minute silence!! The children and opportunities which support each while you wait to see the cardiologist will be making poppies to take home to individual child, enabling them to make If the condition becomes more advanced display in the window. significant progress. We achieve this by the next level of treatment is cardiac/ The children will be learning about Diwali working closely with parents and NEVER catheter ablation. It’s a low risk but effective and the Festival of Light. We will be making using a ‘one size fits all’ approach. procedure that can be used to treat AF tea light holders for them to take home. If you live in Basingstoke or North Why do we do it? Children in Need is approaching and Hampshire it means a trip to Southampton To teach children to ‘reach for the stars we have lots of fun activities planned for for treatment. Ironically the Cardiac and shine’ so that they develop life skills the children. We will all dress up in our consultant and heart rhythm specialist, Rob and learning behaviours to equip them for pyjamas or anything Pudsey related on the Bowers, is based in Basingstoke & has to 12th and 13th November. their learning journey throughout life. make the same trip to treat you. Can you Nursery Rhyme week is 16th to 20th Some of our sessions are filling up fast help us get this equipment at Basingstoke November and we will be inviting the so if you’d like your child to become a hospital so that local people with this children to come into preschool dressed as Shooting Star before Sept 2021, please condition and the consultant no longer their favourite story characters. Each day contact us ASAP. If your child is 2, they have to make that 60 mile round trip? we will cover a different rhyme and will be may be eligible for 15 free hours per week. creating games relating to each theme. Atrial Fibrillation (AF) sufferers in North We take children from around the age of Hampshire need your help to get treatment Our AGM is on 18th November. As a 1 year. We are open 8am to 5pm all year charity organisation we follow the running here in Basingstoke! round – see our website/Facebook page model of the Preschool Learning Alliance Rotary has already raised a substantial for more information. and as part of this our Management amount of money towards this equipment Committee is required to be made up of Our parents say… but we now need your help for the final at least 60% parents. “Thanks Clare and the team for always push to make this happen and achieve Alf’s If we are unable to find enough parents going that one step further.” goal to improve the lives of the numerous to volunteer to join the Committee our “Shooting Stars are a great nursery and local people with this type of debilitating preschool will not be able to operate. will always accommodate your needs to heart condition If you are able to spare a few hours each the best of their ability.” www.rcbd.org.uk month and have skills in finance, education, Marketing, IT, HR or just a general “Lovely nursery, amazing staff. Great To donate go to: enthusiasm to help make our Pre-school communication – lots of feedback to https://www.gofundme.com/f/a- great then please do get in touch. parents.” healthier-hampshire-in-a-heartbeat 17 zŽƵĐĂŶŶŽǁŬĂƚĂďůĞŝŶƐŝĚĞƚŚĞ ĂĨĠ͊͊WůĞĂƐĞŬLJŽƵƌƚĂďůĞŝŶ ĂĚǀĂŶĐĞďLJĞŵĂŝůŝŶŐ ŽĸĐĞΛďĞŐŐĂƌǁŽŽĚ͘ŽƌŐͲƐůŽƚƐ ĂǀĂŝůĂďůĞΛϭϬĂŵ͕ϭϭ͘ϯϬĂŵĂŶĚ ϭƉŵ&ƌŝĚĂLJƚŽ^ƵŶĚĂLJ͘KƵƚƐŝĚĞ ƚĂďůĞƐǁŝůůĐŽŶƟŶƵĞƚŽďĞĂǀĂŝůĂďůĞ ŽŶĂĮƌƐƚĐŽŵĞ͕ĮƌƐƚƐĞƌǀĞĚďĂƐŝƐ͕ ƐŽLJŽƵĐĂŶĂĚŵŝƌĞƚŚĞǀŝĞǁƐŽĨƚŚĞ WĂƌŬ͘ĞůŝĐŝŽƵƐŚŽŵĞŵĂĚĞĐĂŬĞƐ͕ ŚŽƚĂŶĚĐŽůĚĚƌŝŶŬƐ͕ŝĐĞĐƌĞĂŵƐΘ ǁĞĞŬĞŶĚďƌĞĂŬĨĂƐƚďĂƉƐ͊ dĂŬĞĂǁĂLJƐĞƌǀŝĐĞĂůƐŽĂǀĂŝůĂďůĞ ƵƌƌĞŶƚŽƉĞŶŝŶŐ ƟŵĞƐ&ƌŝĚĂLJƚŽ ^ƵŶĚĂLJϭϬĂŵ ƚŽϮƉŵ ,ƵŐĞƚŚĂŶŬLJŽƵƚŽ,ŝŐŚǁŽŽĚŽŶƐƚƌƵĐƟŽŶ ŽŽŬŶŽǁĨŽƌŽŶĞŽĨŽƵƌ ;ĞŐŐĂƌǁŽŽĚ^ŝƚĞͿĨŽƌƉƌŽǀŝĚŝŶŐŶĞǁŚŝͲǀŝƐũĂĐŬĞƚƐ ĐŚĂƉĞƌŽŶĞĚϮϬϮϭĐŽĂĐŚƚƌŝƉƐ ĨŽƌŽƵƌŌĞƌ^ĐŚŽŽůůƵď ĂŶĚĐĞůĞďƌĂƚĞƚŚĞŽƉĞŶŝŶŐŽĨ >ŽŶĚŽŶdŚĞĂƚƌĞƐŝŶƐƚLJůĞ͊ dŝŶĂdƵƌŶĞƌdŚƵƌϮϭƐƚ:ĂŶ >ŝŽŶ<ŝŶŐ&ƌŝϭƐƚKĐƚ ĞŵĂŝůŽĸĐĞΛŚĂƚĐŚǁĂƌƌĞŶ͘ŽƌŐƚŽ ƌĞƐĞƌǀĞLJŽƵƌƟĐŬĞƚƐ dŚĞŽŶůLJzŽƵƚŚůƵďǁŝƚŚKƉĞŶ ĐĐĞƐƐĂŶĚĂ,ĞĂůƚŚ,ƵďƐĞƌǀŝŶŐ ,ĂƚĐŚtĂƌƌĞŶĂŶĚĞŐŐĂƌǁŽŽĚ YƵĂůŝĮĞĚ^ƚĂīͬdžƚĞŶƐŝǀĞ&ƌĞĞ,ŽůŝĚĂLJWƌŽŐƌĂŵŵĞƐͬdĞů͗ϴϰϮϭϭϭͬŵĂŝů͗ǀŝĐŬLJΛŚĂƚĐŚǁĂƌƌĞŶ͘ŽƌŐ 