Bay Colt Barn 12 Hip No

Consigned by Wesfield Sales (Robert and Saronda Smith), Barn Agent I Hip No. 12 Bay Colt 287 Bold Reasoning Seattle Slew ...................... My Charmer Chief Seattle ..................... Icecapade Skatingonthinice............... Bay Colt Rain Shower March 5, 2002 Mr. Prospector Magic Prospect................. Life's Magic Miss Virginia .................... (1994) Nodouble Angel Again ...................... Cherubim By CHIEF SEATTLE (1997). Stakes-placed winner at 2, $327,000, 2nd Breeders' Cup Juvenile [G1], Champagne S. [G1]. His first foals are 2- year-olds of 2004. Son of horse of the year Seattle Slew, leading sire, sire of 105 stakes winners, 8 champions, including Slew o' Gold ($3,533,534, Jockey Club Gold Cup-G1 twice, etc.), A.P. Indy ($2,979,815, Belmont S. [G1], etc.), Surfside (8 wins, $1,852,987, Frizette S. [G1], etc.), Swale (9 wins, $1,583,660, Kentucky Derby-G1, etc.), Capote [G1] ($714,470). 1st dam Miss Virginia, by Magic Prospect. 8 wins, 3 to 5, $163,490, 2nd Something- royal H.-R (CNL, $6,000). Dam of 1 other registered foal, 1 of racing age, 1 to race. 2nd dam ANGEL AGAIN, by Nodouble. 2 wins at 3, $24,580. Sister to Double Angel. Dam of 7 foals, 5 to race, all winners, including-- Remember the Roar (c. by Vigors). 12 wins, 2 to 6, $358,177, 3rd Pioneer S. [L] (TP, $7,670), Dust Commander S. [L] (TP, $6,335), William Henry Harrison H.-R (HOO, $5,924). Miss Virginia (f. by Magic Prospect). Stakes-placed winner, above. Double Again. 3 wins at 2 and 3, 2003, $79,310. Code of Angels. Winner at 2, 2003, $28,700. 3rd dam CHERUBIM, by Stevward. Winner at 2 and 4, $32,319, Lady Luck H., 2nd Bon Femme H. Sister to TRACK FIDDLER. Dam of 4 other winners, incl.-- Double Angel. 4 wins at 4 and 5, $54,792, 2nd Cyclamen S.-R (PHA, $4,320). Producer. Granddam of Space Time (to 4, 2003, 2nd Darley Arabian S.). 4th dam Sociable Angel, by Social Climber. 2 wins, 2nd Florida Breeders' Futurity, 3rd Oh Susannah S., etc. Half-sister to Tis an Angel. Dam of 10 winners, incl.-- DIAMOND PROSPECT. Winner at 2 and 3 in France, Prix Djebel, etc. Sire. TRACK FIDDLER. 6 wins, 2 to 7, $47,933, Florida Breeders' Futurity-R. CHERUBIM. Stakes winner, above. Tampa Town. 6 wins, $174,053, 3rd Creme de la Fete Claiming S. [L]. Sire. Solly. 7 wins, 2 to 7, $68,610, 2nd Annapolis H. Sire. Anchorwoman. 2 wins at 3, 3rd Noble Table Visitation S. Dam of TEDDY'S TOP TEN ($433,167), NORANC ($251,416, Forward Gal S. [G3], etc., dam of POSITION OF POWER, $295,717), Betamillion Bock [G3], etc. Casual Aquaintance. 4 wins, 3 to 5, $25,701. Dam of CASUAL DANCER ($46,976), Fighting Forty ($146,850, 2nd Lilac S. (RKM, $7,000), etc.). Engagements: OBS Championship S., Sunshine Millions, NATC F., Breeders' Cup. Registered Florida-bred..

