Characterization of Major Structural Proteins of the Infectious Salmon Anemia Virus (ISAV)
Vidar Teis Aspehaug
Doctoral Thesis
Department of Biology University of Bergen 2005
ISBN XX-XXXX-XXX-X Bergen, Norway 2005
1 Acknowledgements
This work has been carried out in 2001-2005 at the University of Bergen, Department of Biology where I have been a research fellow during these years, and received financial support from the Norwegian Research Council and from Intervet Norbio. I thank these institutions for enabling me to perform this work.
I express my sincere gratitude to my supervisor, Professor Curt Endresen for encouraging me to start a research career, and for his support and participation during these years.
Also, I thank my co-supervisors: Dr. Eirik Biering (Intervet Norbio, currently at the Institute of Marine Research, Bergen) has contributed greatly to my contentment with being a scientist, and have provided interesting and productive discussions throughout this study. Dr. Knut Falk (National Veterinarian Institute, Oslo) introduced me to the field of virus protein characterization, and inspired me to discover many interesting aspects of this field. I am deeply grateful to you both!
Furthermore, I would like to thank my other co-authors, Bjørn Krossøy, Aase B. Mikalsen, Lindsey Moore, Lisette Sanders, Mike Snow, Jegatheswaran Thevarajan, Stephane Villoing and Reinhard Vlasak.
Special thanks to friends and colleagues in the Fish Disease group for inspiring discussions and for providing a socially unique place of work.
I am deeply grateful to my family for believing in me and encouraging me through the years. Especially, thanks to my daughter Marta Grethe who made me realize that there are more important things to life than science and to my better half - Audny - love you!! You have contributed significantly to this thesis by taking care of things at home and by your input on the manuscripts.
2 3 Contents
Acknowledgements ...... 2
List of Original Papers ...... 5
INTRODUCTION...... 6 Twenty Years of ISA...... 7 ISAV an Orthomyxovirus?...... 8 ISAV Replication ...... 10 ISAV Genome Organization and Encoded Proteins ...... 17
AIMS OF THE PRESENT STUDY ...... 23
OVERVIEW OF PAPERS I-III...... 24
GENERAL DISCUSSION...... 26 ISAV Protein Profile ...... 29 Potential Determinants of Pathogenicity...... 31
CONCLUDING REMARKS AND FUTURE PERSPECTIVES ...... 38
REFERENCES...... 41
4 List of Original Papers
This thesis is based on the following original articles, which will be referred to by their
Roman numerals:
Paper I Falk, K., V. Aspehaug, R. Vlasak, and C. Endresen. 2004. Identification and
partial characterisation of viral structural proteins of infectious salmon anaemia
(ISA) virus. J Virol 78:3063-71.
Paper II Aspehaug, V., K. Falk, B. Krossøy, J. Thevarajan, L. Sanders, L. Moore, C.
Endresen, and E. Biering. 2004. Infectious salmon anemia virus (ISAV) genomic
segment 3 encodes the viral nucleoprotein (NP), an RNA-binding protein with
two monopartite nuclear localization signals (NLS). Virus Res 106:51-60.
Paper III Aspehaug, V., A. B. Mikalsen, M. Snow, E. Biering, and S. Villoing. First
Characterization of the Infectious Salmon Anemia Virus Fusion Protein.
(Submitted to J Virol).
5 INTRODUCTION
During the last thirty years the Norwegian aquaculture industry has grown from close to nothing into a high-tech industry with major growth potential. Today, Norway is the world leading producer of Atlantic salmon (Salmo salar L.), exporting half a million tons yearly representing values of about 1.8 billion USD (2003). For a small country like Norway this represents a substantial value, and fish is one of the main export articles, after oil and gas
(Source: The Norwegian Seafood Export Council).
The salmon industry is operating in a highly competitive international market, forcing the producer to reduce production costs and risk factors to a minimum. After experiencing major losses in the eighties and in the beginning of the nineties due to vibrosis, cold water vibriosis, furunculosis, infectious pancreas necrosis (IPN), and infectious salmon anaemia (ISA), the industry became increasingly aware of the significance and profitability of preventive healthcare. The introduction of effective bacterial vaccines and improved health management rescued the industry from total collapse and reduced the total use of antibacterial drugs in farmed fish by 99%. However, viral vaccines have so far not proved as efficacious as the bacterial vaccines, and fairly well characterized diseases like IPN, ISA, and pancreas disease
(PD), are still causing major losses in the industry. In addition, some less characterized diseases such as haemorrhagic smolt syndrome (HSS), heart and skeletal muscle inflammation (HSMI), and cardiac myopathy syndrome (CMS), all suspected to be of viral etiology, are of increasing concern. Thus, good health monitoring and efficient diagnostics are of vital importance to prevent viral diseases, and continued research on aquatic diseases is essential to fully exploit the potential of the Norwegian aquaculture industry.
6 The focus of this thesis will be on ISA with particular focus on the characterization of the
ISA-virus (ISAV) major structural proteins. This knowledge can contribute to establish potential determinants of pathogenicity of the ISAV, and provide key information for the development of improved diagnostics and recombinant subunit vaccines.
Twenty Years of ISA
Since the first officially recorded outbreak of ISA in Norway in November 1984 (111), several outbreaks have been reported yearly, with a peak of nearly 100 new cases in 1990
(52). Control measures including regulations on transportation, fish movement restrictions, disinfection of wastewater, and introduction of combat zones, contributed to reduce the number of outbreaks, and in 1994 only two outbreaks were registered (52). In addition the unspecific protection provided by the oil-adjuvant bacterial vaccines might have contributed to this end. Since then, the number of outbreaks in Norway has been stable, with 15 to 20 new cases each year.
The first incidence of ISA was a chronically proceeding disease among Atlantic salmon parr in a hatchery on the West Coast of Norway (Bremnes). The disease was characterized by severe anemia and high cumulative mortality. Affected fish were lethargic with pale gills, fin rot, exophthalmia, and hemorrhages in the anterior eye chamber and abdominal skin.
Pathological changes included dark, pale or yellowish liver, a dark and swollen spleen, congested intestinal walls, petechia in periviceral fat, acites fluid, edemas, hemorrhages in the swim bladder wall, and muscular hemorrhages (111).
For more than a decade ISA was considered to be an exclusively Norwegian problem, but as of today ISA have affected fish farms in Scotland, Canada, the Faeroe Islands, and the United
7 States (6, 69, 77, 91, 98, 111), and the virus has been isolated from Coho salmon
(Oncorhynchus kisutch) in Chile (54). The annual costs of ISA outbreaks has been substantial, and in 1999 reported losses were 11 million USD in Norway, 14 million USD in Canada, and the 1998 - 1999 epidemics in Scotland were estimated to cost 32 million USD (43). In North-
America ISA vaccination programs were initiated some years ago, and recently vaccination was initiated in the Faeroe Islands. However, ISA is classified as a list I disease according to the OIE (Office International des Epizooties), and in principle vaccination is forbidden, but it might be authorized under certain circumstances. In Norway, the general policy when dealing with ISA outbreaks is stamping-out and fallowing. Nevertheless, vaccination may become important in future strategies to control ISA and much effort has been aimed at the development of ISA vaccines. However, efficacious and cost-effective inactivated/killed viral vaccines have proven difficult to develop, and increasing focus is being put into subunit vaccines (104).
ISAV an Orthomyxovirus?
The first outbreak of ISA started an epizootic suggestive of a transmissible disease, and the following years new cases of the disease emerged (111). Antibacterial treatment and nutritional additives failed to reduce mortalities. Infection trials verified that the disease was caused by a transmissible agent, and the agent was recovered after filtration through 100 nm pores, suggesting a viral nature of the disease (110). The first purification of virus from infectious plasma using sucrose gradients revealed that the virus had a buoyant density in the range 1.184 to 1.262 g/ml (15), and later this have been specified to 1.18 g/ml using both sucrose and CsCl gradients (32). Exposure to lipid solvents indicated that the virus was enveloped (15, 110), and in 1994 electron microscopy studies presenting pictures of enveloped spherical virus particles suggested to be the ISAV was published (49). ISAV was
8 reported to have a diameter of approximately 100 nm, and was budding from endothelial cells lining blood vessels in tissue samples from infected salmon (49). The following year, a cell culture supporting the propagation of the ISAV was reported, enabling the isolation and a final confirmation of the causative agent of ISA (23, 33).
In vitro cultivation of ISAV laid the foundation for more detailed studies of the virus, and several succeeding papers have focused on virus characterization. The first report substantiating that the ISAV resembled the orthomyxoviruses presented a genomic characterization (73). It was demonstrated that the virus has a genome consisting of eight negative strand RNA segments that range from 1.0 to 2.3 kb, with a total size of approximately 14.5 kb. Also, the first ISAV-specific molecular clone corresponding to segment eight was sequenced, but no homology to other sequences was found (73). However, cumulative data on the morphological and replicational properties suggested that the virus resembled the orthomyxoviruses. Supportive biochemical, physicochemical, and morphological properties of the virus were published shortly after, including hemagglutination, receptor-destroying enzyme activity, and a nuclear replication strategy sensitive to actinomycin D (32). Another important piece in the puzzle of the ISAV classification was the sequencing of the basic polymerase 1 (PB1) gene, showing core polymerase motifs characteristic to all RNA-dependent RNA polymerases (60). The conserved motifs showed similarities to other negative strand, segmented RNA viruses, especially to the members of the Orthomyxoviridae, substantiating the classification of the
ISAV as an orthomyxovirus. According to the International Committee of Taxonomy of
Viruses (ICTV), the ISAV is now the type species of the fifth genera amongst the orthomyxoviruses, namely the Isaviruses.
9 ISAV Replication
Infection of a cell by a virus involves a number of steps. The virus must attach to the cell surface, penetrate, and subsequently become uncoated to make its genome accessible to the viral or host machinery for transcription and translation. Enveloped viruses (such as the orthomyxoviruses, paramyxoviruses, and retroviruses) rely on fusion of their envelopes with the cell membrane during penetration, and have separate coat proteins which are involved in the activities of virus attachment, entry, and penetration. Generally, two different entry strategies are used by various viruses. Influenza A is the prototype of a virus that requires a low pH environment in the endosomal compartment to trigger membrane fusion (100). In contrast, other viruses, such as paramyxoviruses and retroviruses, use a pH-independent mechanism (18). For these viruses, fusion occurs at the plasma membrane, but may occur in the endosomes as well. Unlike other RNA viruses, influenza virus mRNA synthesis has a unique dependence on host cell nuclear function, and in response to acidification and penetration, internal viral proteins facilitate the release and transport of the viral genome to the nucleus. Following genome amplification, the newly formed viral genomes leave the nucleus and incorporate into virus particles that are budding off the plasma membrane. The infectious cycle is completed when new virions are released from the cell by a receptor- destroying enzyme (51).
ISAV replication seems to share general characteristics with other orthomyxoviruses except that ISAV has an optimal replication at 15°C, and is accordingly slower (32). In the following, documented characteristics of the ISAV “life cycle” are summarized. Figure 1 provides an overview of each step in the ISAV replication.
10 APICAL SIDE b) Endocytosis c) Fusion and release of RNPs a)a) AttachmentAttachmen t in response to low pH
d) Import of cRNA (+) RNPs into the nucleus N U
h) Translation of C proteins into ER and L E
post-translational e) Transcription U processing and genome S amplification vRNA (-)
mRNA (+) i) RNP export
k) Release f) mRNA export
j) Assembly and budding
g) Translation of proteins in the cytoplasm
FIGURE 1. A simplified model of the ISAV replication. See main text for more details of the model. The virus first binds to sialic-acid-containing receptors (lilac and grey) on the cell surface via the hemagglutinin-esterase (HE) protein (red and yellow) (a). It then enters the cell by endocytosis (b) and in response to a lowering of the pH in the endosomes the viral fusion protein (blue) mediates the fusion of the viral and endosomal membranes, and the ribonucleoprotein (RNP) complexes are released into the cytoplasm (c). The viral genome segments are transported into the nucleus (d) where transcription and genome amplification takes place (e). Viral mRNA transcripts are exported to the cytoplasm (f), and translation of viral proteins is initiated (g). Surface proteins are translated into the endoplasmatic reticulum (ER) (h) where they enter the secretory pathway, going through posttranslational modifications prior to exposure in the plasma membrane. Proteins that will be components of new RNPs are transported into the nucleus, and late in the infection cycle newly synthesized viral genomes are transported out of the nucleus in the form of RNPs (i). RNPs are packaged into progeny virions that bud off from the plasma membrane, most frequently at the apical side of polarized cells (j). Mature virions are released from the cell surface by the receptor cleavage activity mediated by the HE (k).
B are litt 11 ISAV attachment, entry, and penetration have been elucidated in some detail. ISAV is an enveloped virus (15, 110) and enters the cells by fusion in acidic vesicles (24). Virus characterization studies revealed that the ISAV has hemagglutinating and receptor-destroying enzyme activities, the latter suggested to be an acetylesterase of a different specificity than the influenza C virus (32). The beneficial effect of trypsin on the in vitro replication of ISAV indicated proteolytic activation of a fusion protein as part of the fusion process (32).