7KH:DUUHQLVQRZRSHQDQGZHDUHFRQVWDQWO\UHYLHZLQJDOO &Z/zE/',ddZDd/DzZ^ϲͲϴzKhd,>h &Z/zE/',ddZDd/D'^ϭϯн d/s/Qd/H^;ƐĞĞďĞůŽǁͿZJRYHUQPHQWJXLGHOLQ HVUKWEHVWULF^^Θ,>d,WLRQV ,h dŚĞtĂƌƌĞŶŝƐŶŽǁŽƉĞŶĨŽƌĂůůLJŽƵŶŐƉĞŽƉůĞ zĞĂƌϲĂŶĚĂďŽǀĞŽŶĂ&ƌŝĚĂLJĞǀĞŶŝŶŐĨƌŽŵ ϲ͘ϬϬͲϳ͘ϯϬƉŵ͘ŽŽŬŝŶŐŝƐĞƐƐĞŶƟĂů͕ƉůĞĂƐĞƐĞĞ ŽƵƌ&ĂĐĞŬƉĂŐĞĨŽƌŬŝŶŐĨŽƌŵƐ͘ŽŽŬŝŶŐƐ ŽƉĞŶŽŶĂdƵĞƐĚĂLJĞǀĞŶŝŶŐ͘ x KŶĞďƵďďůĞŽĨϭϱLJŽƵŶŐƉĞŽƉůĞ x ^ŽĐŝĂůĚŝƐƚĂŶĐŝŶŐŝŶƉůĂĐĞ x ůůLJŽƵŶŐƉĞŽƉůĞǁŝůůďĞƌĞƋƵŝƌĞĚƚŽǁĞĂƌĂ ŵĂƐŬĚƵƌŝŶŐƚŚĞƐĞƐƐŝŽŶƵŶůĞƐƐĞdžĞŵƉƟŽŶƐ ĂƉƉůLJ x ^ĞƐƐŝŽŶƐǁŝůůEKdďĞŽƉĞŶĂĐĐĞƐƐĚƵƌŝŶŐƚŚĞ ƉĂŶĚĞŵŝĐ͕LJŽƵŶŐƉĞŽƉůĞǁŝůůďĞƌĞƋƵŝƌĞĚƚŽ ƐƚĂLJŝŶƚŚĞLJŽƵƚŚĐůƵďĨŽƌƚŚĞĚƵƌĂƟŽŶŽĨƚŚĞ ƐĞƐƐŝŽŶ x &ƌĞĞĞŶƚƌLJ x DŝdžƚƵƌĞŽĨĨƌĞĞĂĐƟǀŝƟĞƐĂǀĂŝůĂďůĞĞĂĐŚ ǁĞĞŬ͖ĂƌƚƐĂŶĚĐƌĂŌƐ͕yͲŽdž͕WůĂLJ^ƚĂƟŽŶ͕ ƋƵŝnjnjĞƐĂŶĚŵƵĐŚŵŽƌĞ͊ x dƵĐŬƐŚŽƉŽƉĞŶ tĞƵŶĚĞƌƐƚĂŶĚůŝĨĞŝƐŶŽƚŚŽǁŝƚƐŚŽƵůĚďĞĂŶĚ ƚŚŝƐŵĂLJĐĂƵƐĞĂĚĚŝƟŽŶĂůǁŽƌƌŝĞƐ͘&ŽƌĂŶLJ ƐƵƉƉŽƌƚŶĞĞĚĞĚďLJLJŽƵŶŐƉĞŽƉůĞǁĞĐĂŶ ƐŝŐŶƉŽƐƚLJŽƵƚŽŚƩƉƐ͗ͬͬǁǁǁ͘ƚŚĞŵŝdž͘ŽƌŐ͘ƵŬͬŽƌ ŚƩƉƐ͗ͬͬLJŽƵŶŐŵŝŶĚƐ͘ŽƌŐ͘ƵŬͬŝŶƉĂƌƟĐƵůĂƌŝĨ ƐƵƉƉŽƌƚǁŝƚŚĂŶdžŝĞƚLJŽƌŵĞŶƚĂůŚĞĂůƚŚŝƐ ŶĞĞĚĞĚ͘ ZĞĂĐŚŽƵƚĂŶĚƌĞŵĞŵďĞƌƚŚĞŐŽŽĚƟŵĞƐĂƚdŚĞ tĂƌƌĞŶ͘^ƚĂLJĂĐƟǀĞĂŶĚƐƚĂLJƐĂĨĞ͊ The Rabbiter - November 2020 summer. Other species that did really well was a Chalkhill Blue – very similar to the were:- Comma, Marbled White, Peacock, Common Blue but paler. Small Heath, Small Tortoiseshell and both The national Big Butterfly Count, carried the Small and Large White. However, some out by Butterfly Conservation at the end species were disappointing; Common Blues of July, shows a worrying reduction in the were again down together with Brown average number of butterflies since their Argus, Gatekeeper and Ringlet. Compared records began 11 years ago. The survey to last year fewer Orange Tips and result shows a drop in certain species Brimstones were seen but this was mainly such as Speckled Wood and Marbled White. due to the late transect start. No Speckled However, this is not quite what we have OLD DOWN AND Woods were seen on any transect this year seen and recorded on the two sites – the BEGGARWOOD but just a few were seen at other times. average number is up. Marbled Whites were WILDLIFE GROUP The highlight of 2020 was a sighting of a around all season and although Speckled It’s that time of year again to look at the Purple Hairstreak. This butterfly has only Woods were only seen on Beggarwood, butterfly transect records for Old Down. been recorded once before in 2016. There elsewhere locally they were in healthy 2020 has been a good year for butterflies were a couple of sightings of Clouded Yellow numbers on other sites such as Basing on Old Down with numbers increasing by but not on any formal transect. Wood and Odiham Common. another 200 plus despite the fact that the Beggarwood was good for butterflies too. Work Parties – Old Down work parties Covid lockdown and restrictions meant No formal transect is carried out on the have now started so please come and join no transects could be undertaken for the site but on occasional visits there were us. For Old Down, we meet outside Old first 6 weeks of the season. The number of sightings of – Green Hairstreak (Springtime), Down Hall every Thursday 10-12 noon. Small Blues rocketed with 919 seen during Small Blue, Common Blue, Large White, Always check our website just in case weekly recordings; their season lasted a Meadow Brown, Red Admiral and Peacock. there is a cancellation or change. Currently long time due to the lovely warm/hot A very unusual sighting on Beggarwood there are no volunteers for work parties on Beggarwood. If anyone is interested in volunteering for Beggarwood please contact the Group to discuss; these work parties can be weekly or monthly and any day of the week. www.olddownandbeggarwood.org.uk Email: [email protected] Brown Argus Common Blue Purple Hairstreak www.cranforddesign.co.uk ʟʁˑɔȬɔɷɆȥȲʦʜʁɦȲ ȉʟȦɏɔʰȲȦʰʹʟȉɫȬȲʦɔɆɷ z Extensions, alterations & new builds z Loft and Garage Conversion <ʁʟɅʟȲȲȦʁɷʦʹɫʰȉʰɔʁɷʦɔɷ˘ʁʹʟɏʁɴȲʁʟȥʹʦɔɷȲʦʦूȦȉɫɫʁʟȲɴȉɔɫʹʦेेे z Domestic & commercial project solutions 01252 872657 07525 064570 [email protected] LADY DecoratOR CALL JULES Local lady decorator t(MPTTJOH 30 years experience t&NVMTJPO Call for a FREE no