Copy Link

Recommended publications

SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1
SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1 SUNDARBAN A.P. Indy—Desert Tigress, by Storm Cat $1.7 million 2007 Keeneland September Yearling Earned $103,340 as the winner of 4 races, including his maiden win by 8 3/4 lengths going gate-to-wire at 1 1/16 miles as the 123-pound highweight. Out of DESERT TIGRESS, by Storm Cat, sister to GROUP 3-winning sire HURRICANE CAT who has six group winners in France and Chile from his first two crops to race & second dam is champion older mare SKY BEAUTY,9GRADE 1 wins, including FILLY TRIPLE CROWN. Third dam is multiple GRADE 1 winner MAPLEJINSKY and this is the family of champions GOLD BEAUTY & DAYJUR, BREEDERS’ CUP DISTAFF (G1) winner PLEASANT HOME ($1,378,070) & multiple 2012 GRADE 1 winner POINT OF ENTRY. By Horse of the Year and Classic winner A.P. INDY, sire of the earners of more than $120 million & 11 champions, including BERNARDINI, MINESHAFT, RAGS TO RICHES, TEMPERA, etc. 2014 FEE: $2,500-LIVE FOAL First foals are two-year-olds of 2014 Standing at MILKY WAY FARM Inquiries to Linda Madsen 34174 De Portola Road, Temecula, California 92592 (909) 241-6600 e-mail: [email protected] • http://www.thoroughbredinfo.com/showcase/sundarban.htm 154 California Thoroughbred 2014 Stallion Directory www.ctba.com SUNDARBAN CS403401ORIGJockeyClubPageSent11-8-2013-1stChngLoretta11-27-2013-1052am:Layout 1 11/27/13 10:53 AM Page1 SUNDARBAN 2006 Bay - Height 16.2 - Dosage Profile: 8-12-21-1-0; DI: 2.65; CD: +0.64 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 unraced 61 foals, 10 SWs Reason to Earn Sailing Home Seattle Slew 3 1 0 0 0 $170 Round Table 1050 foals, 114 SWs 4 9430 98,635 Poker Glamour My Charmer 5 6002 4,535 Jet Action 12 foals, 4 SWs 16 4 3 2 $103,340 Fair Charmer Myrtle Charm A.P.
[Show full text]
MOR SPIRIT Dkb/Br, 2013
Enters Stud in 2019 MOR SPIRIT dkb/br, 2013 Dosage (4-0-14-0-0); DI: 1.57; CD: 0.44 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Cat, 1983 Storm Bird, by Northern Dancer Age Starts 1st 2nd 3rd Earned 8s, BTW, $570,610 Giant's Causeway, 1997 1,414 f, 177 BTW, 2.94 AEI Terlingua, by Secretariat 2 4 2(1) 2(1) 0 $288,400 13s, BTW, $3,078,989 3 5 1(1) 2(2) 0 $388,000 2,429 f, 186 BTW, 1.76 AEI Mariah's Storm, 1991 Rahy, by Blushing Groom Eskendereya, ch, 2007 16s, BTW, $724,895 4 5 3(3) 1(1) 0 $992,000 14 f, 11 r, 8 w, 2 BTW Immense, by Roberto Totals 14 6(5) 5(4) 0 $1,668,400 6s, BTW, $725,700 390 f, 18 BTW, 1.42 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian Won At 2 7.53 AWD 17s, BTW, $1,208,726 Los Alamitos Futurity (G1, $350,500, 8.5f in 1:43.54, Aldebaran Light, 1996 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 5s, wnr, $18,660 dftg. Toews On Ice, I’malreadythere, Urlacher, Frank 12 f, 8 r, 5 w, 2 BTW Altair, 1991 Alydar, by Raise a Native Conversation, Hollywood Don, Sorryaboutnothing). Unraced A maiden special weight race at SA ($68,100, 8f in 8 f, 5 r, 4 w, 1 BTW Stellar Odyssey, by Northern Dancer ¼ 1:37.48, by 4 , dftg. Urlacher, Uninvited, Nightly Dixieland Band, 1980 Northern Dancer, by Nearctic News, Wise Tale, Bruntino, Recalibrating).