More recent studies have demonstrated that ISAV attach to the surface of a susceptible cell by binding to sialic acid receptors (Fig. 1), and this binding is pH-dependent, with increasing binding at decreasing pH (28). Studies with specific hydrolase inhibitors have revealed that the receptor-destroying activity of the ISAV is inhibited by both diisopropyl fluorophosphates and 3,4-dichloroisocoumarin, indicating that the viral enzyme represents a serine esterase (58,
Paper I). Morphologically, the mushroom-shaped hemagglutinin spikes observed in ISAV using electron microscopy seemed different from the rod-shaped hemagglutinin projections of the influenza A viruses (31, 32). Recent studies have revealed that these spikes are hemagglutinin-esterases (HE) that specifically hydrolyze Neu4,5Ac2 sialic acids (44, Paper I), and under the assumption that the receptor-destroying enzyme specificity reflects receptor usage, Neu4,5Ac2 was suggested to represent a major ISAV receptor determinant (44).
Bound viral particles are internalized by receptor-mediated endocytosis and transported to endosomes and lysosomes, where the fusion of virus and endosomal/lysosomal membranes takes place in a pH-dependent manner (28, 49, Fig. 1). Compared to the fusion rate at pH 7.4, the fusion rate at pH 5.6 and 4.0 increased nearly 3 and 6 fold, respectively. Inhibitors of the endosomal acidification prevented the fusion process, further demonstrating the dependence on a lowering of the pH for fusion (28), and recent studies have demonstrated that the fusion
12 process is initiated at pH 5.4-5.6 (Paper III). However, amantadine did not inhibit ISAV replication, and attempts to demonstrate a pH-dependent association of the nucleoprotein
(NP) and matrix proteins have not been successful (32, 65, Paper I). This could indicate that the mechanism for the release of ribonucleoprotein (RNP) complexes during ISAV entry is dissimilar from influenza A, questioning whether an ion channel contributes to lower the intra-viral pH to facilitate the release of RNP complexes.
Key characteristics in the proceeding steps in the ISAV replication is similar to the influenza virus replication, indicating that the general mechanisms involved are comparable. ISAV pursue a nuclear replication strategy (32, 74, Paper II), and subsequent to membrane fusion, the RNP complexes must be released into the cytoplasm and transported to the nucleus for transcription (Fig. 1). The replication of both ISAV and influenza viruses is sensitive to inhibitors of mRNA synthesis such as actinomycin D and α-amanitin which block the activity of the RNA polymerase II by binding to double-stranded DNA (32, 51, 63, 96). Thus, these viruses steal the 5' cap from host cellular mRNA to generate appropriate primers for the initiation of viral mRNA transcription (96). This is reflected by the heterogeneous sequences representing the cellular 5` cap in the 5`-end of ISAV mRNA nucleotide sequences (96). The viral segments 7 and 8 have been shown to contain conserved nucleotides at both ends, and computer based secondary structure modeling suggested that the terminal 21 to 24 nucleotides are able to form self-complementary panhandle structures (96). These are structures assumed to be important for the transcriptional regulation of the viral RNA (vRNA), since both 3`- and
5`-end terminal sequences are believed to be involved in the initiation of transcription (35).
As genome sequences of all ISAV segments have been published, corresponding conserved regions with minor modifications has also been identified from 5`-end mRNA transcripts representing gene segments 1, 2, 3, 4, and 6 (4, 16, 59, 60, 88, 90, 103).
13
Several viruses that transcribe their genome in the cell nucleus have evolved mechanisms that promote the selective export of their mRNA transcripts, and in some cases, inhibit the export of cellular transcripts. To what extent the ISAV utilizes its potential to inhibit the expression of cellular proteins is unknown, but the general mechanisms of mRNA processing is similar to that of the influenza viruses (96), implying that the same regulatory mechanisms can be involved (14). These include the above mentioned cap-stealing, which contribute to reduce the export of cellular mRNA, but more importantly, the polyadenylation of influenza viral mRNAs is accomplished by the viral polymerase itself, which repeatedly copies a short stretch of U residues in the template genome RNA during transcription (14, 65). Indications that all ISAV vRNAs contain similar stretches of conserved polyadenlyation signals have been published (16, 59, 96, 103). This enables the virus to block the adenylation of cellular mRNA, inhibiting the expression of cellular proteins. In influenza, it is the non-structural protein 1 (NS1) that inhibits the cellular polyadenylation of mRNAs by reacting with the cleavage and polyadenylation specificity factor and the poly(A) binding protein II (14, 65).
The ISAV NP has been found to be produced early in the infection cycle, and the export to the cytoplasm coincides with the detection of the late proteins, indicating that the replication control system is similar to that of the influenza viruses (Papers I, II, III). In influenza A, the
NP is synthesized early, presumably because it is needed for the synthesis of template RNAs and vRNAs. The synthesis of the matrix 1 (M1) is delayed, probably because this protein stops the transcription of vRNA into viral mRNA, and because it is a major regulator of nuclear export of vRNP (11, 65, 70).
14 Following transcription and translation, the synthesized proteins seem to follow the same path as in influenza. Briefly, the ISAV NP is transported to the nucleus where it is assumed to encapsidate vRNA and assembles into RNP complexes containing vRNA, NP, and the polymerases. These are exported to the cytoplasm and transported towards the cellular membrane to be incorporated into budding viral particles (Fig. 1, Papers I, II). The glycoproteins contain N-terminal signal sequences to be synthesized on membrane-bound ribosomes and are thought to be translocated across the membrane of the endoplasmatic reticulum (ER) (16, 41, Paper II). N-terminal signal sequences are cleaved off (16, 41), most likely in the ER. Subsequently, these proteins are transported along the classical intracellular route for glycoproteins, through the secretory pathway, going through posttranslational modifications prior to exposure in the plasma membrane (51, Papers II, III).
For most enveloped viruses, targeting of viral glycoproteins in polarized epithelial cells defines the site of budding (3, 51, 78). Polarized virus assembly and release may be important in determining the pathogenesis of viral infections because it can influence in a major fashion the pattern of virus spread in the infected host (65, 78). Because the glycoproteins define the site of virus budding, specific interactions between the viral NP and the glycoproteins, sometimes mediated by a matrix protein, must take place to ensure that the genome of the virus is incorporated (51). ISAV has been found budding from endothelial cells lining blood vessels and from endocardial cells and leucocytes, and the apical side of polarized epithelial cells seem to be the preferential site of budding (49, 81, 82). The polarized targeting of the
ISAV HE often observed in infected cells grown in vitro indicate that the ISAV HE is involved in mediating this polarized ISAV budding (Fig. 2, unpublished results), as does the tight association between the RNPs and the matrix protein (Paper I). The infectious cycle is completed by the cleavage of sialic acids bound to HE in the budding particles, and this
15 cleavage is mediated by the viral receptor-
destroying enzyme activity located to the
HE, as described above (Fig. 1).
FIGURE 2. Cellular localization of the NP (red) and HE (green) in ISAV infected ASK cells 48 h post infection (p.i.). The NP is distributed in the cytoplasm, while the HE is localized perinuclearly, probably to the ER or golgi. Also, the HE locates to the plasma membrane at one side of the cell, indicating a polarized distribution correlating to the apical budding observed in electron microscopy (49, 81, 82).
16 ISAV Genome Organization and Encoded Proteins
The ISAV genome is composed of eight negative-sense, single-strand RNA segments, and nucleotide sequences of all segments have been published (16, 59, 60, 73, 87, 88, 90, 101,
103). Segment 1 through 6 has one open reading frame (ORF), while segment 7 and 8 has two
ORFs, as in other orthomyxoviruses. Segment 7 has an arrangement of un-spliced and spliced mRNAs analogous to that of influenza A virus segments 7 and 8, while ISAV segment 8 contains two overlapping ORFs (4, 73).
A total of 12 proteins have been detected by immunoprecipitation of lysates from radiolabeled infected cells (54), while four major structural proteins, and two minor proteins suggested to be precursor proteins, breakdown products, dimeric forms of one of the structural proteins, or minor viral proteins, have been recognized in purified ISAV particles (32, Paper I).
Interestingly, a protein band corresponding to one of the major structural proteins observed in purified viruses (50-53 kDa protein) was not included amongst the 12 detected by immunoprecipitation (32, 54, Paper I), but three new viral proteins of 19-20, 29-30, and 33.5-
36 was demonstrated. This is discussed further in the: “ISAV Protein Profile” section in the general discussion.
Initial suggestions on gene assignments in the ISAV have primarily been based on indications obtained by computer analysis, and have usually not been supported by experimental data.
Naturally, after the establishment that the ISAV is an orthomyxovirus, gene assignments have been influenced by the assumption that it would have an organization similar to other orthomyxoviruses, and this is reflected by the confusion in the literature. Although protein
17 TABLE 1. ISAV segments and coding assignments as compared to other relevant viral proteins as indicated. Boldface information is considered as accepted for the ISAV. Segment # Influenza A and other comparable viral proteins and size ISAV Suggested Comparable ORF MWc Important protein featuresa Flu A ISAVd coding #bp (kDa) References protein assignment Flu A Cap recognition of host cell RNA; component of RNPs and RNA 1 1 Basic 722 79.5 (16, 65, 103) Basic polymerase 2 transcriptase complex; nuclear localization; positive chargef; (2.3 kb) (2.3 kb) polymerase 2 Endonuclease activity; catalyzes nucleotide addition; positive Flu A 2 2 Basic chargef; component of RNPs and RNA transcriptase and replication 708 80.5 (60, 65) Basic polymerase 1 (2.3 kb) (2.3 kb) polymerase 1 complex; conserved polymerase motifs characteristic to all RDRPb Monomer binds to RNA to form RNPs; Flu A 5 3 (16, 65, 90, 101, involved in switch from mRNA to template RNA synthesis Nucleoprotein 617 68.0 Nucleoprotein (1.6 kb) (2.2 kb) Papers I, II) and in virion RNA synthesis; nuclear localization; early protein; Flu A Component of RNPs and RNA transcriptase and replication complex; 3 4 Acidic (16, 65, 90, 579 65.3 Acidic polymerase function unknown; negative chargef (2.2 kb) (2.0 kb) polymerase unpublished results) Surface glycoprotein; antigenic determinant: Type I viral 4 proteolytic cleavage activation: low pH induced conformational 5 (16, 65, membrane (HA) Fusion protein 445 48.8 change and fusion activity; fusion peptide; (1.7 kb) Papers I, III) fusion protein (1.8 kb) post fusion stable trimer; coiled-coil; late protein Viral 4 (HA) Major surface glycoprotein; dimer; receptor binding: 6 Hemagglutinin (59, 62, 65, 87, hemagglutinin 6 (NAg) 392 42.2 esterase activity; major antigenic determinant; late protein (1.5 kb) - esterase Papers I, III) -esterase (1.4 kb) High abundance in cells, not present in virion; localize to Flu A (seg 8 ORF 1) cytoplasm and nucleus; inhibits cellular pre-mRNA 3`end cleavage 8 7e Non-structural ORF 1 Non-structural 34.2 (4, 65, 102) and polyadenylation; inhibits pre-mRNA splicing, (0.9 kb) (1.3 kb) protein 1 300 protein 1 sequesters dsRNAh from PKR kinase reducing interferon response Flu A (seg 8 ORF 2) Minor component of virions; cytoplasmic and nuclear location; Unknown ORF 2 Nuclear Export interacts with matrix 1 and involved in nuclear export of RNPs; 8 7e 17.5 (65) (Spliced mRNA) 159 Protein (NEP (NS2)) originate from spliced mRNA Flu A (seg 7 ORF 1) Major protein of virion, underlies lipid bilayer; 7 8 ORF 1 Matrix 22 (4, 65, 73, Paper I) Matrix 1 interacts with RNPs and NEP; nuclear localization; late protein (1.0 kb) (1.0 kb) 185 Integral membrane protein; ion channel activity essential Unknown Flu A (seg 7 ORF 2) ORF 2 for virus uncoating; channel inhibited by amantadine; 7 8 (Non-spliced 27.4 (65) Matrix 2 234 originate from spliced mRNA mRNA) a) Accepted features for the tentatively corresponding ISAV protein are marked in bold. b) RNA-dependent RNA polymerases. c) Estimated from amino acid sequence of first published sequence. Isolate variations are not considered. d) (16, 73). e) A third ORF tentatively encoding a protein of 11 kDa has been suggested in ISAV segment 7 (57). f) Charge has been estimated from the protein sequence. g) Neuraminidase. h) Double-stranded RNA. assignments have not been settled for all gene segments, the disorders resolved so far has involved the two smallest segments and the receptor-destroying enzyme and fusion protein in particular. This illustrates the value of functional characterization of proteins when they have limited or no sequence similarity to other characterized proteins. Table 1 summarizes what is known about the features of ISAV proteins as compared to other seemingly similar viral proteins, with an emphasis on the relevant influenza A proteins. The cumulative knowledge on the gene assignments of the ISAV is summarized in the following:
ISAV RNA segment 1 has been suggested to encode the basic polymerase 2 (PB2), as indicated by its similarity in size and amino acid composition to the influenza PB2, its level of conservation amongst isolates, and its intrinsic properties of nuclear localization (103). The intrinsic nuclear localization has been verified by transfection studies, but beyond that the experimental data is limited.
ISAV RNA segment 2 encodes the polymerase basic protein 1 (PB1) as evident by the presence of polymerase motifs characteristic to all RNA-dependent RNA polymerases (60).
PB1 is the most conserved protein amongst orthomyxoviruses (66), and ISAV segment 2 show 20.8-24.1% amino acid identity to other orthomyxoviruses (60). The presence of the conserved polymerase motifs has been considered sufficient to conclude on its coding assignment relative to the influenza viruses.