obligation quote t6OEFSDPBUJOH 07517 641650 tWBMM1BQFSJOH [email protected] t%JTDPVOUTGPS0"1T 20 The Rabbiter - November 2020 CAGE CAMPAIGN SPIRITUALLY SPEAKING Latest details of the proposed A30 warehouse development have revealed some alarming examples of planning creep. Remembering First its main tenant is almost certainly going to be Amazon. Similar I cannot quite believe that we are in November already! It’s schemes in Tilbury and Darlington have been used to illustrate the becoming colder and the evenings are getting darker and as planning documents which now reveal a low profile grey flat shed, I look out of the vicarage window, I can see the trees have which is just over ninety feet high. The developers have in many cases lost most of their autumn leaves which makes the landscape failed to send the council the illustrations of this, despite specific look so different. There are a number of things that will be requests from planning officials. It is now clear that the distribution different this month. The amazing firework display at the centre will be plainly visible from most of the surroundings. Hatch Warren Community Centre is not able to go ahead and Remembrance will be different this year too. Large scale But more disturbing are the staff numbers. The original proposition events and parades will not be able to take place but this was for 146 employees. Here’s the creep - the latest documents should not stop us remembering all those who gave their show a huge increase in those figures, now 1381. The car park has lives for our freedom. also been extended to 800 spaces. Comparing the quoted staff numbers with similar data from the Tilbury and Darlington sites, November is the month where churches have special that 1381 figure may only apply to one shift. The other two quote services of remembrance. At Immanuel ours will be held at a similar figure for each of two shifts. Such is the congestion as the church on Sunday 8 November at 10am. I will also be one shift leaves and another arrives at Tilbury and Darlington, those recording our usual online Worship@Home service with a centres have been forced to stagger leaving and arriving times. This focus on remembering, which can be watched on the church traffic would be on top of the 24 hour flow of HGVs, and add to website and Facebook. the congestion which the other nearby housing developments will As Jesus was crucified on the cross one of the robbers, who already create not only into the A30 corridor into Basingstoke, but was on a cross next to him, said to Jesus, “remember me onto the M3 at junction 7. when you come into your kingdom.” He didn’t say rescue me The CAGE group does not have sufficient technical skills to investigate or forgive me but remember me. Being remembered is really and make official traffic models. This probably needs to be handled by important. Is there someone you will be remembering on the County Council planners. But it is fairly obvious that none of the local 11th of the 11th at 11am, the time when we all say ‘we will roads, including the M3, will be able to cope safely with such traffic remember them.’? We will be remembering those who lost volumes. CAGE and the Parish Council will be contacting the relevant their lives on active service in conflicts from the beginning officials to reinforce the case against this development. of the First World War right up to the present day. We also remember those who have served and their families. Christine Northam The Royal British Legion are having to adapt their Poppy cleanairgreenenvironment.org f: cleanairgreenuk Appeal due to Covid-19. One thing they are doing is encouraging us to display a poppy in a window as a way of showing appreciation for the service and sacrifice of our Armed Forces, veterans and their families, both past and present. The red poppy is a symbol of both remembrance and hope. At Immanuel Church we will be doing this and would love the community to join in too. You can download and print a Remembrance Poppy from the Royal British Legion website or you may want to create your