[Show full text]
Graydar Oxbow
GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
[Show full text]
Race and (Stakes) Record A.P
Entered Stud in 2015 TRITAP gr/ro, 2009 Dosage (6-5-10-1-0); DI: 2.67; CD: 0.73 See gray pages—Bold Ruler RACE AND (STAKES) RECORD A.P. Indy, 1989 Seattle Slew, by Bold Reasoning Age Starts 1st 2nd 3rd Earned 11s, SW, $2,979,815 Pulpit, 1994 1,184 f, 163 SW, 2.89 AEI Weekend Surprise, by Secretariat 2 3 0 2 0 $20,200 6s, SW, $728,200 3 4 2 1 0 $101,736 919 f, 79 SW, 1.85 AEI Preach, 1989 Mr. Prospector, by Raise a Native Tapit, gr/ro, 2001 15s, SW, $304,656 4 2 0 1(1) 0 $34,000 14 f, 12 r, 12 w, 1 SW Narrate, by Honest Pleasure Totals 9 2 4(1) 0 $155,936 6s, SW, $557,300 866 f, 70 SW, 2.33 AEI Unbridled, 1987 Fappiano, by Mr. Prospector Won At 3 7.45 AWD 24s, SW, $4,489,475 An allowance race at CD ($52,000, 9.5f in 1:58.12, Tap Your Heels, 1996 566 f, 49 SW, 2.65 AEI Gana Facil, by Le Fabuleux 9s, SW, $47,275 NTR, dftg. Suns Out Guns Out, Shun, Charlie’s the 10 f, 6 r, 3 w, 1 SW Ruby Slippers, 1982 Nijinsky II, by Northern Dancer Man, Kid Sidney, Starforce, Chalybeate Springs). 14s, wnr, $83,760 A maiden special weight race at Sar ($80,000, 7f in 13 f, 13 r, 10 w, 2 SW Moon Glitter, by In Reality 1:22.56, dftg. Cape Glory, Joking, D’tiger, In Seattle Slew, 1974 Bold Reasoning, by Boldnesian Speight Ofitall, Chief Gaga, Dattts Happy, Guilt Trip, 17s, SW, $1,208,726 Avarice, Starter, Grand Rapids).
[Show full text]
Friesan Fire Bay Ridgling; Apr 30, 2006 View Complete Auction History 18 Starts, G2 Winner Click Here for Interactive Nicking
equineline.com Product 10N 12/16/19 17:03:15 EST Friesan Fire Bay Ridgling; Apr 30, 2006 View Complete Auction History 18 Starts, G2 winner Click here for Interactive Nicking Bold Ruler, 54 dk b Boldnesian, 63 b Alanesian, 54 b Bold Reasoning, 68 dk b/ Hail to Reason, 58 br Reason to Earn, 63 b Sailing Home, 48 ch Seattle Slew, 74 dk b/ Round Table, 54 b Poker, 63 b Glamour, 53 b My Charmer, 69 b Jet Action, 51 ch Fair Charmer, 59 ch Myrtle Charm, 46 b A.P. Indy, 89 dk b/ *Nasrullah, 40 b Bold Ruler, 54 dk b Miss Disco, 44 b Secretariat, 70 ch *Princequillo, 40 b Somethingroyal, 52 b Imperatrice, 38 dk b Weekend Surprise, 80 b Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Lassie Dear, 74 b Sir Gaylord, 59 dk b Gay Missile, 67 b Missy Baba, 58 b Friesan Fire Bay Ridgling Northern Dancer, 61 b Foaled Apr 30, 2006 Vice Regent, 67 ch in Kentucky Victoria Regina, 58 ch Deputy Minister, 79 dk b/ 18 Starts Bunty's Flight, 53 dk b G2 winner Mint Copy, 70 dk b/ Shakney, 64 dk b/ Dehere, 91 b Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Sister Dot, 85 b Damascus, 64 b Sword Game, 76 dk b/ Bill and I, 65 dk b/ Bollinger (AUS), 99 b =Star Kingdom (IRE), 46 =Biscay (AUS), 65 ch ch =Marscay (AUS), 79 ch =Magic Symbol (AUS), 56 ch To Market, 48 ch Bint Marscay (AUS), 90 ch Heart of Market, 67 b Accroche Coeur, 59 b Sir Ivor, 65 b *Sir Tristram, 71 b Isolt, 61 b =Eau d'Etoile (NZ), 82 b Prince Bright, 65 ch =Fille d'Etoile (NZ), 71 ch =Ascalon (NZ), 59 ch Breeder: Grapestock LLC (KY) Inbreeding: Secretariat: 3S X 4D Dosage Profile: 5 12 17 0 0 Bold Ruler: 4S X 5S X 5D Dosage Index: 3.00 Somethingroyal: 4S X 5D Center of Distribution: +0.65 Most Recent Auction Result: Sale Price: RNA $725,000 Sale: Keeneland Association September 2007 Yearling Sale Consignor: Vinery View Complete Auction History Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2019 The Jockey Club Information Systems, Inc.