ISAV RNA segment 3 has been suggested to encode the ISAV NP as supported by sequence analysis, although no significant sequence similarity to other proteins were identified (16, 90,
101). Supportive data were based on similarities to the influenza A NP, including amino acid composition, putative phosphorylation sites in two regions of the protein, and a hydrophobic
19 C-terminal end. Additionally, an RNA-binding site was predicted by comparison of the physicochemical characteristics of amino acids within the putative RNA-binding site of influenza NP (16). One study proposed that this protein is one of the major tissue antigens, but supportive experimental data are not clear (90). Experimental data supporting that segment 3 encodes the ISAV NP have been published, and is discussed in detail in papers I and II.
ISAV RNA segment 4 has been proposed to encode the acidic polymerase (PA) (90). The knowledge about the function of this protein in influenza is limited, and it is termed the acidic polymerase simply because it is part of the polymerase complex, and has a negative charge.
Thus, the basis for characterizing this protein is limited, and so is the experimental data supporting this gene assignment in the ISAV (Table 1). Indicative data were based on sequence comparison to the influenza A PA, and included a slightly negative charge, the size, putative sites of phosphorylation, lack of predicted transmembrane regions, and a predicted cytoplasmic localization of the protein (90). However, even though proteins are synthesized in the cytoplasm, all influenza polymerases have intrinsic properties to be transported to the nucleus (51), thus at this point, the presumptive supportive data is conflicting with the influenza literature. However, indication that segment 4 encodes an integral protein of the
RNP complex has been obtained by radioimmunoprecipitation studies using an antibody towards recombinant protein encoded by segment 4 (unpublished results). Two proteins thought to represent the NP and the matrix were detected, indicating that the antibody was reactive to the RNP complex. Attempts to disrupt the complex by SDS and boiling prior to precipitation was not successful, further substantiating that the targeted protein is part of the
RNP complex (51).
20 ISAV RNA segment 5 has been suggested to encode a glycoprotein corresponding to the 53 kDa protein detected in purified virus (16). This was supported by N-terminal sequencing, which also demonstrated that the initial 17 N-terminal residues constitute a signal sequence.
Functional studies have established that the encoded protein is a glycoprotein with the general properties of a type I viral membrane fusion protein, and this is discussed in detail in papers I and III.
ISAV RNA segment 6 has been shown to encode a 43 kDa HE (59, 87, Paper I), which is glycosylated (41, Paper I) and responsible for eliciting virus neutralizing antibodies (31), hemagglutination activity (31, 59, 87), and esterase activity (Paper I). This is discussed in further detail in paper I, and in the: “ISAV Replication” section above. Segment 6 has been found to hold the highest genomic variation amongst ISAV isolates, including a highly variable region very close to the predicted transmembrane region of the encoded protein, and phenotypic variation has been observed (25, 55, 56, 59, 72).
The coding assignments for the two smallest ISAV segments, have been, and are still causing discussion. In influenza viruses, the smallest of these genome segments uses an arrangement of unspliced and spliced mRNA transcripts to encode one non-structural (NS1) protein and one protein termed the nuclear export protein (NEP, previously termed NS2) (65). The coding strategies used by the second smallest segment on the other hand, vary, even though the proteins encoded are believed to have similar functionality (65, 76). In the influenza A virus, they are encoded by a colinear and a spliced transcript, while in influenza B M1 is encoded by a colinear transcript, and BM2 is transcribed by utilizing a tandem cistron translational stop- start mechanism (48). In influenza C virus CM1 derives from a spliced mRNA, whereas CM2
21 is the proteolytic product of a precursor protein that also produces a rapidly degraded membrane-bound polypeptide of unknown function (65).
ISAV RNA segment 7 has been shown to produce two partly overlapping mRNA species by splicing, and encode two proteins of 34.2 and 17.5 kDa (4, 88). The largest protein has been suggested to encode a non-structural protein as indicated by the lack of reactivity of recombinant protein to a polyclonal antibody prepared against purified virus (4). Additionally, indication that this protein is an interferon antagonist support that it corresponds to the influenza A NS1 (4, 102). This suggests that the orthomyxovirus genome segments encoding the NS proteins generally use the same coding strategy.
ISAV RNA segment 8 contains two overlapping ORFs. The first and smallest ORF encodes a protein with expected molecular weight of 22 kDa, and the second encodes a protein of 27.4 kDa. Experimental studies have demonstrated that the first of these proteins is a major structural protein corresponding to the virus matrix protein (4, Paper I), suggesting that the
ISAV has a fourth coding strategy amongst the orthomyxoviruses for the segment encoding the matrix protein.
Segment 8 was the first ISAV gene sequence published (73), but the original paper did not suggest a coding assignment. Still, several authors have proposed, with reference to the original paper and to similarities between ISAV and the influenza viruses, that segment 8 encodes NS1 and NS2 (5, 21, 53, 89, 90, 101). Even recently, long after the publication of experimental data showing that the first ORF in segment 8 encodes the matrix protein (4,
Paper I), scientists disagree on whether the encoded protein is structural or not (57).
22 AIMS OF THE PRESENT STUDY
The goal of this project was to identify and characterize the major structural proteins of the
ISAV, and to determine the localization of the most important activities expected to be associated to these proteins based on the knowledge from the influenza literature. Specific aims were to:
1. Confirm the major structural proteins of the virus.
2. Establish the glycosylation and phosphorylation status of the ISAV major structural
proteins, and determine the localization of these proteins in the virus particle.
3. Determine the localization of the most important biological activities associated to the
major structural proteins.
4. Provide further characterization of the proteins to contribute to the identification of
potential determinants of pathogenicity, and to support the development of improved
diagnostics and recombinant subunit vaccines.
23 OVERVIEW OF PAPERS I-III
Paper I in this thesis describes an initial identification and characterization of the four major structural proteins of ISAV. Metabolic labeling experiments demonstrated that the ISAV has two glycosylated proteins with molecular masses of 42 (gp42) and 50 kDa (gp50), one 66 kDa phosphoprotein (vp66) and one 22 kDa protein (vp22). The localization of these proteins in the virus particle was further resolved by solubilizing the viral membrane of purified virus using a detergent and separating the soluble and the non-soluble proteins into two fractions by ultracentrifugation. The two glycoproteins and vp22 were detected in the soluble fraction, reflecting a membrane association of these proteins, while vp66 and a minor part of vp22 were found in the pelleted fraction, indicating that these are located to the internal side of the viral envelope. Additionally, vp22 was found to be the most abundant protein in the virion, and immunofluorescence studies demonstrated that it is a late protein accumulating in the cell nucleus. Based on these results we concluded that the vp66 is the nucleoprotein, vp22 is the matrix protein, and gp42 and gp50 are surface proteins. Additionally it was demonstrated that the viral esterase is located to gp42, previously shown to represent the ISAV hemagglutinin, and this protein was demonstrated to form dimers, and possibly trimers. Finally, the active site serine residue could be tentatively identified at position 32 within the amino acid sequence of the hemagglutinin of ISAV strain Glesvaer/2/90. We proposed that the ISAV vp66 protein should be termed nucleoprotein (NP), the gp42 should be termed hemagglutinin- esterase (HE) protein, and the vp22 should be termed matrix protein.
Paper II presents the expression of the ISAV genome segment 3, demonstrating that it encodes vp66, and provides further data confirming that this protein is the viral NP. It was demonstrated that it is an RNA-binding protein, expressed as an early protein during viral replication, initially detected in the cell nucleus. Two monopartite nuclear localization signals
24 (NLS) at amino acids 230RPKR233 and 473KPKK476 were identified by computer analysis, and validated by site-directed mutagenesis. Both NLSs had to be present for the ISAV NP protein to be transported into the nucleus, indicating that these motifs cooperate to target the protein to the nucleus. This is in contrast to other orthomyxovirus NPs that have several NLSs that function independently of each other.
Paper III presents the characterization of the ISAV gp50 as the viral membrane fusion protein (F). Cloned sequences showed identity to previously published segment 5 sequences, and computational analysis of the protein sequence revealed a potential coiled-coil and a tentative viral fusion peptide (FP). The F protein was found to be synthesized as a precursor termed F0, cleavable by trypsin to the disulfide linked fragments F1 and F2. Size estimates of
F1 and F2 and the localization of the FP and theoretical trypsin cleavage sites suggested a proteolytic cleavage site after residue K277 in the protein sequence. Cell-cell fusion assays demonstrated the requirement for trypsin and low pH to induce fusion. Treatment of purified virus with trypsin and low pH induced a conformational change in the protein, revealing a band suggestive of a trimer in WB, indicating a trimerization as part of the fusion process, or more likely, a stabilization of the trimer. This conformational change was coincident with induction of membrane-fusion activity, providing strong evidence that it represents the formation of the fusogenic structure. The same conformational change could be induced by high temperature and by urea, suggesting that the cleaved form of the protein is in a metastable state, all in accordance with characteristics of type I viral membrane fusion proteins. Sequence data indicated that the cleavage site structure is not a major determinant of pathogenicity in the ISAV.
25 GENERAL DISCUSSION
Although the overall morphological and physicochemical properties of the ISAV are similar to those of the other orthomyxoviruses, ISAV is distinct from the influenza viruses in a number of ways. ISAV infects fish, and have an optimal replication at 15°C (32). It is structurally unique in having several homologous proteins that bear no significant similarity in primary sequence to those of the other orthomyxoviruses, and its genomic organization differs in several ways. Particularly, the organization of the activities associated to the ISAV surface proteins is different from that of the other orthomyxoviruses.
With regard to genome structure, the major difference among influenza A, B, and C viruses pertains to the surface glycoproteins, and as demonstrated, the ISAV represents an additional variant (Fig. 3). Influenza A and B viruses have eight gene segments and contain separate attachment and receptor-destroying envelope glycoproteins (HA and neuraminidase (NA)), whereas ISAV contains one glycoprotein providing both of these functions (HE) and a separate F protein (Papers I, III). In influenza A and B viruses the fusion activity is located to the attachment protein (HA). Influenza C viruses contain only a single glycoprotein providing all of these functions (hemagglutinin-esterase-fusion, HEF), as reflected in the genome by the concomitant loss of one RNA segment (65) (Fig. 3).
Despite these differences, the structures of influenza A HA and influenza C HEF have been demonstrated to be largely comparable, having structurally similar receptor-binding domains as well as comparable stem domains thought to form independent fusion domains (92). The segregation of the three functions in HEF into structurally distinct domains led to the speculation that the trimeric fusion domain may have been an ancestral membrane-fusion protein (92). It was suggested that the HEF has evolved by recombination events resulting in
26 NA HA F HE
1 2 3 1 2 3 4 4 5 5 6 6 7 7 8 8
a) ISAV b) Influenza A & B F HN HEF
1 2 3 4 5 6 7
c) Influenza C d) Paramyxovirus FIGURE 3. Organization of the activities associated to the surface proteins of the ISAV, Influenza A, B, and C viruses, and one paramyxovirus, as indicated. The localization of the receptor-binding activity is illustrated as red balls, the receptor-destroying activity as stars in yellow (esterase) or orange (neuraminidase), and the fusion activity as blue triple-bars. ISAV has a receptor-binding and -destroying protein termed the HE, and a separate F protein (a). Influenza A and B has a receptor-binding and fusion protein termed the HA, and a separate receptor- destroying protein termed the NA. Influenza C has all activities associated to a single protein termed the hemagglutinin-esterase-fusion protein (HEF) (c), while paramyxoviruses (d) has a similar organization as the ISAV except their receptor-destroying activity is a neuraminidase and not an esterase as in the ISAV. Thus paramyxoviruses have a hemagglutinin-neuraminidase (HN). Enumerated bars with head in a), b), and c) illustrate the viral genome segments, and the same colors that were used to indicate activities above, have been used to indicate the coding assignment of segments encoding the surface proteins. Paramyxoviruses have a non-segmented genome as illustrated in d).
27 the insertion of a receptor-binding domain and an esterase domain into an ancestral fusion protein analogous to the single-function fusion proteins of paramyxoviruses (92).
Paramyxovirus fusion proteins (F) are different from the orthomyxovirus fusion proteins, particularly because of its pH-independence (51), and since the ISAV fusion protein is the first single function orthomyxovirus fusion protein described (Paper III), it may be more closely related to such an ancestral fusion protein.
Another distinguishable difference amongst the orthomyxovirus genera involves the coding strategy for the gene segment encoding the matrix proteins. The ISAV matrix protein has been linked to the first and smallest ORF in segment 8 (4) (Table 1), as opposed to the other genera in which the second smallest segment encode the M1. In Paper I we demonstrated that this protein is the most abundant protein in the virus particle, and that it is associated to both the membrane fraction and to the RNPs. It is a late protein, detected at 23 h post infection and it is accumulating in the nucleus (Paper I). However, as opposed to the matrix proteins in the influenza A, B, and C viruses, we were not able to demonstrate phosphorylation of this protein (65, Paper I). The phosphorylation of these proteins is thought to be associated to the active transport of these proteins in and out of the nucleus during the infection cycle (11, 79), and the unphosphorylated nature of the ISAV matrix could indicate a novel mechanism mediating this transport. However, transfection studies have established that the ISAV matrix has intrinsic ability to be transported to the nucleus, and it has a theoretical NLS (personal observation and personal communication Snow, M.). Thus, the importance of phosphorylation for this nuclear transport is questionable. Alternatively, the protein is phosphorylated, but the sensitivity of our immunoprecipitation assays was too low. This could be explained by the relatively low affinity of the antibody used towards the matrix (Paper I).