own. How wonderful would it be to see poppies in windows all around Hatch Warren and Beggarwood. This year we would love the community to help us with our online Christmas Advent Calendar which we will put on Facebook and our website. If you have any Christmas themed photos or drawing you would like to share please send them to me at [email protected] by Monday 23 November and then we will select 25, one for each day leading up to Christmas. I look forward to receiving your pictures. Blessings, Rev May 07922 516761 [email protected] www.immanuelhwb.co.uk 21 The Rabbiter - November 2020 This publication is freely distributed ROCHESTER CL to Kempshott Rise, Hatch Warren, YORK CL E NU VE D IVE Beggarwood Lane and Kempshott COVENTRY A U R W R D CL H A A TRURO Y C PL M Park. Circulation over 4000. R R RABBITER CONTACTS: A E N E T T LINCOLN E T RBURY S S E CL CL E C Editor: [email protected] C U Kempshott R NORWICH O CL O W L Roundabout W E G S EXET Advertising Manager: TM STER ER C IN CL ERSON A C L T C A L L Brighton P Nick Overton: 01256 880770 C L HATCH E R WAR UPRON V REN C O A LANE GE FIELDF CL L OCTAVIAN R Hill [email protected] A P S YR H C CL M W W H I EWO O N A A US D GN R W S A R O M A C I A E BEAC M H V K T Y D OD E E I Distribution Manager: W PIEC L SHERATON E WY B N D D AV Y U T F R A O U O R TP AT Hatch Warren R H 01256-364378 Y O W NL I Y O WIGHTS R AT School L N O C E DR SANDBANKS WLK ING ORIN E T T A N T H [email protected] I DR ILL D H E H H VANBURGH D IA C LEW PAXTON Y C N EPP IS GDNS A L O H CL SOLENT R R W BEREWYK H AR A CHANTRYMWS DR N L CL OYS D IONL F Y TER AY AV R Y IE HATCHWARREN LANE W ERN TU HE S L Copy deadline to the CL BR M L T D D L AM N C IEL S A DO E I F E WD N R N N N R ET N S C G O O ON O Editor and Advertising WINCHESTERWINDSOR O ROADA HEIGHT T C M L CL R BU L S ANE RY Hatch Warren GDNS A S R D R Playing B C O Y O E A R A L L D Farm Manager is the 15th C Hatch PINNELL Field W Hatch Warren N G A HATCH CL T T N S I N E PETWORTH ROW N CL O Roundabout W of the month. Warren D L CL The Portsmouth O O SHERWOOD IRC A B H O E C Y S H W Arms C H A OD O R C W CL R T E E E S T L D C Sainsburys G E NDHURST V IN R B Y D D W L H E W /Argos T A H W N D I GA A T A E E A O HOLMES G R L B S AY N R R THE R L Mothercare U Y T O R E EN E ORTHW CL B O O E L N T A N Playing Field N R N N A S A S E L P IDGE C S E R R K N THE N A R D E E G H D O D T T BEECHES O R D HE S D O E W C Community Centre W A D O S NE R ID T O SAUN H B L H U O A F C St Mark’s RY T W G I D I H R S R G O D D IVE H C A ERS WAY School H D A MANOR D Pets at Home M O O CL M W W M O WOODSTOCK A O R Poundstretchers O AV E C N O R MS N P MEAD S HA O E LA L OD NE Y G N E D O A P ID R S H W L R SAUN S U A O MALHAM URST B R E C CR L N S R LONG C U C I BURROW DOW L M GDNS HA P EA D T CH SE R FIELDS SE A M E A O R R S M ROSEBERRY Y L R R E S WAY J N E S O O A R R M A U J E I N W E ES CLOSE D L N O A K AN E D S R S N E AV T A G RI G D E T L P A ID H I A D M D R C I Y TA S C O HERITA CL E L C R L D C R C D N D LI H I C E S C I T G H T S G R N G H W H OS I L O O Co-op / Post Office E VE - M C R NO BR L T A P O TW WOODLAND PARK R E C B P M O L O SE O Doctor’s & Dentist A TITHEW D G L R N D A P M E K T G Boots Pharmacy R D O D I I N D N S R THE COA G E D Community Centre Beggarwood E EL N TAGE I KIDDI CARU RI YF CH R A HE EW A L VI M Allotments D WIMBORNE O THE CL L LD BROA P B GARLIC LANE COURTYARD D EG DMER GA RW R CL E RD OO T O CANDOVER D A D S HO I IF NE LA W CL O E Y- TW GT R N O OOD LA I LEAZE E RT RW NE ED O F H H O R W GA R D F E G W W IE LD GLENE E ERB H R DR BE AGLES B FT A LFR I N E G G Y C AV U IT L S G T O M RN H L E S C TU E LE RS W B R I W S N N U T Q BE R S C RR P W C O M R Y A DR O E D H D A M CL N S O C W R EN US T T O A EN C D D CAM N L F D O A R C M O C F E R R D L I D E F A F O L E R C T L N O S C BR N SE BR EA A O DE E L LS L U C Z E L T N T E B F CADIA E D S N O R A A P A L E L R OD O W O R C C E W B C R O Y Y D A R A G R D R E C G D O R L E A E B M B R O O E • Doorstep milk delivery: T O E S R W G U G G A N A www.milkandmore.co.uk R O W ANE L O D L C O B S W A E E 01256 321329 R N C Y R A - NI A R N AN A R A IT D E • Basingstoke Neighbourcare S B R C RE • Newspaper Delivery: O C A N EA Need the help of a good Kempshott Post Office and OC neighbour? 