[Show full text]
LUCKY PULPIT Ch, 2001
LUCKY PULPIT ch, 2001 height 16.0 Dosage (8-7-13-0-0); DI: 3.31; CD: 0.82 See gray pages—Bold Ruler RACE AND (STAKES) RECORD Seattle Slew, 1974 Bold Reasoning, by Boldnesian Age Starts 1st 2nd 3rd Earned 17s, SW, $1,208,726 2 6 2 2(1) 1(1) $95,260 A.P. Indy, 1989 1,050 f, 114 SW, 3.66 AEI My Charmer, by Poker 3 7 0 1(1) 2(1) $47,454 11s, SW, $2,979,815 1,184 f, 163 SW, 2.89 AEI Weekend Surprise, 1980 Secretariat, by Bold Ruler 4 8 1(1) 1 2(1) $55,214 31s, SW, $402,892 5 1 0 1(1) 0 $12,000 Pulpit, b, 1994 6s, SW, $728,200 14 f, 12 r, 9 w, 4 SW Lassie Dear, by Buckpasser Totals 22 3(1) 5(3) 5(3) $209,928 919 f, 79 SW, 1.85 AEI Mr. Prospector, 1970 Raise a Native, by Native Dancer Won At 2 7.66 AWD 14s, SW, $112,171 A race at Dmr ($70,200, 5.5f in 1:04.92). Preach, 1989 1,178 f, 181 SW, 3.98 AEI Gold Digger, by Nashua A maiden special weight race at Hol ($57,200, 5.5f, turf). 15s, SW, $304,656 14 f, 12 r, 12 w, 1 SW Narrate, 1980 Honest Pleasure, by What a Pleasure 2nd Pinjara S (8f, turf, to Rush Into Heaven, by a nose, 27s, SW, $188,856 dftg. Nister Bere, Presumption, True Contender, Kissin 11 f, 7 r, 7 w, 1 SW State, by Nijinsky II Ty, General Moody, Learman, etc.).
[Show full text]
PPCO Twist System
Entered Stud in 2016 ROUSING SERMON ch, 2009 Dosage (5-11-18-0-0); DI: 2.78; CD: 0.62 See gray pages—Bold Ruler RACE AND (BLACK TYPE) RECORD A.P. Indy, 1989 Seattle Slew, by Bold Reasoning Age Starts 1st 2nd 3rd Earned 11s, BTW, $2,979,815 Pulpit, 1994 1,184 f, 156 BTW, 2.88 AEI Weekend Surprise, by Secretariat 2 6 2(1) 2(2) 2(2) $274,000 6s, BTW, $728,200 3 8 0 1(1) 2(2) $213,500 921 f, 74 BTW, 1.82 AEI Preach, 1989 Mr. Prospector, by Raise a Native 15s, BTW, $304,656 4 10 3(1) 2(1) 3(1) $218,342 Lucky Pulpit, ch, 2001 22s, BTW, $209,928 14 f, 12 r, 12 w, 1 BTW Narrate, by Honest Pleasure 5 6 0 2(2) 0 $50,500 392 f, 7 BTW, 1.62 AEI 6 6 1 0 0 $65,230 Cozzene, 1980 Caro, by Fortino II 6.36 AWD 24s, BTW, $978,152 Totals 36 6(2) 7(6) 7(5) $821,572 Lucky Soph, 1992 964 f, 84 BTW, 2.19 AEI Ride the Trails, by Prince John 6s, wnr, $9,865 Won At 2 12 f, 12 r, 10 w, 1 BTW Lucky Spell, 1971 Lucky Mel, by Olympia Bob Benoit California Cup Juvenile S ($100,000, 8.5f 69s, BTW, $253,655 in 1:43.52, by 2¼, dftg. Motown Men, Stoney 14 f, 12 r, 8 w, 3 BTW Incantation, by Prince Blessed Fleece, Broadway Nika, Champions Gate, Unveiled Deputy Minister, 1979 Vice Regent, by Northern Dancer Heat, Inquisitive Son, Far to Reach, Our Boy 22s, BTW, $696,964 Benjamin).