28 ISAV Protein Profile
ISAV contains eight RNA segments encoding at least ten proteins, and so far a total of 13
ISAV protein bands have been detected (Table 2). These include four major structural proteins of 22, 42, 50, and 66 kDa, and two minor proteins of 30 and 82 kDa which all have been recognized in purified ISAV particles (32, Paper I). The present study has established that these major structural proteins represent the matrix, HE, the F protein precursor (F0) and the NP respectively, and the 82 kDa protein is a dimer of the HE (Papers I, II, III). A total of 7 protein bands have been associated to the F protein by Western blot analysis after various treatments, including the F0 monomer, the cleaved fragments F1 and F2, F dimer, F trimer, and possible intermediates of these F polymers (cleaved and uncleaved) (Paper III, table 2). The
30 kDa protein detected in purified virus probably corresponds to F1 (Paper I). Kibenge et al.
(54) identified three additional viral proteins of 19-20, 29-30, and 33.5-36 kDa by
a) b) c)
NP 66 kDa F 50 kDa HE 43 kDa
matrix 22 kDa
Photo: A. Nylund, UIB FIGURE 4. The ISAV particle. (a) Electron micrograph showing an ISAV particle. The particle is approximately 100 nm wide. (b) A schematic reproduction of the ISAV particle, showing the location of the different structural viral proteins. The NP (orange) associates with each of the eight vRNA segments to form RNP complexes. The subunits of the viral RNA-dependent RNA polymerase complex PB1, PB2, and PA (lilac) are also associated with the RNPs. ISAV has a receptor-binding and -destroying protein termed the HE, and a separate F protein. The localization of the receptor-binding activity is illustrated as red balls, the receptor-destroying activity as yellow stars (esterase), and the fusion activity as blue triple-bars. The matrix protein (green) is derived from a colinear mRNA of segment 8 and interacts both with the membrane and with the RNPs inside the virion. No attempt has been made to reconstruct the relative size proportions of proteins or number of copies of each protein in the virus particle. Also, proteins of unknown status have not been included. (c) Radioactively labeled purified virus run in SDS-PAGE is demonstrated on the right, reflecting the migration and relative quantity of the four major structural ISAV proteins (see also paper I).
29 radioimmunoprecipitation, but in their study the protein band corresponding to F0 (50 kDa) was not detected. The absence of F0 may indicate that the samples analyzed contained non- inactivated proteolytic enzymes, and that the 19-20 and 29-30 kDa protein bands represent the cleaved products of the fusion protein, namely F1 and F2 (54, Paper III). Also, previous studies have demonstrated that the ISAV HE is cleavable by trypsin, producing a cleaved fragment of 34 kDa (59, Paper I), suggesting that the 33.5-36 kDa protein may represent a cleaved form of the HE. This is supported by the size difference of this protein band amongst isolates which might be due to different numbers of glycosylation sites in the HE (16, 32, 41,
54, 56, 59, 87, Papers I, III). It is also suggested that the protein bands in the range 80-94 kDa represents dimers of HE and not the polymerases as suggested by Kibenge et al. (54), and also this is supported by the size variability amongst isolates. Thus, the present study suggests an alternative explanation to the protein profile observed by Kibenge et al (54), and this is summarized in table 2.
TABLE 2. Suggested assignments to protein bands observed in the ISAV protein profile, generated by summarizing observations from immunoprecipitation studies, SDS-PAGE, and WB from several publications as indicated. SDS-PAGE Protein bands Size-range of observed in corresponding Suggested protein References present study protein bands from (kDa) other studies (kDa) 170a HE trimer or tetramer? Paper I, unpublished results 150a, c F trimer Paper III 125a, c F intermediate Paper III 100a F dimer Paper III 82a 80-94 HE dimer (54, Paper I) 75a, c F intermediate Paper III 66 66-74 NP (32, 54, 56, Papers I, II) 50 47-53 F (16, 32, 56, Paper III) 42 38-46 HE (16, 32, 54, 56, 59, 87, Paper I) 34b? 33.5-36 Cleaved HE? (54, Paper I) b 30 29-30 F1 (54, Paper III) 22 22-26.5 Matrix (4, 32, 54, 56, Paper I) b 20 19-20 F2 (54, Paper III) a) non-reducing SDS-PAGE. b) trypsin treated virus. c) trypsin and low pH treated virus.
30 The association of the viral membrane fusion activity to the second ISAV glycoprotein (gp50) verifies that the ISAV has a HE and not a HEF (59, Paper I and III). Additionally, it has been established that the ISAV HE has substantial sequence similarities to the regions around the active-site serine residue of other HEs, including the influenza C HEF (Paper I), and an enzyme activity comparable to that of certain coronaviruses (44). In coronaviruses, the HE is not absolutely necessary for virus infection in culture (62), while the presence of the HE in all isolates analyzed so far suggests that this is not the case in ISAV (25, 59, 72). In Paper I we suggested the ISAV HE to exist as dimers and probably trimers, as indicated by the presence of a second and third protein band in Western blots of non-reduced, non-heat-treated samples of precipitated HE. However, HE proteins of coronaviruses are found as dimers (86), and the trimeric nature of the HA, HEF, and F proteins are primarily related to the fusogenic activity of these proteins (18, 29, 75, 84, 92, 119). Additionally, the receptor binding domains of HEF, which is a trimer, has been suggested to have structural relationship to the HE of coronaviruses (92), suggesting that the polymerization status of these proteins is of secondary importance to the receptor-binding domains. Thus it is suspected that the ISAV HE is a dimer, and that the third protein band observed in WB which was suggested to represent a trimer
(Paper I), may be a tetramer. This is supported by recent size estimates on this protein indicating that it is approximately 170 kDa (unpublished results), which is in agreement with it being a tetramer.
Potential Determinants of Pathogenicity
Increased virulence is consistently associated with a change in the function of one or several viral proteins, resulting in a more efficient completion of the infectious cycle, and/or altered tissue tropism. Thus, identifying and characterizing proteins involved in each step of the viral replication is crucial for the understanding of ISAV pathogenicity. Additionally, studies of the
31 intrinsic properties of these proteins can gain valuable information on the mechanisms involved in modulating viral pathogenicity, and combined with genome sequence information from several isolates, this can provide an important foundation to understand the genetic basis for virulence in ISAV.
The majority of the ISAV isolates isolated so far are pathogenic as they originate from outbreaks of ISA in fish farms, and a system of classifying isolates as virulent or avirulent is not yet established. Still, speculations that a full length archetype variant of the HE highly polymorphic region (HPR) represents an avirulent phenotype of the virus has been presented
(20, 80). The avirulent nature of these strains were indicated by the lack of disease in the host fish, and by their poor replication in cell culture (19, 20). The model suggests that virulent variants of the full length archetype arise by deletion of several nucleotides in the HPR, suggesting that the HPR is a major determinant of pathogenicity in the ISAV (19, 20, 72, 80).
The HPR is located to the stalk of the HE, and deletions in the HPR may affect several properties of the HE, including flexibility and receptor-binding specificity and affinity, antigenicity, esterase activity, interaction with other proteins, and possibly the polymerization of the protein, potentially affecting all the previously mentioned properties (see for instance 2,
115). Additionally, the variable glycosylation of the HE can potentially contribute to modulate pathogenicity, as it does in other orthomyxoviruses (9, 65). Thus the ISAV HE is a prime candidate in modulating the pathogenicity of the ISAV.
The most notable determinant of pathogenicity in other orthomyxoviruses and in paramyxoviruses is the cleavage properties displayed by the fusion promoting proteins (see for instance 13, 17, 37, 38, 40, 85, 106-109, 112). Virulent isolates generally have an F protein which is cleavable by ubiquitous intracellular proteases due to multiple basic residues
32 at the cleavage site, enabling a systemic spread of the virus, thereby increasing virulence.
Still, it is also clear that several gene segments can contribute to the pathogenic phenotype of these viruses, depending on considerations such as the genetic background of the virus, the host, and the route of infection (7-10, 65). Also, it seems that when gene segments harbor traits that are known to influence pathogenicity, the genetic background provided by other segments can play a significant role in modulating this phenotype (107). Thus in the following, I will focus on other potential modulators of ISAV pathogenicity than that of the
HE directly, particularly on the roles of the F and NP.
The apparent lack of multiple basic residues in the F protein cleavage site sequence of the distantly related virulent ISAV isolates published so far suggests that the cleavage site structure is not as important in determining the pathogenicity of the ISAV as in other orthomyxoviruses (Paper III). Nevertheless, the ISAV fusion activity, including the cleavability of the F protein, might still be a target of pathogenicity altering mechanisms. In our experiments, cell-cell fusion were observed in cells co-transfected with the HE and F genes, excluding the requirement of other viral proteins for fusion. Yet, conclusive data on whether the F protein could induce fusion independently of the HE was not obtained due to the generally low transfection efficacy obtained in fish cells. Nevertheless, an interaction between these two proteins, in which the HE affects the fusion activity, cannot be excluded.
Several studies confirm the importance of the hemagglutinin-neuraminidase in influencing the fusion activity in paramyxoviruses (1, 45, 50, 64, 83), and residues in the paramyxovirus FP found to influence this regulatory effect seem conserved in the ISAV (95, Paper III). Also, the fusion activity of the Influenza A HA has been suggested to be modulated by other viral genes
(9). Although a an interaction between the ISAV HE-F might simply serve to bring the target membranes and the F protein close enough to undergo fusion, attempts to induce
33 trimerization, or even to induce trypsin cleavage of recombinant F protein expressed alone in either Sf9 cells, Escherichia coli, or fish cells have so far been unsuccessful (unpublished results). This suggests that the ISAV HE might have a role in regulating the availability of the
F protein cleavage site. As mentioned, the natural variation in the ISAV HE HPR has already attracted the attention of researchers interested in viral evolution and determinants of host range and virulence (25, 55, 59, 72, 80). However, the concept that HE might affect the F protein phenotype is new, and further research is required to determine its significance.
Papers I and II established that the NP is a phosphoprotein encoded by segment 3 which accumulate in the nucleus until the export is initiated at the onset of the detection of the late proteins. The ability of the NP to be transported to the cell nucleus is an intrinsic property of the protein, regulated by two NLSs which was identified and verified by site-directed mutagenesis (Paper II). Both ISAV NLSs are required to transport the NP to the nucleoplasma in transfected cells, and this is in contrast to other orthomyxovirus-NPs that have independent
NLSs (79, 114). Mutations in virulent variants of Influenza A have been shown to repeatedly involve NLSs and sites of protein and RNA interaction, implicating them as potential modulators of virulence (9). However, NP genome sequences from only three isolates have been published so far, and supplementary sequence analyses and functional studies are needed to establish the importance of these findings.
In the absence of other viral proteins, the NP appear in the nucleolus and in structures resembling Cajal bodies before it is detectable in the nucleoplasma (Paper II). Initially, this led us to speculate whether phenotypic differences existed between Bremnes/98 (used for transfections) and Glesvaer/2/90 (used for infections). However, the ISAV NP was only rarely observed in the nucleolus of immunostained infected cells using either isolate, and we
34 FIGURE 5. Cellular localization of NP (red) and HA (green) in ASK cells infected with two isolates of ISAV (a-c, e, and f), and localization of the NP in transfected COS cells (d) (NB: in (d) NP is shown in green). Immunofluorescence analysis are shown from 20 (a), 24(b), and 36 (c) h p.i. using the Bremnes/98 isolate, and 24 (e) and 36 (f) h p.i. using Glesvaer/2/90 (method of staining is as described in paper II). As described in paper II, the NP can be detected in the nucleus at 8 h p.i., while the HA appears at about 20 h p.i. (c). Using the Bremnes/98 isolate, the NP seem to accumulate in the nucleolus as indicated by arrows (a, b and, c). An orange arrow indicates a structure possibly representing a Cajal body (a). When expressed in COS cells, the NP located to the nucleolus and the cytoplasm. Conversely, the NP of the Glesvaer/2/90 isolate was only sporadically observed in the nucleolus, seemingly very early after the onset of NP detection (paper II), while the nucleolus appeared devoid of NP during the remaining of the infectious cycle (e, f).
.
suggested that the NP might require another viral protein to facilitate the transport from the
nucleolus (Paper II). However, recent studies have shown that cells infected with the
Bremnes/98 isolate give a significantly higher number of cells with NP localized to the
nucleolus than the Glesvaer/2/90 isolate does, substantiating a phenotypic difference between
the two isolates (Fig. 5 a, b, c, e, f, unpublished results). Also, these results suggest that
localization to the nucleolus may be of functional significance to the ISAV. Several viruses
and viral proteins including the Influenza A NP, have been shown to interact with the
nucleolus and its components, and evidence suggests that viruses may target these structures
35 to favor viral transcription, translation, and perhaps alter the cell cycle in order to promote virus replication (12, 42, 47, 93, 94, 116, 118). In addition, cellular and viral proteins that localize to the nucleolus have been found to be involved in apoptosis events (42, 46, 97, 105).
Nucleolus targeting is mediated by nucleolus localization signals (NoLS) which consist of clustered basic Arg/Lys residues. These are separate from, but in many cases overlapping,
NLSs (39, 61, 99, 117) (Table 3). Our studies using mutants of segment 3 to identify the
NLSs indicated that NLS1 was implicated in the transport of the NP to the nucleolus in transfected cells (Paper II), and by comparing this region with NoLSs identified in other viral proteins, a tentative NoLS spanning NLS1 can be suggested (Table 3).