01256 423855 Stores 01256 465517 Local Police Contacts: • Representatives: Community Safety Patrol Team • Councillors: Health Visitors 01256 844844 County Council: Tel: 376483 Email: [email protected] Stephen Reid, 34 Centurion Way Child Health Clinic Hampshire Constabulary 101 RG22 4TJ 320860 The Community Centre - every Crimestoppers 0800 555111 email: [email protected] • Health: Wednesday 10.30 - noon. Doctors’ Surgeries All Welcome. • Churches: Borough Council: Rebecca Bean, 12 Arcadia Acorn Health Partnership Dentist Immanuel C of E Church (in St. Western Way - Tel: 479747 Close, RG22 4AJ 07506 570926 Broadmere Road - Tel: 391391 Mark's School, Danebury Road) email: [email protected] Mon-Fri 0800-1830 • Library: 10.00 a.m. every Sunday All enquires to: 07922 516761 Te rri Reid, 34 Centurion Way Broadmere Road Surgery - 465102 - HCC mobile library RG22 4TJ 320860 Tel: 396500 every Tuesday evening St. Mark’s Hub Community Church email: [email protected] Every Sunday at The Apollo Hotel CE primary school from 4.40pm Dan Putty, 1 Gloucester Drive, Mon-Fri 0830-1800 to 6.40pm. (answermessage when closed) Contact Dan Wake or Margie RG22 4PH 356650 • Post Office Mendelsohn 01256 316010 email: [email protected] Chemist Co-op Broadmere Road: [email protected] • Member of Parliament Boots Pharmacy Broadmere Sun-Sat 0700-2200 www.hubcommunitychurch.org Road - Tel: 398927 Mon-Fri Hatch Warren: Kempshott Post Office and Stores • Buses: 0900-1800 Sat/Sun closed 01256 465517 Mon-Fri 0800-17.30 Maria Miller Lloyds Pharmacy, Sainsbury’s Sat 0900-1500 See previouspage 28 Rabbiter email: [email protected] 22 The Rabbiter - November 2020 SATURDAY MARKET AT PORTSMOUTH ARMS “Ever been to the Saturday market at the system is set up and everybody’s details Portsmouth Arms?” was a text received are taken. Richard has received countless from the Editor by my restaurant reviewer comments on how well run the market is partner. “Not my scene” he replied – so and how safe people felt. Very necessary “Madam” was tasked with the job! in these Covid times especially since in Together with a friend, and thinking it to the opening week of 19 September there only be a morning market, we decided it were 645 visitors. Also, as part of the social best to get there at a reasonable hour and media campaign, Richard advertised the 15 duly arrived at 10am to find the market’s businesses that were attending that Saturday opening hours are 10am to 4pm. As the market on the pub Facebook page, which stalls were still setting up, we decided to have resulted in 562 clicks being directed onto a coffee inside the Portsmouth Arms. There the Facebook pages of the stall holders. I got talking to Richard Curtis the manager, My friend and I enjoyed a leisurely stroll about how the market came about. round the market. The stalls were well placed around the perimeter of the sectioned Richard told me that during lockdown off car park and offered a wide array of he had cemented the Portsmouth Arms’ products including hand-made crafts, leather place in the local and digital community by goods, pictures and even a well-attended running daily pub quizzes which saw him converted horse box selling take-away food. raise nearly £50,000 for local charities. Sad to say we missed out on the appetising He decided to build on this and thus the donuts on the bakery stall as they were all market idea came about. Local people sold whilst we were having our coffee, but working from home or starting a small I did purchase two almond croissants which business, and needing promotion, can were enjoyed on my return home. From one therefore show their actual products to of the craft stalls, which had many delightful people instead of just relying on selling items for sale, I managed to get an early online. Customers can see and feel their Christmas present for my granddaughter. products