Amelogenin, X isoform recombinant, expressed in E. coli
Catalog Number SAE0117 Storage Temperature –20 C
Synonyms: AMELX, AMG, AMGX, Amel Preparation Instructions The product can be reconstituted in water or 2% acetic Product Description acid at a concentration of 0.1-5 mg/mL. Tap the vial to Amelogenin, X isoform (AMELX) belongs to the family make sure that the protein is reconstituted. Aliquot of closely related amelogenin proteins that participate in reconstituted AMELX and store at –20 C. Avoid the amelogenesis process of teeth mineralization. repeated freeze/thaw cycles. AMELX may form thin Amelogenins account for more than 90% of the total clear films on some surfaces, leading to reduced protein in developing tooth enamel. Mutations in concentrations in solution. The exact AMELX AMELX are responsible for development of the rare concentration can be determined by absorption disease Amelogenesis imperfecta 1E (AI1E), which is measurement at 280 nm. An AMELX solution of 0.1% 1 characterized by abnormal tooth enamel development. has A280 = 1.35. Amelogenins act both as attachment factors and as a growth factor for mesenchymal stem cells.2-4 Precautions and Disclaimer Amelogenins are of interest in various research For R&D use only. Not for drug, household, or other applications such as treatment of hard-to-heal wounds, uses. Please consult the Safety Data Sheet for regeneration of tooth-supporting tissues, promoting information regarding hazards and safe handling remineralization of caries lesions, and repair of human practices. tooth enamel.5-8 Storage/Stability This recombinant AMELX expressed in E. coli has the The product retains activity for at least 2 years when following protein sequence. It does not contain any stored at –20 C. added sequence tags: References MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPM 1. Lagersrtroem-Fermér, M. et.al., Genomics, 26(1), GGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQ 159-162 (1995). PMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQP 2. Izumikawa, M. et al., ScientificWorldJournal, 2012, MQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWP 879731 (2012). STDKTKREEVD 3. Zeichner-David, M. et al., Eur. J. Oral Sci., 114(Suppl. 1), 244-253 (2006). The product is supplied as a lyophilized powder, 4. Schwarz, F. et al., Clin. Oral Investig., 8(3),165- prepared from a 0.2 M filtered solution of AMELX in 171 (2004). 2% acetic acid without any additives. The lyophilized 5. Romanelli, M. et.al., Clin. Interv. Aging, 3(2), 263- product is essentially salt-free. 72 (2008), 6. Haze, A. et al., J. Cell. Mol. Med., 13(6), 1110- The biological activity of recombinant human AMELX is 1124 (2009). measured by its ability to promote attachment of Saos-2 7. Ren, Q. et.al., Arch. Oral Biol., 100, 42-48 (2019). cells to a coated surface. The ED50 is defined as the 8. Mukherjee, K. et.al., J. Mater. Res., 31(5), 556-563 amount of AMELX per cm2 that elicits 50% of the (2016). maximal attachment activity. DK,DT,GCY,MAM 10/19-1
©2019 Sigma-Aldrich Co. LLC. All rights reserved. SIGMA-ALDRICH is a trademark of Sigma-Aldrich Co. LLC, registered in the US and other countries. Sigma brand products are sold through Sigma-Aldrich, Inc. Purchaser must determine the suitability of the product(s) for their particular use. Additional terms and conditions may apply. Please see product information on the Sigma-Aldrich website at www.sigmaaldrich.com and/or on the reverse side of the invoice or packing slip.