TABLE 3. NoLSs in viral and cellular proteins. NoLSs consist of clustered basic Arg/Lys residues, and are separate from, but in many cases overlapping, NLSs. The basic residues are shown in bold, and NLSs are underlined. The ISAV NP NLS1-region has residues comparable to other NoLS, and experimental data has indicated that this region may be implicated in the nucleolus targeting of the NP (Paper II), while the ISAV NP NLS2-region is less similar to NoLSs. Proteins Sequences References GGNNV Protein α RRRANNRRR (42) MDV MEQ RRRKRNRDAARRRRRKQ (67) HIV-1 Tat GRKKRRQRRAP (22) HIV-1 Rev RQARRNRRRRWERQR (61) HTLV-I Rex PKTRRRPRRSQRKRP (99) Semliki capsid protein NoLS-1 KPKKKKTTKPKPKTQP (34) Semliki capsid protein NoLS-2 RRRKRNRDAARRRRKWQ (34) PRRSV nucleocapsid PGKKNKKKNPEKPHFPLATEDDVRHHFTPPSER (94) PTHrP GKKKKGKPGKRREQEKKKRRT (46) DEDD KRPARGRATLGSQPKRRKSV (42, 97, 105) ISAV NP NLS1-region KAAFRQSRPKRSDYRKGQGSKAT Paper II ISAV NP NLS2-region SNIKANTTKPKKDSTYTIQGLRLSN Paper II Abbreviations: GGNNV - greasy grouper nervous necrosis virus (fish betanodavirus), MDV - Marek’s disease virus (avian alphaherpesvirus), HIV - human immunodeficiency virus (retrovirus), HTLV-I - Human T cell leukemia virus type I (retrovirus), PRRSV- porcine reproductive and respiratory syndrome virus (arterivirus), PTHrP - Parathyroid hormone-related peptide, DEDD - death effector domain-containing DNA-binding protein.
Recent studies have also revealed that when expressed in mammalian cells (COS cells) the
ISAV NP (Bremnes/98) is transported to the nucleolus but not to the nucleoplasma, indicating
36 that there is conserved mechanisms for the nucleolus localization in these cells (Fig. 4d, unpublished results). These results are in agreement with observations on protein α in fish betanodaviruses which also contains a NoLS that is functional in mammalian cells, while the
NLSs are not (42). However, in this context, the phenotypic variation with respect to nucleolus localization is surprising, and further studies are needed to verify the ISAV NoLS to determine whether the phenotypic difference observed is intrinsic to the NP, or affected by other viral proteins.
The localization of the NP to structures resembling Cajal bodies in transfected cells may also be of importance for viral pathogenicity as other viruses have been shown to modulate downstream antiviral effects by targeting such structures (47). Cajal bodies are nuclear organelles whose morphology and composition have been highly conserved from plants to animals (71). They contain the three eukaryotic RNA polymerases and a variety of factors involved in transcription and processing of all types of RNA (36). Thus, even though the NP localization to Cajal bodies was less prominent and only rarely observed in infected cells (Fig.
5 a), the prominent localization of the NP to these structures in transfected cells could imply that they are involved in ISAV replication.
37 CONCLUDING REMARKS AND FUTURE PERSPECTIVES
The present study has characterized the major structural proteins of the ISAV, including their localization in the virus particle and their key characteristics as compared to other viral proteins. Thus, this thesis contributes to the general understanding of the structure and replication of the ISAV, and provides decisive information for the development of subunit vaccines, and valuable information in the improvement of diagnostics. Also, potential therapeutic targets have been identified, and the organization of the activities associated to the surface proteins has been resolved, providing important information for the understanding of mechanisms controlling virulence.
In future studies, the isolation and characterization of avirulent ISAV isolates will be of major importance to establish mechanism used to induce increased ISAV virulence. However, this seems very complicated, and until then the verification of the F protein cleavage site and the importance of this structure should be of special interest. Although the pathogenicity of the
ISAV probably is polygenic as in other viruses, this may contribute to substantiate the importance of the HE HPR as a determinant of pathogenicity in the ISAV. Either way, the surface proteins should be investigated in concert, particularly since the F protein phenotype might be influenced by the HE. Also, the phenotypic variation observed between the
Bremnes/98 and Glesvaer/2/90 NP suggests that the nucleolus may be of functional significance to the ISAV replication. In the following, supplementary sequence data will be of great importance to understand the genetic basis for virulence in ISAV variants, with the hope that specific mutations will be indicators and thus predictors of virulence. Also, continued research to establish the coding assignment of the remaining ISAV genes, and to identify active sites, will be important to further understand the mechanisms utilized by this virus to generate virulent variants.
38
In recent years, F protein coiled-coils and fusion peptides have been the target for development of new anti-viral drugs, suggesting that F proteins might be important candidates both for vaccination and as therapeutic targets (27, 68, 113). In the present study, both peptides and antibodies were produced, but not tested due to the lack of a quantitative fusion assay. Thus, future studies will aim to establish such an assay to exploit the anti-viral effect of targeting these structures.
The diagnosis of ISA include pathological and haematological examinations as well as isolation of the pathogen in cell culture, ISAV-specific immunofluorescent antibody test
(IFAT) and/or reverse transcriptase polymerase chain reaction (RT-PCR) (23, 24, 26, 30, 31,
73). So far, the ISA IFAT has been based on the use of a monoclonal antibody towards the
HE (31), but the specificity of this antibody in diagnostics have been questioned, and special skills are required for interpretation (43). The present study draw attention to the potential of the NP as a diagnostic target using antibody based methods, as it is expressed in vast amounts in infected cells, and localize to the cell nucleus (Paper II). These are characteristics that could contribute to simplify the interpretation of the results by providing an additional means of verifying the specificity of the reaction, namely the nuclear localization, potentially improving both the specificity and sensitivity. Additionally, the NP is an internal protein in the virion, and should be expected to have less antigenic variation than the surface proteins that are exposed to the immune system of the host. Indeed, segment 6 encoding the HE, is one of the most variable genome segments in the ISAV (25, 59, 72, 80), and phenotypic variation, including antigenicity, has been related to this protein (41, 55, 56). In paper III we used a monoclonal antibody towards the NP which is commercially available (Aquatic Diagnostics
Ltd.). Although a mix of different monoclonal antibodies towards the NP would be optimal to
39 avoid false negative results due to phenotypic variation, this antibody probably represents a good alternative for use in antibody based diagnostics of the ISAV.
40 REFERENCES
1. Bagai, S., and R. A. Lamb. 1995. Quantitative measurement of paramyxovirus fusion: differences in requirements of glycoproteins between simian virus 5 and human parainfluenza virus 3 or Newcastle disease virus. J Virol 69:6712-9. 2. Baigent, S. J., and J. W. McCauley. 2003. Influenza type A in humans, mammals and birds: determinants of virus virulence, host-range and interspecies transmission. Bioessays 25:657- 71. 3. Barman, S., A. Ali, E. K. Hui, L. Adhikary, and D. P. Nayak. 2001. Transport of viral proteins to the apical membranes and interaction of matrix protein with glycoproteins in the assembly of influenza viruses. Virus Res 77:61-9. 4. Biering, E., K. Falk, E. Hoel, J. Thevarajan, M. Joerink, A. Nylund, C. Endresen, and B. Krossøy. 2002. Segment 8 encodes a structural protein of infectious salmon anaemia virus (ISAV); the co-linear transcript from Segment 7 probably encodes a non-structural or minor structural protein. Dis Aquat Organ 49:117-22. 5. Blake, S., D. Bouchard, W. Keleher, M. Opitz, and B. L. Nicholson. 1999. Genomic relationships of the North American isolate of infectious salmon anemia virus (ISAV) to the Norwegian strain of ISAV. Dis Aquat Organ 35:139-44. 6. Bouchard, D. A., K. Brockway, C. Giray, W. Keleher, and P. L. Merrill. 2001. First report of infectious salmon anemia (ISA) in the United States. Bull Eur Assoc Fish Pathol 21:86-88. 7. Brown, E. G. 1990. Increased virulence of a mouse-adapted variant of influenza A/FM/1/47 virus is controlled by mutations in genome segments 4, 5, 7, and 8. J Virol 64:4523-33. 8. Brown, E. G. 2000. Influenza virus genetics. Biomed Pharmacother 54:196-209. 9. Brown, E. G., H. Liu, L. C. Kit, S. Baird, and M. Nesrallah. 2001. Pattern of mutation in the genome of influenza A virus on adaptation to increased virulence in the mouse lung: identification of functional themes. Proc Natl Acad Sci U S A 98:6883-8. 10. Brown, I. H., S. Ludwig, C. W. Olsen, C. Hannoun, C. Scholtissek, V. S. Hinshaw, P. A. Harris, J. W. McCauley, I. Strong, and D. J. Alexander. 1997. Antigenic and genetic analyses of H1N1 influenza A viruses from European pigs. J Gen Virol 78:553-62. 11. Bui, M., E. G. Wills, A. Helenius, and G. R. Whittaker. 2000. Role of the influenza virus M1 protein in nuclear export of viral ribonucleoproteins. J Virol 74:1781-1786. 12. Chen, H., T. Wurm, P. Britton, G. Brooks, and J. A. Hiscox. 2002. Interaction of the coronavirus nucleoprotein with nucleolar antigens and the host cell. J Virol 76:5233-50. 13. Chen, J., K. H. Lee, D. A. Steinhauer, D. J. Stevens, J. J. Skehel, and D. C. Wiley. 1998. Structure of the hemagglutinin precursor cleavage site, a determinant of influenza pathogenicity and the origin of the labile conformation. Cell 95:409-17. 14. Chen, Z., and R. M. Krug. 2000. Selective nuclear export of viral mRNAs in influenza- virus-infected cells. Trends Microbiol 8:376-83. 15. Christie, K. E., B. Hjeltnes, I. Uglenes, and J. R. Winton. 1993. Determination of buoyant density and sensitivity to chloroform and freon for the etiologic agent of infectious salmon anaemia. Dis Aquat Org 15:225-228. 16. Clouthier, S. C., T. Rector, N. E. Brown, and E. D. Anderson. 2002. Genomic organization of infectious salmon anaemia virus. J Gen Virol 83:421-8. 17. Collins, M. S., J. B. Bashiruddin, and D. J. Alexander. 1993. Deduced amino acid sequences at the fusion protein cleavage site of Newcastle disease viruses showing variation in antigenicity and pathogenicity. Arch Virol 128:363-70. 18. Colman, P. M., and M. C. Lawrence. 2003. The structural biology of type I viral membrane fusion. Nat Rev Mol Cell Biol 4:309-19. 19. Cook-Versloot, M., S. Griffiths, R. Cusack, S. McGeachy, and R. Ritchie. 2004. Identification and characterisation of infectious salmon anaemia virus (ISAV) haemagglutinin gene highly polymorphic region (HPR) type 0 in North America. Bulletin of the European Association of Fish Pathologists 24:203-208.
41 20. Cunningham, C. O., A. Gregory, J. Black, I. Simpson, and R. Raynard. 2002. A novel variant of the infectious salmon anaemia virus (ISAV) haemagglutinin gene suggests mechanisms for virus diversity. Bull Eur Assic Fish Pathol 22:366-374. 21. Cunningham, C. O., and M. Snow. 2000. Genetic analysis of infectious salmon anaemia virus (ISAV) from Scotland. Dis Aquat Organ 41:1-8. 22. Dang, C. V., and W. M. Lee. 1989. Nuclear and nucleolar targeting sequences of c-erb-A, c- myb, N-myc, p53, HSP70, and HIV tat proteins. J Biol Chem 264:18019-23. 23. Dannevig, B. H., K. Falk, and E. Namork. 1995. Isolation of the causal virus of infectious salmon anemia (ISA) in a long-term cell-line from Atlantic salmon head kidney. J Gen Virol 76:1353-1359. 24. Dannevig, B. H., K. Falk, and C. M. Press. 1995. Propagation of infectious salmon anemia (ISA) virus in cell culture. Vet Res 26:438-442. 25. Devold, M., K. Falk, B. Dale, B. Krossøy, E. Biering, V. Aspehaug, F. Nilsen, and A. Nylund. 2001. Strain variation, based on the hemagglutinin gene, in Norwegian ISA virus isolates collected from 1987 to 2001: indications of recombination. Dis Aquat Organ 47:119- 28. 26. Devold, M., B. Krossøy, V. Aspehaug, and A. Nylund. 2000. Use of RT-PCR for diagnosis of infectious salmon anaemia virus (ISAV) in carrier sea trout (Salmo trutta) after experimental infection. Dis Aquat Organ 40:9-18. 27. Eckert, D. M., and P. S. Kim. 2001. Mechanisms of viral membrane fusion and its inhibition. Annu Rev Biochem 70:777-810. 28. Eliassen, T. M., M. K. Frøystad, B. H. Dannevig, M. Jankowska, A. Brech, K. Falk, K. Romøren, and T. Gjøen. 2000. Initial events in infectious salmon anemia virus infection: evidence for the requirement of a low-pH step. J Virol 74:218-227. 29. Epand, R. M. 2003. Fusion peptides and the mechanism of viral fusion. Biochim Biophys Acta 1614:116-21. 30. Falk, K., and B. H. Dannevig. 1995. Demonstration of infectious salmon anaemia (ISA) viral antigens in cell cultures and tissue sections. Vet Res 26:499-504. 31. Falk, K., E. Namork, and B. H. Dannevig. 1998. Characterization and applications of a monoclonal antibody against infectious salmon anaemia virus. Dis Aquat Org 34:77-85. 32. Falk, K., E. Namork, E. Rimstad, S. Mjaaland, and B. H. Dannevig. 1997. Characterization of infectious salmon anemia virus, an orthomyxo-like virus isolated from Atlantic salmon (Salmo salar L.). J Virol Dec:9016-9023. 33. Falk, K., C. M. Press, T. Landsverk, and B. H. Dannevig. 1995. Spleen and kidney of Atlantic salmon (Salmo salar L.) show histochemical changes early in the course of experimentally induced infectious salmon anaemia (ISA). Vet Immunol Immunopathol 49:115-26. 34. Favre, D., E. Studer, and M. R. Michel. 1994. Two nucleolar targeting signals present in the N-terminal part of Semliki Forest virus capsid protein. Arch Virol 137:149-55. 35. Fodor, E., D. C. Pritlove, and G. G. Brownlee. 1994. The influenza virus panhandle is involved in the initiation of transcription. J Virol 68:4092-6. 36. Gall, J. G. 2001. A role for Cajal bodies in assembly of the nuclear transcription machinery. FEBS Lett 498:164-7. 37. Garten, W., F. X. Bosch, D. Linder, R. Rott, and H. D. Klenk. 1981. Proteolytic activation of the influenza virus hemagglutinin: The structure of the cleavage site and the enzymes involved in cleavage. Virology 115:361-74. 38. Glickman, R. L., R. J. Syddall, R. M. Iorio, J. P. Sheehan, and M. A. Bratt. 1988. Quantitative basic residue requirements in the cleavage-activation site of the fusion glycoprotein as a determinant of virulence for Newcastle disease virus. J Virol 62:354-6. 39. Goatley, L. C., M. B. Marron, S. C. Jacobs, J. M. Hammond, J. E. Miskin, C. C. Abrams, G. L. Smith, and L. K. Dixon. 1999. Nuclear and nucleolar localization of an African swine fever virus protein, I14L, that is similar to the herpes simplex virus-encoded virulence factor ICP34.5. J Gen Virol 80 ( Pt 3):525-35. 40. Goto, H., and Y. Kawaoka. 1998. A novel mechanism for the acquisition of virulence by a human influenza A virus. Proc Natl Acad Sci U S A 95:10224-10228.