while enjoying a wander around in the fresh air. I am glad I went to this event. Not only does it support local traders, but also The cost for a stall is very reasonable and means a social interchange with the stall there is full support for stallholders from holders, all of whom had the ability to Richard’s team, providing a complimentary take contactless payments so as not to breakfast of sausage or bacon baps, tea, coffee handle cash. The Portsmouth Arms can or squash, with food served to the stalls all be reached via several safe footpaths, so day. And the use of a clean warm toilet! what better way to enjoy a bit of exercise The market is run in a very safe way - much as well as enjoying some retail therapy by the same as inside the business. A one-way visiting the market. HATCH WARREN W.I. Hatch Warren W.I. held their meeting W.I. Ladies are very resourceful and we RHS judge from Hillier’s who worked on 1st October via Zoom. Our speaker was were able to enjoy our Spring Council gardens for Chelsea Flower Show. Miriam Matandu ‘My Life as an Asylum meeting at last with Zoom. Ben Fogle was Our weekly coffee morning Zoom Seeker’, Miriam became a refugee our speaker, Ben described himself as a chat keeps us all informed and we have from Zimbabwe in 2000 due to her shy child not particularly good at school: enjoyed meeting in small groups in person campaigning for better rights for women. neither academically nor field sports. He for a coffee. Our other groups include She fled her home leaving her three volunteered to join the cast of ‘Castaways’, our craft group and Hattie’s Family tree year old daughter with her mother as where he was marooned for a year on group, which is very interesting to see she feared for her life. Miriam lived on an island in the Outer Hebrides with 35 what members have found out about the streets before having help from the other people. This gave him the confidence their passed relatives. Hattie’s Huddle Church and Refugee Forum, this caused to take on new and bigger challenges, keeps us all in touch with one another. her to suffer a heart attack and has not 3000 mile race across the Atlantic with Our speaker for next month’s Zoom seen her daughter since fleeing, she has James Cracknell. Ben has worked on meeting will be a talk on ‘Medical missed all important mile-stones of her programmes including ‘One man and his Detection Dogs’, on 5th November at daughter’s life which made her feel a dog’ and Countryfile to name but a few. 7.30 p.m. for more information on how failure as a mother. Miriam now gives More meetings are planned using Zoom you can become involved in our W.I. talks and has become a preacher and from Hampshire Federation to include please contact our President Lynette on delights in making quilts and cakes to this month a Macaron master class, some 07824 535868, you will be made most help other people in this situation. members joined a talk by Pip Bensley a welcome to come and join in with us. 23 The Rabbiter - November 2020 CLASSIFIED ADS CARS URGENTLY WANTED ONE TO ONE PIANO TUITION. TOP PRICES PAID Beginners welcome from 6yrs. Local, experienced ‘ISM approved’ CASH OR INSTANT BANK TRANSFER teacher. 01256 333241 / 07774 631802 / janecleaver33@ M & K AUTOS • BASINGSTOKE hotmail.com www.1to1musictutors.co.uk BRIDGES ELECTRICAL SOLUTIONS LTD Trading in your car or just Fully Qualified, Insured and Registered Electrician. All Work Certified. Call 01256 471853 or 07879 298008. need an Instant Cash Sale All Electrical Work Undertaken. CALL US FIRST FAY CURTIS-FOOT HEALTH PRACTITIONER Professional Footcare in the comfort of your home. • All cars and vans considered from Call 07780 664410 £50 to £20,000 • For a fast, friendly professional approach please call Keith Lovelock on Basingstoke (01256) 477838 or 07785 594429 Yr Lc Bur 8 DAHLIA CLOSE • KEMPSHOTT • RG22 5RQ Online booking of all adverts: www.fromthesmallestseed.co.uk UPDATE FROM THE FORCE CRIME PREVENTION ADVISOR Catalytic Converter: If you see someone acting suspiciously and social media are used to sell theft prevention advice under a vehicle, report it to the police. counterfeit products as more shoppers • Park your car in a locked garage where Obtain as much information as possible, are buying online. possible, but if this isn’t an option, then including any vehicle registrations. 