[Show full text]
SLEW's TIZNOW Dkb/Br, 2005
SLEW’S TIZNOW dkb/br, 2005 Dosage (4-0-8-0-0); DI: 2.00; CD: 0.67 See gray pages—Matchem RACE AND (BLACK TYPE) RECORD Relaunch, 1976 In Reality, by Intentionally Age Starts 1st 2nd 3rd Earned 18s, BTW, $278,100 Cee's Tizzy, 1987 725 f, 87 BTW, 2.66 AEI Foggy Note, by The Axe II 2 3 1 1(1) 0 $140,300 6s, wnr, $173,150 3 3 2(2) 0 0 $107,570 740 f, 28 BTW, 1.58 AEI Tizly, 1981 Lyphard, by Northern Dancer 6s, wnr, $6,209 4 3 0 0 0 $9,000 Tiznow, b, 1997 15s, BTW, $6,427,830 11 f, 9 r, 8 w Tizna, by Trevieres 5 5 1 1(1) 1(1) $64,230 1,477 f, 78 BTW, 1.63 AEI Totals 14 4(2) 2(2) 1(1) $321,100 Seattle Song, 1981 Seattle Slew, by Bold Reasoning 7.71 AWD 9s, BTW, $295,321 Won At 2 Cee's Song, 1986 352 f, 20 BTW, 1.75 AEI Incantation, by Prince Blessed 18s, wnr, $82,225 A maiden special weight race at Sar ($62,000, 7f in 15 f, 13 r, 9 w, 4 BTW Lonely Dancer, 1975 Nice Dancer, by Northern Dancer 1:23.44, by 4¼). 10s, wnr, $3,873 2nd Lane’s End Breeders’ Futurity (G1A, 8.5f, to 15 f, 13 r, 12 w, 2 BTW Sleep Lonely, by Pia Star Wicked Style, dftg. Old Man Buck, Adriano, Tend, Seattle Slew, 1974 Bold Reasoning, by Boldnesian The Roundhouse, Fidelio, Briarwood Circle, Ready 17s, BTW, $1,208,726 Set, Referee, Mikimoto’s Mojo, Gold Train).