42 41. Griffiths, S., M. Cook, B. Mallory, and R. Ritchie. 2001. Characterisation of ISAV proteins from cell culture. Dis Aquat Org 45:19-24. 42. Guo, Y. X., K. Dallmann, and J. Kwang. 2003. Identification of nucleolus localization signal of betanodavirus GGNNV protein alpha. Virology 306:225-35. 43. Hastings, T., G. Olivier, R. Cusack, I. Bricknell, A. Nylund, and M. Binde. 1999. Infectious Salmon Anaemia. Bull Eur Ass Fish Pathol 19:286- 288. 44. Hellebø, A., U. Vilas, K. Falk, and R. Vlasak. 2004. Infectious salmon anemia virus specifically binds to and hydrolyzes 4-O-acetylated sialic acids. J Virol 78:3055-62. 45. Heminway, B. R., Y. Yu, and M. S. Galinski. 1994. Paramyxovirus mediated cell fusion requires co-expression of both the fusion and hemagglutinin-neuraminidase glycoproteins. Virus Res 31:1-16. 46. Henderson, J. E., N. Amizuka, H. Warshawsky, D. Biasotto, B. M. Lanske, D. Goltzman, and A. C. Karaplis. 1995. Nucleolar localization of parathyroid hormone-related peptide enhances survival of chondrocytes under conditions that promote apoptotic cell death. Mol Cell Biol 15:4064-75. 47. Hiscox, J. A. 2002. The nucleolus - a gateway to viral infection? Arch Virol 147:1077-89. 48. Horvath, C. M., M. A. Williams, and R. A. Lamb. 1990. Eukaryotic coupled translation of tandem cistrons: identification of the influenza B virus BM2 polypeptide. EMBO J 9:2639-47. 49. Hovland, T., A. Nylund, K. Watanabe, and C. Endresen. 1994. Observation of infectious salmon anaemia virus in Atlantic salmon, Salmo salar L. J Fish Dis 17:291-296. 50. Hu, X. L., R. Ray, and R. W. Compans. 1992. Functional interactions between the fusion protein and hemagglutinin-neuraminidase of human parainfluenza viruses. J Virol 66:1528- 1534. 51. Hunter, E. 2001. General virology: Virus assembly, p. 171-197. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A., R. B., and S. E. Straus (ed.), Fields virology, 4th ed. ed. Lippincott-Raven, Philadelphia, Pa. 52. Håstein, T., B. J. Hill, and J. R. Winton. 1999. Successful aquatic animal disease emergency programmes. Rev sci tech Off int Epiz 18:214-227. 53. Inglis, J. A., J. Bruce, and C. O. Cunningham. 2000. Nucleotide sequence variation in isolates of infectious salmon anaemia virus (ISAV) from Atlantic salmon (Salmo salar) in Scotland and Norway. Dis Aquat Organ 43:71-6. 54. Kibenge, F. S., O. N. Garate, G. Johnson, R. Arriagada, M. J. Kibenge, and D. Wadowska. 2001. Isolation and identification of infectious salmon anaemia virus (ISAV) from Coho salmon in Chile. Dis Aquat Organ 45:9-18. 55. Kibenge, F. S., M. J. Kibenge, P. K. McKenna, P. Stothard, R. Marshall, R. R. Cusack, and S. McGeachy. 2001. Antigenic variation among isolates of infectious salmon anaemia virus correlates with genetic variation of the viral haemagglutinin gene. J Gen Virol 82:2869- 79. 56. Kibenge, F. S., J. R. Lyaku, D. Rainnie, and K. L. Hammell. 2000. Growth of infectious salmon anaemia virus in CHSE-214 cells and evidence for phenotypic differences between virus strains. J Gen Virol 81:143-150. 57. Kibenge, F. S., K. Munir, M. J. Kibenge, T. Joseph, and E. Moneke. 2004. Infectious salmon anemia virus: causative agent, pathogenesis and immunity. Anim Health Res Rev 5:65-78. 58. Kristiansen, M., M. K. Frøystad, A. L. Rishovd, and T. Gjøen. 2002. Characterization of the receptor-destroying enzyme activity from infectious salmon anaemia virus. J Gen Virol 83:2693-7. 59. Krossøy, B., M. Devold, L. Sanders, P. M. Knappskog, V. Aspehaug, K. Falk, A. Nylund, S. Koumans, C. Endresen, and E. Biering. 2001. Cloning and identification of the infectious salmon anaemia virus haemagglutinin. J Gen Virol 82:1757-65. 60. Krossøy, B., I. Hordvik, F. Nilsen, A. Nylund, and C. Endresen. 1999. The putative polymerase sequence of infectious salmon anemia virus suggests a new genus within the Orthomyxoviridae. J Virol 73:2136-42.
43 61. Kubota, S., H. Siomi, T. Satoh, S. Endo, M. Maki, and M. Hatanaka. 1989. Functional similarity of HIV-I rev and HTLV-I rex proteins: identification of a new nucleolar-targeting signal in rev protein. Biochem Biophys Res Commun 162:963-70. 62. Lai, M. M. C., and K. V. Holmes. 2001. Coronaviridae: The viruses and their replication, p. 1163-1185. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A., R. B., and S. E. Straus (ed.), Fields virology, 4th ed. Lippincott-Raven, Philadelphia, Pa. 63. Lamb, R. A., and P. W. Choppin. 1977. Synthesis of influenza virus polypeptides in cells resistant to alpha-amanitin: evidence for the involvement of cellular RNA polymerase II in virus replication. J Virol 23:816-819. 64. Lamb, R. A., and D. Kolakofsky. 2001. Paramyxoviridae: The viruses and their replication, p. 1305-1340. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A., R. B., and S. E. Straus (ed.), Fields virology, 4th ed. Lippincott-Raven, Philadelphia, Pa. 65. Lamb, R. A., and R. M. Krug. 2001. Orthomyxoviridae: The viruses and their replication, p. 1487-1579. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A., R. B., and S. E. Straus (ed.), Fields virology, 4th ed. Lippincott-Raven, Philadelphia, Pa. 66. Lin, D. A., S. Roychoudhury, P. Palese, W. C. Clay, and F. J. Fuller. 1991. Evolutionary relatedness of the predicted gene product of RNA segment 2 of the tick-borne Dhori virus and the PB1 polymerase gene of influenza viruses. Virology 182:1-7. 67. Liu, J. L., L. F. Lee, Y. Ye, Z. Qian, and H. J. Kung. 1997. Nucleolar and nuclear localization properties of a herpesvirus bZIP oncoprotein, MEQ. J Virol 71:3188-96. 68. Louis, J. M., I. Nesheiwat, L. Chang, G. M. Clore, and C. A. Bewley. 2003. Covalent trimers of the internal N-terminal trimeric coiled-coil of gp41 and antibodies directed against them are potent inhibitors of HIV envelope-mediated cell fusion. J Biol Chem 278:20278-85. 69. Lovely, J. E., B. H. Dannevig, K. Falk, L. Hutchin, A. M. MacKinnon, K. J. Melville, E. Rimstad, and S. G. Griffiths. 1999. First identification of infectious salmon anaemia virus in North America with haemorrhagic kidney syndrome. Dis Aquat Organ 35:145-8. 70. Martin, K., and A. Helenius. 1991. Nuclear transport of influenza virus ribonucleoproteins: the viral matrix protein (M1) promotes export and inhibits import. Cell 67:117-30. 71. Matera, A. G. 1998. Of coiled bodies, gems, and salmon. J Cell Biochem 70:181-92. 72. Mjaaland, S., O. Hungnes, A. Teig, B. H. Dannevig, K. Thorud, and E. Rimstad. 2002. Polymorphism in the infectious salmon anemia virus hemagglutinin gene: importance and possible implications for evolution and ecology of infectious salmon anemia disease. Virology 304:379-91. 73. Mjaaland, S., E. Rimstad, K. Falk, and B. H. Dannevig. 1997. Genomic characterization of the virus causing infectious salmon anemia in Atlantic salmon (Salmo salar L.): an orthomyxo-like virus in a teleost. J Virol 71:7681-7686. 74. Moneke, E. E., M. J. Kibenge, D. Groman, G. R. Johnson, B. O. Ikede, and F. S. Kibenge. 2003. Infectious salmon anemia virus RNA in fish cell cultures and in tissue sections of Atlantic salmon experimentally infected with infectious salmon anemia virus. J Vet Diagn Invest 15:407-17. 75. Morrison, T. G. 2003. Structure and function of a paramyxovirus fusion protein. Biochim Biophys Acta 1614:73-84. 76. Mould, J. A., R. G. Paterson, M. Takeda, Y. Ohigashi, P. Venkataraman, R. A. Lamb, and L. H. Pinto. 2003. Influenza B virus BM2 protein has ion channel activity that conducts protons across membranes. Dev Cell 5:175-84. 77. Mullins, J. E., D. Groman, and D. Wadowska. 1998. Infectious salmon anaemia in salt water Atlantic salmon (Salmo salar L.) in New Brunswick, Canada. Bull Eur Assic Fish Pathol 18:110-114. 78. Nayak, D. P., E. K. Hui, and S. Barman. 2004. Assembly and budding of influenza virus. Virus Res 106:147-65. 79. Neumann, G., M. R. Castrucci, and Y. Kawaoka. 1997. Nuclear import and export of influenza virus nucleoprotein. J Virol 71:9690-700. 80. Nylund, A., M. Devold, H. Plarre, E. Isdal, and M. Aarseth. 2003. Emergence and maintenance of infectious salmon anaemia virus (ISAV) in Europe: a new hypothesis. Dis Aquat Organ 56:11-24.