3. Copycat websites - on which criminals park in a well-lit and well-populated area. To further protect your vehicle: Thieves pose as people delivering legitimate • If using a public car park, park alongside steal catalytic converters for the valuable government initiatives. other cars and face your bonnet metals they can contain. Vehicles with a 4. Claims of miracle cures - including fake towards a wall where possible. higher chassis are often targeted, as are coronavirus treatments. hybrid vehicles. To keep yours safe, ask • Avoid parking half on the pavement, 5. Misrepresented home viewings - as your car dealer if they can give you any which makes the underside of your virtual property viewings are now more advice on locks, cages or guards that are vehicle more accessible. common, there are risks of buyers or approved by the vehicle manufacturer. • If your catalytic converter is ‘bolted on’ renters not getting the true picture of you can have the bolts welded shut. National Trading Standards a home. • Identify/etch your converter with a highlight Covid-19 Scams 6. Fake refund websites - offering unique reference number and register Criminals are adapting as the coronavirus “assistance” in claiming refunds which, it at www.immobilise.com pandemic develops. NTS have listed seven at the least, is advice that charities offer • Installing security lighting and CCTV on likely scams to watch out for: for free. your drive can act as a deterrent. Look 1. Price gouging - when traders over- 7. Exploiting the vulnerable – not a new for approved CCTV installers in your inflate products that are likely to be in tactic, but will become more prominent. area who are members of a recognised high demand, such as Covid-19 testing For further Crime Prevention advice inspecting body e.g. United Kingdom kits. please visit www.hampshire.police.uk/cp/ Accreditation Service. 2. Online fraud - where websites, apps crime-prevention/ 24 :ILMGPI+VETLMGW (SR´XFIWL]+IX]SYVWIPJRSXMGIH )URPDV OLWWOHDV TPYW:%8 Free ads Sponsored by Greenhouse Graphics 'EPP+VIIRLSYWI+VETLMGWSRSVIQEMPMRJS$KVIIRLSYWIKVETLMGWGSYO Online booking of all adverts: www.fromthesmallestseed.co.uk Free ads can also be sent to [email protected] 1PG1PG&KGV Want the weight gone? This is the one. +V+VũũUUVJGQPGYKVJCRGTUQPCNFKGV%QPUWNVCPV VQIKXG[QWQPGVQQPGUWRRQTV %QPVCEV[ QWT&KGV%QPUWNVCPV 5GNXCO5 GUGNXCOQPGQPGFKGV"IOCKNEQOYYYYQPGQPGFKGVEQOUGNXCO High quality and friendly MSK, Back and Neck Pain with professionals who listen Annette and Gordon Linscott 35 Years in Basingstoke – Specialists in Long Term or Recurrent Back and Neck Pain If you have a long wait for treatment or other care has not worked come and talk to us Goslings Garden & Fencing Services Ltd East Barn, Lychpit Centre With over 20 years experience in all gardening areas. 01256 466 666 T: 01256 332680 / 07973 523246 Email: [email protected] Garden Maintenance (one-off / regular) • Mowing • Strimming • Hedge-cutting • Stump grinding • Fencing • Pruning • Patio’s • Turfing ... and more www.spineteam.co.uk 25 The Rabbiter - November 2020 HATCH WARREN RUNNERS After several months of the club hitting the pause button on running in groups and not being able to take part in races with a fancy medal, it feels like we are getting back to some semblance of a ‘new normal’. Many people have continued with running alone and sharing post- run solo selfies on-line, but in recent months, in line with England Athletics guidance, we have been able to safely and sensibly return to club running. We’re outside, ensuring we are COVID compliant and club run leaders have been briefed and raring to go. A huge and heartfelt thanks has to go to our wonderful run leader volunteers for being committed to supporting others at what is an anxious and stressful time for so many