[Show full text]
JUMP START Dkb/Br, 1999
JUMP START dkb/br, 1999 height 16.2 Dosage (10-12-22-0-0); DI: 3.00; CD: 0.73 See gray pages—Bold Ruler RACE AND (BLACK TYPE) RECORD Bold Reasoning, 1968 Boldnesian, by Bold Ruler Age Starts 1st 2nd 3rd Earned 12s, BTW, $189,564 Seattle Slew, 1974 61 f, 10 BTW, 3.81 AEI Reason to Earn, by Hail to Reason 2 5 2(1) 1(1) 0 $221,265 17s, BTW, $1,208,726 Won Saratoga Special S (G2, $150,000, 6.5f in 1,050 f, 111 BTW, 3.69 AEI My Charmer, 1969 Poker, by Round Table 1:17.35), 2nd Champagne S (G1, 8.5f). A.P. Indy, dkb/br, 1989 32s, BTW, $34,133 11s, BTW, $2,979,815 12 f, 8 r, 6 w, 4 BTW Fair Charmer, by Jet Action SIRE LINE 1,184 f, 156 BTW, 2.89 AEI Secretariat, 1970 Bold Ruler, by Nasrullah JUMP START is by A.P. INDY, black-type stakes 8.24 AWD 21s, BTW, $1,316,808 winner of 8 races, $2,979,815, Horse of the Year and Weekend Surprise, 1980 653 f, 54 BTW, 2.98 AEI Somethingroyal, by Princequillo 31s, BTW, $402,892 champion 3yo colt, Belmont S (G1), Breeders’ Cup 14 f, 12 r, 9 w, 4 BTW Lassie Dear, 1974 Buckpasser, by Tom Fool Classic (G1), etc., and sire of more than 155 black- 26s, BTW, $80,549 type stakes winners, including MINESHAFT (Horse of 13 f, 12 r, 12 w, 4 BTW Gay Missile, by Sir Gaylord the Year and champion older male, G1), FESTIVAL OF Storm Bird, 1978 Northern Dancer, by Nearctic LIGHT (Horse of the Year in UAE, G3 in UAE), 6s, BTW, $169,181 BERNARDINI (champion 3yo colt, G1), HONOR CODE Storm Cat, 1983 682 f, 63 BTW, 2.26 AEI South Ocean, by New Providence 8s, BTW, $570,610 (champion older male, G1), RAGS TO RICHES (cham- 1,414 f, 177 BTW, 2.95 AEI Terlingua, 1976 Secretariat, by Bold Ruler pion 3yo filly, G1), MARCHFIELD (champion older Steady Cat, b, 1993 17s, BTW, $423,896 male twice in Can, G2A), etc.
[Show full text]
Caleb's Posse
equineline.com Product 10N 06/14/21 20:19:48 EDT Caleb's Posse Bay Horse; Apr 04, 2008 19 Starts, G1 winner Click here for Interactive Nicking Northern Dancer, 61 b Vice Regent, 67 ch Victoria Regina, 58 ch Deputy Minister, 79 dk b/ Bunty's Flight, 53 dk b Mint Copy, 70 dk b/ Shakney, 64 dk b/ Silver Deputy, 85 b Raise a Native, 61 ch Mr. Prospector, 70 b Gold Digger, 62 b Silver Valley, 79 ch Road At Sea, 64 dk b/ Seven Valleys, 72 ch Proud Pied, 66 b Posse, 00 b Red God, 54 ch Blushing Groom (FR), 74 ch Runaway Bride (GB), 62 b Rahy, 85 ch Halo, 69 dk b/ Glorious Song, 76 b Ballade, 72 dk b/ Raska, 92 ch Hail to Reason, 58 br Roberto, 69 b Bramalea, 59 dk b/ Borishka, 87 b Nearctic, 54 br Queen Maud, 68 ch Caleb's Posse *Vent Neurf, 60 b Bay Horse Boldnesian, 63 b Foaled Apr 04, 2008 Bold Reasoning, 68 dk b/ in Kentucky Reason to Earn, 63 b 19 Starts Seattle Slew, 74 dk b/ Poker, 63 b G1 winner My Charmer, 69 b Fair Charmer, 59 ch Slewacide, 80 b Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Evasive, 70 ch Summer Tan, 52 b Summer Scandal, 62 ch Go-Modern, 54 b Abbey's Missy, 01 ch Icecapade, 69 gr Clever Trick, 76 dk b/ Kankakee Miss, 67 blk Phone Trick, 82 b Finnegan, 56 ch Over the Phone, 65 ch Prattle, 57 ch Abbey's Phone, 93 ch Bold Commander, 60 b Dust Commander, 67 ch Dust Storm, 56 ch Dusty Donna, 85 ch Silent Screen, 67 ch Grow Silent, 75 ro Grow Light, 68 ro Breeder: Don C.