44 81. Nylund, A., T. Hovland, K. Watanabe, and C. Endresen. 1995. Presence of infectious salmon anemia virus (ISAV) in tissues of Atlantic salmon, Salmo salar L, collected during 3 separate outbreaks of the disease. J Fish Dis 18:135-145. 82. Nylund, A., B. Krossøy, K. Watanabe, and J. A. Holm. 1996. Target cells for the ISA virus in Atlantic salmon, Salmo salar L. Bulletin of the European Association of Fish Pathology 16:68-72. 83. Paterson, R. G., M. A. Shaughnessy, and R. A. Lamb. 1989. Analysis of the relationship between cleavability of a paramyxovirus fusion protein and length of the connecting peptide. J Virol 63:1293-301. 84. Peisajovich, S. G., and Y. Shai. 2003. Viral fusion proteins: multiple regions contribute to membrane fusion. Biochim Biophys Acta 1614:122-9. 85. Perdue, M. L., and D. L. Suarez. 2000. Structural features of the avian influenza virus hemagglutinin that influence virulence. Vet Microbiol 74:77-86. 86. Regl, G., A. Kaser, M. Iwersen, H. Schmid, G. Kohla, B. Strobl, U. Vilas, R. Schauer, and R. Vlasak. 1999. The hemagglutinin-esterase of mouse hepatitis virus strain S is a sialate-4-O-acetylesterase. J Virol 73:4721-7. 87. Rimstad, E., S. Mjaaland, M. Snow, A. B. Mikalsen, and C. O. Cunningham. 2001. Characterization of the infectious salmon anemia virus genomic segment that encodes the putative hemagglutinin. J Virol 75:5352-6. 88. Ritchie, R. J., A. Bardiot, K. Melville, S. Griffiths, C. O. Cunningham, and M. Snow. 2002. Identification and characterisation of the genomic segment 7 of the infectious salmon anaemia virus genome. Virus Res 84:161-70. 89. Ritchie, R. J., M. Cook, K. Melville, N. Simard, R. Cusack, and S. Griffith. 2001. Identification of infectious salmon anaemia virus in Atlantic salmon from Nova Scotia (Canada): evidence for functional strain differences. Dis Aquat Organ 44:171-8. 90. Ritchie, R. J., J. Heppell, M. B. Cook, S. Jones, and S. G. Griffiths. 2001. Identification and characterization of segments 3 and 4 of the ISAV genome. Virus Genes 22:289-97. 91. Rodger, H. D., and R. H. Richards. 1998. Haemorrhagic smolt syndrome: a severe anaemic condition in farmed salmon in Scotland. The Veterinary Record:538-541. 92. Rosenthal, P. B., X. Zhang, F. Formanowski, W. Fitz, C. H. Wong, H. Meier-Ewert, J. J. Skehel, and D. C. Wiley. 1998. Structure of the haemagglutinin-esterase-fusion glycoprotein of influenza C virus. Nature 396:92-96. 93. Rowland, R. R., P. Schneider, Y. Fang, S. Wootton, D. Yoo, and D. A. Benfield. 2003. Peptide domains involved in the localization of the porcine reproductive and respiratory syndrome virus nucleocapsid protein to the nucleolus. Virology 316:135-45. 94. Rowland, R. R., and D. Yoo. 2003. Nucleolar-cytoplasmic shuttling of PRRSV nucleocapsid protein: a simple case of molecular mimicry or the complex regulation by nuclear import, nucleolar localization and nuclear export signal sequences. Virus Res 95:23-33. 95. Russell, C. J., T. S. Jardetzky, and R. A. Lamb. 2004. Conserved glycine residues in the fusion peptide of the paramyxovirus fusion protein regulate activation of the native state. J Virol 78:13727-42. 96. Sandvik, T., E. Rimstad, and S. Mjaaland. 2000. The viral RNA 3'- and 5'-end structure and mRNA transcription of infectious salmon anaemia virus resemble those of influenza viruses. Arch Virol 145:1659-1669. 97. Schickling, O., A. H. Stegh, J. Byrd, and M. E. Peter. 2001. Nuclear localization of DEDD leads to caspase-6 activation through its death effector domain and inhibition of RNA polymerase I dependent transcription. Cell Death Differ 8:1157-68. 98. Schyth, B. D., N. J. Olesen, P. Østergård, and K. Falk. 2003. Presented at the Diseases of Fish and Shellfish, 11 th International Conference of the EAFP, Malta. 99. Siomi, H., H. Shida, S. H. Nam, T. Nosaka, M. Maki, and M. Hatanaka. 1988. Sequence requirements for nucleolar localization of human T cell leukemia virus type I pX protein, which regulates viral RNA processing. Cell 55:197-209. 100. Skehel, J. J., and D. C. Wiley. 2000. Receptor binding and membrane fusion in virus entry: The influenza hemagglutinin. Annu Rev Biochem 69:531-569.
45 101. Snow, M., and C. O. Cunningham. 2001. Characterisation of the putative nucleoprotein gene of infectious salmon anaemia virus (ISAV). Virus Res 74:111-118. 102. Snow, M., A. J. A. McBeath, R. Paley, S. Duraffour, V. Aspehaug, E. Biering, C. J. Secombes, and B. Collet. (manuscript in prep). Identification of an interferon antagonist protein encoded by segment 7 of infectious salmon anaemia virus. 103. Snow, M., R. Ritchie, O. Arnaud, S. Villoing, V. Aspehaug, and C. O. Cunningham. 2003. Isolation and characterisation of segment 1 of the infectious salmon anaemia virus genome. Virus Res 92:99-105. 104. Sommerset, I., B. Krossøy, E. Biering, and P. Frost. 2005. Vaccines for fish in aquaculture. Expert Rev Vaccines 4:89-101. 105. Stegh, A. H., O. Schickling, A. Ehret, C. Scaffidi, C. Peterhansel, T. G. Hofmann, I. Grummt, P. H. Krammer, and M. E. Peter. 1998. DEDD, a novel death effector domain- containing protein, targeted to the nucleolus. EMBO J 17:5974-86. 106. Steinhauer, D. A. 1999. Role of hemagglutinin cleavage for the pathogenicity of influenza virus. Virology 258:1-20. 107. Steinhauer, D. A., and J. J. Skehel. 2002. Genetics of influenza viruses. Annu Rev Genet 36:305-32. 108. Suarez, D. L., D. A. Senne, J. Banks, I. H. Brown, S. C. Essen, C. W. Lee, R. J. Manvell, C. Mathieu-Benson, V. Moreno, J. C. Pedersen, B. Panigrahy, H. Rojas, E. Spackman, and D. J. Alexander. 2004. Recombination resulting in virulence shift in avian influenza outbreak, Chile. Emerg Infect Dis 10:693-9. 109. Tashiro, M., N. L. McQueen, and J. T. Seto. 1999. Determinants of organ tropism of sendai virus. Front Biosci 4:D642-5. 110. Thorud, K. 1991. Infectious salmon anaemia: transmission trials, haematological, clinical chemical and morphological investigations. Ph.D. Norwegian College of Veterinary Medicine, Oslo, Norway. 111. Thorud, K., and H. O. Djupvik. 1988. Infectious salmon anaemia in Atlantic salmon (Salmo salar L.). Bull Eur Assoc Fish Pathol 8:109-111. 112. Toyoda, T., T. Sakaguchi, K. Imai, N. M. Inocencio, B. Gotoh, M. Hamaguchi, and Y. Nagai. 1987. Structural comparison of the cleavage-activation site of the fusion glycoprotein between virulent and avirulent strains of Newcastle disease virus. Virology 158:242-7. 113. Vareckova, E., V. Mucha, S. A. Wharton, and F. Kostolansky. 2003. Inhibition of fusion activity of influenza A haemagglutinin mediated by HA2-specific monoclonal antibodies. Arch Virol 148:469-86. 114. Weber, F., G. Kochs, S. Gruber, and O. Haller. 1998. A classical bipartite nuclear localization signal on Thogoto and influenza A virus nucleoproteins. Virology 250:9-18. 115. Wu, E., and G. R. Nemerow. 2004. Virus yoga: the role of flexibility in virus host cell recognition. Trends Microbiol 12:162-9. 116. Wurm, T., H. Chen, T. Hodgson, P. Britton, G. Brooks, and J. A. Hiscox. 2001. Localization to the nucleolus is a common feature of coronavirus nucleoproteins, and the protein may disrupt host cell division. J Virol 75:9345-56. 117. Yamada, H., Y. M. Jiang, H. Y. Zhu, K. Inagaki-Ohara, and Y. Nishiyama. 1999. Nucleolar localization of the UL3 protein of herpes simplex virus type 2. J Gen Virol 80 ( Pt 8):2157-64. 118. Yoo, D., S. K. Wootton, G. Li, C. Song, and R. R. Rowland. 2003. Colocalization and interaction of the porcine arterivirus nucleocapsid protein with the small nucleolar RNA- associated protein fibrillarin. J Virol 77:12173-83. 119. Zhu, J., C. W. Zhang, Y. Qi, P. Tien, and G. F. Gao. 2002. The fusion protein core of measles virus forms stable coiled-coil trimer. Biochem Biophys Res Commun 299:897-902.
46
Paper I JOURNAL OF VIROLOGY, Mar. 2004, p. 3063–3071 Vol. 78, No. 6 0022-538X/04/$08.00ϩ0 DOI: 10.1128/JVI.78.6.3063–3071.2004 Copyright © 2004, American Society for Microbiology. All Rights Reserved.
Identification and Characterization of Viral Structural Proteins of Infectious Salmon Anemia Virus Knut Falk,1* Vidar Aspehaug,1,2 Reinhard Vlasak,3 and Curt Endresen2 Section for Fish Health, National Veterinary Institute, Oslo,1 and Department of Fisheries and Marine Biology, University of Bergen, Bergen,2 Norway, and Institute of Molecular Biology, Austrian Academy of Sciences, Salzburg, Austria3
Received 21 September 2003/Accepted 24 November 2003
Infectious salmon anemia virus (ISAV) is an unclassified Orthomyxovirus that has been shown to contain a segmented genome with eight single-stranded RNA species coding for 10 viral proteins. Four major structural proteins were characterized in the present study: two glycosylated proteins with estimated molecular masses of 42 and 50 kDa, one 66-kDa phosphoprotein, and one 22-kDa protein. Examination of lysed virions revealed the two glycoproteins and the 22-kDa protein in the soluble fraction, while the 66-kDa phosphoprotein and a minor part of the 22-kDa protein were found in the pelleted fraction. Immunofluorescence staining of infected cells demonstrated that the 22-kDa protein was a late protein accumulating in the nucleus. We conclude that the 66-kDa protein is the nucleoprotein, the 22-kDa protein is the matrix protein, and the 42- and 50-kDa proteins are the surface proteins. Radioimmunoprecipitation analysis of the 42-kDa glycoprotein, which was previously shown to represent the ISAV hemagglutinin, indicated that this protein exists at least as dimers. Further, by labeling of purified ISAV with [1,3-3H]diisopropyl fluorophosphate, it was also demonstrated that the viral esterase is located with the hemagglutinin. This finding was confirmed by demonstration of acetyles- terase activity in affinity-purified hemagglutinin preparations. Finally, the active-site serine residue could be tentatively identified at position 32 within the amino acid sequence of the hemagglutinin of ISAV strain Glesvaer/2/90. It is proposed that the ISAV vp66 protein be termed nucleoprotein, the gp42 protein be termed HE protein, and the vp22 protein be termed matrix protein.
Infectious salmon anemia (ISA) is one of the most impor- Influenza A and B viruses contain four major structural tant viral diseases in farmed Atlantic salmon (Salmo salar L). proteins and six minor proteins. The major proteins include The disease was first described for salmon parr in a hatchery the nucleoprotein (NP), which interacts with the viral RNA on the southwest coast of Norway in 1984 (34), and later the together with the polymerases (PB1, PB2, and PA) to form the disease was also observed in Canada, Scotland, the Faroe Is- viral ribonucleoprotein (vRNP) complex. The matrix protein lands, and the United States (2, 4, 26, 30). In addition, the ISA (M1) is the most abundant structural protein and is believed to virus has been observed in Pacific coho salmon (Oncorhyncus form a bridge between the vRNPs and the viral membrane. kisutch) in Chile (1, 13) and in rainbow trout (Oncorhyncus The two other major structural proteins of the virion are inte- mykiss) in Ireland. gral to the viral envelope. The hemagglutinin (HA) is a ho- The ISA virus has been shown to share several morpholog- motrimeric glycoprotein with receptor-binding and acid-acti- ical, physiochemical, and biochemical characteristics with the vated membrane fusion activity, and the neuraminidase is a influenza viruses, suggesting that it belongs to the Orthomyxo- homotetramer with receptor-destroying enzyme (RDE) activ- viridae (12, 18, 24). These characteristics include a single- ity. Influenza C virus has only seven gene segments and has one stranded RNA genome that consists of eight segments with a surface glycoprotein, the HA-esterase (HE) protein. Further, tentative negative polarity (24), conservation of partially self- while the RDEs of influenza A and B viruses are neuramini- complementary terminal ends of the genomic segments (32), a dases, the RDE of influenza C virus is an esterase (21). replication strategy that both includes RNA production and ISAV has been shown to possess hemagglutinating, RDE, protein accumulation in the nucleus (12, 32), morphological and fusion activities (9, 12). The RDE has been suggested to be similarities, and the ability to hemagglutinate red blood cells an acetylesterase with specificity different from that of influ- (RBC) (12). The nucleotide sequences of all ISAV genome enza C virus (12). Recently, it was found that 4-O-acetylated segments have now been published (3, 6, 18, 19, 24, 29, 33). In sialic acids serve both as a substrate for the RDE and as a common with the influenza A and B viruses, segments 7 and 8 receptor determinant for virus binding (12a). Four major struc- reveal two open reading frames (ORFs), while the others con- tural proteins with estimated molecular masses of 71, 53, 43, tain one ORF each. No significant sequence homology with the and 24 kDa have been detected in purified ISAV particles (12, influenza viruses was found, although some sequence similar- 14). Further, by immunoprecipitation of lysates from radiola- ities suggesting coding assignment of the different genes have beled infected cells, Kibenge et al. (14) detected a total of 12 been reported. proteins. It is currently unknown whether these additional pro- teins represent minor structural proteins, precursor proteins, or breakdown products. Based on functional analysis and pro- * Corresponding author. Mailing address: Section for Fish Health, National Veterinary Institute, P.O. Box 8156 dep, N-0033 Oslo, Nor- tein expression, the 43-kDa protein has been suggested to way. Phone: 47 23 21 61 32. Fax: 47 23 21 61 01. E-mail: Knut.Falk represent the HA and to be coded by genome segment 6 (6, 17, @vetinst.no. 28). The 71-kDa protein has been suggested to be encoded by