of us, for so many reasons. As a club, we’ve been particularly mindful of the affect groups of runners might have on the general public. Routes are carefully planned and all runners in the club are briefed on social distancing and on being exceptionally cautious and respectful when approaching and passing other pedestrians. The physical and mental health benefits of running right now are tremendous. At the beginning of lockdown many club members took to the trails and explored the beautiful countryside across Basingstoke and beyond. Although the sunshine and longer days always help, many members have fallen in love with it and have continued. Even our most committed road runners, with an intense dislike for a ploughed field and a muddy puddle, are now converts. It feels safer and there are fewer people so it’s easy to understand why. Despite a total ban on events at the beginning of the year and over summer, we’ve seen things slowly creeping back into the running calendar. It took time for the running community and organisers to be able to adapt and keep people safe. Designing exciting virtual 9ROXQWHHUIRU+RPH6WDUW1:+ and remotely managed events is challenging – especially when many events have evolved and become a local or international institution 2XUYROXQWHHUVSURYLGHSRVLWLYHDQGIULHQGO\VXSSRUWWRIDPLOLHV over several years. Prime examples have been Endure 24, the ZLWK\RXQJFKLOGUHQ7KHYROXQWHHULQJUROHVDUHYDULHG London Marathon, the Great North Run, Centurion 100, Race to LQFUHDVLQJO\IOH[LEOHDQGDOZD\VWDLORUHGWRILWDURXQGRXU the Stones and our very own HWR Farleigh Wallop 10k race. Each YROXQWHHUVRZQOLIH virtual race was unique but had the same distance to reach, a clever 2XUYROXQWHHUVFRPHIURPDZLGHUDQJHRIEDFNJURXQGVDQGDOO way to track the results, a piece of bling to hang in pride of place, a KDYHWKHLURZQXQLTXHOLIHH[SHULHQFHV:HDUHFXUUHQWO\ way for runners to still collect for charity and last, but by no means UHFUXLWLQJIRUQHZYROXQWHHUVWRMRLQRXUWHDP7REHFRPHD least, the love and support of a virtual HWR cheer squad! YROXQWHHU\RXZLOOQHHGWRXQGHUWDNHDKUWUDLQLQJFRXUVH 'XULQJWKHVHXQFHUWDLQWLPHVWKHUHPD\EHDPL[WXUHRIIDFH Running has meant different things to different members since WRIDFHWUDLQLQJDQGRQOLQHVHVVLRQV March. For some, it’s been their lifeline; for others it has needed to take a back seat. Although club activities have been reduced, 2XUQH[W9ROXQWHHU&RXUVHZLOOUXQHYHU\7XHVGD\RYHUZHHNV WK the on-line support amongst members has been strong, heartfelt VWDUWLQJ -DQXDU\IURPDPSP and genuine. It’s running that brings us together, but it is the club’s sense of community and care during a global crisis that makes us a running family. Please get in touch if you’re a runner who’d like to join the club by visiting www.hwrunners.co.uk, our Facebook page or email [email protected]. ,17(5(67('" Completed! 7HO London Marathon (PDLOLQIR#KRPHVWDUWQZKDPSVKLUHRUJXN 40th :HEVLWHZZZKRPHVWDUWQZKDPSVKLUHRUJXN anniversary virtual race 26 SERVING THE PEOPLE OF BASINGSTOKE & NORTH HAMPSHIRE SINCE 1968 FINANCE NOW AVAILABLE Please ask for details DESIGN, SALES & FULL INSTALLATION SERVICE 01256 363123 | twoguys.co.uk ARMSTRONG ROAD, DANESHILL EAST, BASINGSTOKE, HANTS RG24 8NU 5DEELWHU$GYHUWB[BLQGGDEELWHU$GYHUWB[BLQGGLIFE IS A JOURNEY THAT STARTS AND ENDS WITH FAMILY 8\HSP[`I\PSKVU[PTLVUI\KNL[ :LWKRYHUVXFFHVVIXO\HDUVSURYLGLQJTXDOLW\ VHUYLFHVWRRXUFXVWRPHUVZHSRVVHVVDZLGH UDQJHRIEXLOGLQJSURIHVVLRQDOLVPWRKHOS\RX At Clarke & Son our expert DFKLHYHWKHKRPHRI\RXUGUHDPV teams will guide you 5L^)\PSKZ,_[LUZPVUZ(S[LYH[PVUZ through all your important 2P[JOLUZ7SHZ[LYPUN 1VPULY` matters: TVIPSL! VMÄJL! T: 01256 320555 RESIDENTIAL FAMILY LAW WILLS & ESTATE E: [email protected] ^LIZP[L!^^^J[WI\PSKLYZVYN\R PROPERTY PLANNING LTHPS!PUMV'J[WI\PSKLYZJV\R Clarke & Son Solicitors LLP *;7)\PSKLYZ3PTP[LK Manor House, 8 Winchester Road, Basingstoke, Hampshire, RG21 8UG www.clarkeandson.co.uk 27 VXFFHVVIXO\HDUV :LQGRZV'RRUV5RRIOLQH &RQVHUYDWRULHV2UDQJHULHV (QWUDQFH3RUFK*DUDJH&RQYHUVLRQV 5DLQERZ:DUP5RRI&RQYHUVLRQV 1RGHSRVLW 1RKDVVOH (QHUJ\¶$·5DWHG \HDU*XDUDQWHH 3D\PHQWRQFRPSOHWLRQ