[Show full text]
GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89
GOLDEN SLEW 1999 Bay - Height 17.2 - Dosage Profile: 13-1-12-2-0; DI: 2.50; CD: +0.89 RACE AND (STAKES) RECORD *Nasrullah Bold Ruler Miss Disco Age Starts 1st 2nd 3rd Earnings Boldnesian Polynesian 2 unraced Alanesian Alablue 3 5100 $27,720 Bold Reasoning *Turn-to 4 5000 360 Hail to Reason Nothirdchance 10 100 $28,080 Reason to Earn Wait a Bit Sailing Home Marching Home Seattle Slew (1974) At 3, WON a maiden special weight race at Belmont Park (1 *Princequillo Round Table 1/16 mi., defeating This Guns for Hire, Foreign Authori- *Knight’s Daughter Poker ty, Indiana Knight, etc.). *Nasrullah Glamour Striking My Charmer IN THE STUD Jet Pilot Jet Action Busher GOLDEN SLEW entered stud in 2004. Fair Charmer Alsab Myrtle Charm Crepe Myrtle STATISTICAL SUMMARY Golden Slew Native Dancer (Through September 28, 2009) Raise a Native Raise You Mr. Prospector 3 crops Lifetime Lifetime 2yo Nashua Gold Digger Foals of racing age 30 30 Sequence Gold Alert Starters (/Fls) 12(40%) 8(27%) *Ribot Arts and Letters Winners (/Str) 2(17%) 0(0%) All Beautiful Croquis Total Starts 67 25 Cyane Unity Hall Total Wins (/Starts) 2(3%) 0(0%) Rum Bottle Bay Golden Bri (1992) Total Earnings $78,898 $26,493 Nearco Nearctic *Lady Angela Avg. Earnings (/Str) $6,575 $3,312 Briartic Round Table Avg. Earnings (/Start) $1,178 $1,060 Sweet Lady Briar Parading Lady Stakes Wnrs (/Str) 0(0%) 0(0%) Princess Bri Raise a Native Stakes Horses (/Str) 0(0%) 0(0%) Majestic Prince Gay Hostess Avg.
[Show full text]
P164, Gandhi.Indd 1 11/19/18 11:04 AM
GANDHI Chestnut Horse, 2009; 16 Hands FEMALE LINE Bold Reasoning Boldnesian INDIA. 6 wins, 2 to 4, $630,859, Cotillion Breeders’ Cup H-G2, Azeri Breeders’ Reason to Earn Seattle Slew Cup S-G3, etc. Sister to SING SOFTLY. Dam of 5 other foals, 4 winners— My Charmer Poker Fair Charmer MOZU ASCOT (Frankel). 5 wins at 3 and 4, 2018, $2,229,343 in Japan, A.P. Indy Yasuda Kinen-G1, 2nd Yomiuri Milers Cup-G2, Mainichi Broadcast System Dk.B. or Br., 1989 Bold Ruler Secretariat Somethingroyal Sho Swan S.-G2, Hankyu Hai-G3, etc. Weekend Surprise KAREENA (Medaglia d’Oro). 2 wins at 3, $148,000, Jersey Girl S. Lassie Dear Buckpasser Gay Missile The Taj (Street Cry-Ire). 3 wins at 2 and 4, $64,142 in England and U.A.E. India’s Song (Unbridled’s Song). Winner at 3, $28,566. Storm Cat Storm Bird Hennessy Terlingua MISTY HOUR. 4 wins at 2 and 3, $157,844, Glorious Song S, 2nd Fantasy S-G2. Island Kitty *Hawaii Dam of 10 other foals, 9 to race, 6 winners, including— India T. C. Kitten PILFER. 3 wins at 2 and 3, $126,360, Go For Wand S, etc. Dam of TO HONOR Chestnut, 2003 Mr. Prospector (8 wins, $1,798,840, Woodward S-G1, Cigar Mile H-G1, Miswaki Hopespringseternal AND SERVE Misty Hour etc., sire), ANGELA RENEE (4 wins, $578,250, Chandelier S-G1, etc.), Our Tina Marie Nijinsky II Java Moon ELNAAWI (5 wins, $407,305, Native Dancer S, 3rd Donn H-G1, etc.).
[Show full text]