3063 3064 FALK ET AL. J. VIROL. segment 3 and to represent the NP, though no experimental diography (see below). Noninfected, radiolabeled cell lysates were used as data supporting this assumption have been presented (6, 29). controls. SDS-PAGE and Western blotting. Samples were treated with dissociation Recently the 24-kDa structural protein was linked to one of the buffer (50 mM Tris-HCl [pH 6.8], 1% SDS, 50 mM dithiothreitol, 8 mM EDTA, two ORFs of segment 8 (3), and the 53-kDa was linked to 0.01% bromophenol blue) and heated for 5 min at 95°C. In the nonreduced segment 5 (6); however, no function or characterization of samples, dithiothreitol was omitted and incubation was for 30 min at RT. The these two proteins has so far been presented. proteins were then separated by SDS-PAGE with the discontinuous system In the present study we confirm the four major structural devised by Laemmli (20) and 0.5-mm-thick precast 12.5% polyacrylamide gels (ExcelGel SDS; Amersham Biosciences). 14C-methylated marker proteins (Am- proteins and also document that the virus has one surface ersham Biosciences; range, 14.3 to 220 kDa) were run in adjacent lanes. For glycoprotein in addition to the earlier-described HA. We have autoradiography, the gel was fixed in 10% acetic acid–40% ethanol in double- also demonstrated, for the first time, that the HA is an HE distilled water for 30 min, treated with Amplify (Amersham Biosciences) con- protein. Furthermore, we provide both experimental data taining 3% glycerol for 30 min, dried, and exposed to X-ray film at Ϫ80°C. showing that the 22-kDa major structural protein is the matrix For Western blotting, separated proteins were transferred to a nitrocellulose membrane in a semidry electroblotter (NovaBlot; Amersham Biosciences). The (M) protein and data indicating that the 66-kDa protein rep- protein blot was then treated with blocking solution (PBS containing 1% Tween resents the NP. 20 and 5% nonfat dry milk) overnight at 4°C, followed by incubation for2hat RT with the primary rabbit immune serum diluted in blocking solution. The membrane was washed three times in blocking solution and reacted with a goat MATERIALS AND METHODS anti-rabbit–horseradish peroxidase (HRP) conjugate for 1 h at RT. Diamino- Virus and cells. The Norwegian ISA virus isolate Glesvaer/2/90 (7) was used benzidine was used for detection of bound HRP conjugate. throughout this study. Cultures of SHK cells (7) or ASK cells (8) were used for For staining of glycosylated proteins with lectins, the protein blot was first virus propagation. The cells were grown at 20°C in Leibovitz L-15 medium (L-15) treated with PBS with 0.1% Tween 20 and 5% BSA overnight at 4°C. The protein Ϫ supplemented with 5% (SHK cells) or 10% (ASK cells) fetal bovine serum, blot was then reacted with 15 mg of biotinylated concanavalin A (Sigma) ml 1 Ϫ glutamine (4 mM), and gentamicin (50 gml 1). Cells were incubated at 15°C diluted in PBS with 0.1% Tween 20 and 1% BSA. The membrane was washed after inoculation with virus. Unless otherwise stated, cells with the fluid overlay three times in PBS with 0.1% Tween 20 and reacted with HRP-conjugated removed were inoculated with virus at a multiplicity of infection of 0.1 in serum streptavidin for1hatRT.Bound HRP-conjugate was detected as described free L-15. All assays were performed with the fourth or fifth passage of the virus. above. Infectivity titrations were done by end point titration in 96-well culture plates as Labeling of ISAV protein with [1,3-3H]diisopropyl fluorophosphate (DFP) previously described (11). (New England Nuclear; specific activity, 310.8 GBq/mmol) was done by incubat- For preparation of radiolabeled whole virus, 25 Ci of [35S]methionine (Pro- ing purified ISAV, containing 2 mU of esterase activity, with 74,000 Bq of Ϫ Mix; Amersham Biosciences) ml 1 was added to SHK cell cultures in 175-cm2 [3H]DFP for1hatRT,followed by an overnight incubation at 4°C. Reduced and tissue culture flasks at 1 day postinfection (p.i.), and incubation was continued nonreduced viral proteins were analyzed by electrophoresis on SDS–12 and 8% for 3 days before harvest of the virus-containing cell culture medium. Radiola- polyacrylamide gels, respectively. The gels were then incubated with Amplify, beled cell lysates were prepared by infecting confluent monolayers of ASK cells dried, and subjected to fluorography. in 25-cm2 tissue culture flasks. Following a 4-h adsorption period, 350 Ci of The autoradiographs and blots were scanned in a desktop scanner (Image [35S]methionine, 350 Ci of [3H]mannose (Amersham Biosciences), or 350 Ci Scanner; Amersham Biosciences) and subsequently analyzed and printed by Ϫ pf [32P]phosphate (Amersham Biosciences) ml 1 in 2.5 ml of methionine-, man- using Gel-Pro gel scanning software (Media Cybernetics, Silver Spring, Md.). nose-, or phosphate-free medium was added, and incubation was continued for Deglycosylation of viral glycoprotein. Immunoprecipitated [35S]methionine- 24 h. The cell cultures were then washed twice with PBS and lysed on ice for 15 labeled viral proteins were heated at 95°C for 5 min in TNE buffer (10 mM min in lysis buffer (50 mM Tris [pH 7.6], 150 mM NaCl, 1% NP-40, 0.5% sodium Tris-HCl [pH 7.2], 100 mM NaCl, 1 mM EDTA) with 0.05% SDS. N-Octylgly- deoxycholate), and insoluble debris were removed by centrifugation at 14,000 coside (Roche) was added to 0.5%, and then the mixture was briefly heated again rpm (20,000 ϫ g) for 20 min at 4°C. Lysates were stored at Ϫ80°C until used. to 95°C and incubated overnight at 37°C with or without2UofN-glycosidase-F Ϫ Antibodies. Antibodies used in the present study included a monoclonal an- (Roche) ml 1. Samples were subsequently prepared in dissociation buffer, fol- tibody (MAb) directed at the ISAV HA (anti-HA MAb) (11), a rabbit antibody lowed by SDS-PAGE and autoradiography. against purified whole virus (anti-ISAV polyclonal antibody [PAb]) (12), and a Trypsin treatment of virus-specific proteins. Immunoprecipitated [35S]methi- Ϫ rabbit antibody against a recombinant protein based on the first ORF in ISAV onine-labeled viral proteins were treated with 20 g of trypsin (Promega) ml 1 genome segment 8 (anti-rVp22 PAb) (3). All polyclonal antisera were adsorbed in TBS (50 mM Tris [pH 7.2], 100 mM NaCl) for 30 min at 37°C and immediately by incubation on monolayers of acetone-fixed SHK or ASK cells prior to use. prepared in dissociation buffer, followed by SDS-PAGE and autoradiography. Virus purification. Purified whole virus was prepared by sucrose gradient Dissociation of virions. Virus metabolically labeled with [35S]methionine was centrifugation of polyethylene glycol 8000-precipitated cell culture supernatant purified by sucrose gradient centrifugation. Purified virus was then diluted in lysis as described previously (12). Alternatively, virus was affinity purified directly buffer (50 mM Tris [pH 7.6], 100 mM NaCl, 1% NP-40, 0.5% sodium deoxy- from cell culture supernatants by using anti-mouse immunoglobulin G (IgG)- cholate, Complete Mini protease inhibition mix [Roche]) and incubated on ice conjugated immunomagnetic beads (Dynabeads M-280; Dynal, Oslo, Norway) for 15 min. The lysate was then pelleted through a cushion of 20% sucrose in lysis and the anti-HA MAb. Briefly, the beads were washed twice in PBS (10 mM buffer at 50,000 rpm for2hat4°C in a Beckman SW-60 rotor. The supernatant phosphate [pH 7.4], 150 mM NaCl) with 0.1% bovine serum albumin (BSA) was collected and precipitated with trichloroacetic acid at a final concentration of (PBS-BSA), incubated with the MAb in PBS for1hatroom temperature (RT), 10% on ice for 30 min. The precipitate was washed three times with ethanol- and washed four times in PBS-BSA. Culture supernatant with [35S]methionine- ether (1:1), and both this precipitate and the pelleted fraction were resuspended labeled virus was then incubated with the coated beads at 4°C for 3 h (0.1 mg of in dissociation buffer and analyzed by SDS-PAGE, followed by autoradiography. beads per 1 ml of supernatant). Finally, the beads were washed four times in Hemagglutination and HI assays. Hemagglutination in microtiter plates was PBS-BSA, resuspended in dissociation buffer, and analyzed by sodium dodecyl carried out as previously described (12). The hemagglutination inhibition (HI) sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) followed by autoradiog- test with the serine esterase inhibitors DFP (Sigma) and 3,4-dichloroisocoumarin raphy (see below). (DCIC) (Sigma) was performed by first mixing 25 l of inhibitor, diluted in PBS, RIPA of virus-specific proteins. Immune precipitation of radiolabeled viral with 25 l of virus suspension containing 4 HA units, followed by incubation for antigen was performed on crude cytosol extracts. Antibody-coated magnetic 1 h. Fifty microliters of 0.5% Atlantic salmon RBC, 0.75% rabbit RBC, or 0.75% beads (see above) were used for the precipitation. Radiolabeled cell lysates were horse RBC was then added, and the agglutination end points were read following first absorbed with uncoated beads for1hatRT,andthen 250 g of coated 1and6hofincubation. All incubations were performed at RT. The hemagglu- beads was incubated with 10 l of cell lysate in 100 lofPBSfor1to2hatRT. tination activity (HA units) is expressed as the reciprocal value of the highest Antibody-antigen complexes were washed two times with radioimmunoprecipi- dilution showing complete agglutination of RBC. tation assay (RIPA) buffer (PBS containing 1% Triton X-100, 0.1% BSA, 1% Affinity purification of HA and detection of acetylesterase activity. The viral sodium deoxycholate, 0.5 M lithium chloride, and 0.1% SDS), once with PBS- HA was affinity purified by using anti-HA MAb-coated immunomagnetic beads BSA, and once with Tris-HCl (50 mM; pH 6.8). Finally, the beads were resus- as described above for purification of whole virus. Briefly, 500 g of coated beads pended in dissociation buffer and analyzed by SDS-PAGE followed by autora- was added to 300 l of ISAV cell lysate and incubated for 30 min at RT. The VOL. 78, 2004 CHARACTERIZATION OF ISAV STRUCTURAL PROTEINS 3065
FIG. 1. (a) Autoradiograms of [35S]methionine-labeled ISAV proteins resolved in SDS–12.5% polyacrylamide gels. Lanes: 1, whole virus purified by sucrose gradient centrifugation; 2, whole virus purified by affinity purification with immunomagnetic beads and an anti-HA MAb; 3, immunoprecipitation of cell lysates from virus-infected cell cultures with an anti-whole virus antibody (30- and 82-kDa proteins are indicated by asterisks); 4, control lysates of [35S]methionine-labeled cells. (b) Detection of glycoproteins. Lanes: 1, Western blot of purified virus stained with biotinylated concanavalin A; 2, immunoprecipitation of cell lysates from virus-infected cells labeled with [3H]mannose; 3, control lysates of [3H]mannose-labeled cells; 4, [35S]methionine-labeled ISAV proteins were immunoprecipitated, followed by deglycosylation; 5, nondeglycosylated control preparation; 6, control lysates of [35S]methionine-labeled cells. (c) Detection of phosphoproteins. Lanes: 1, immunoprecipitation of cell lysates from virus-infected cells labeled with 32P by using an anti-whole virus antibody; 2, control lysates of 32P-labeled cells.
beads were then removed and washed, and both beads and cell lysate were served earlier by Falk et al. (12). The molecular masses were assayed for esterase activity. calculated based on the average of 10 different lanes, and the The acetylesterase activity was determined by incubating 25 l of sample with 1mlof1mMp-nitrophenyl acetate (pNPA) (Sigma) in double-distilled water. three most distinct bands were estimated to be approximately The release of acetate was monitored by determining the optical density at 400 22, 50, and 66 kDa, respectively, while the wide, less distinct nm. One unit of viral esterase was defined as the amount of enzymatic activity band had a molecular mass peaking at 42 kDa (range, 40 to 43 resulting in cleavage of 1 mol of pNPA per min (16). Inhibition of acetylester- kDa). By scanning the autoradiograms of the gels and perform- ase activity was tested by incubating virus samples and inhibitors for 30 min at RT before testing for acetylesterase activity. ing a densiometric analysis, integrating the area under each Immunofluorescence. Indirect immunofluorescence staining was performed peak, the relative amounts of the 22-, 42-, 50-, and 66-kDa on ISAV-infected ASK cells grown on coverslips. Following incubation, the cells bands were estimated to be approximately 40, 37, 11, and 12%, were washed once in PBS, fixed in 10% buffered formalin for 10 min, rinsed in respectively. PBS, and subsequently permeabilized with 2% Triton X-100 in PBS for 30 min. 35 After blocking with 5% nonfat dry milk in PBS for 30 min, the cells were By RIPA of [ S]methionine-labeled cell lysates of infected incubated for 1 h with the primary antibody diluted in PBS with 2.5% nonfat dry cells with anti-ISAV PAb, we also found two minor proteins milk. Alexa Fluor 546 goat anti-mouse IgG (Molecular Probes) and Alexa Fluor migrating at 30 and 82 kDa (Fig. 1a, lane 3), which probably 488 goat anti-rabbit IgG (Molecular Probes) in PBS were used for the detection represented precursor proteins, breakdown products, dimeric of bound antibodies. PBS was used for washing, and all incubations were per- formed at RT. The cell preparations were mounted with the SlowFade antifade forms of one of the major proteins, or minor viral proteins. kit (Molecular Probes) and examined in a confocal microscope (Leica TCS-SP). Comparing cell lysate RIPA protein profiles with those ob- Sequence alignments. For analysis we used the amino acid sequences of the tained with purified virus preparations, it was also evident that European ISAV strain Glesvaer (accession number AAF32361) and the anti- the relative amount of the 66-kDa protein had increased while genically different Canadian isolate ISAV Bay of Fundy/97 (AAK30064) (15, 19). Accession numbers for the other HE sequences used for alignment are the amount of the 22-kDa protein had decreased, probably AAA43785 for influenza C virus, AAA46442 for mouse hepatitis virus strain reflecting differences in the immune response to these proteins JHM, P15776 for bovine coronavirus strain Mebus, and CAA71819 for Breda in the rabbit. A relatively weak reaction to the 22-kDa protein virus. The sequences were aligned by using the CLUSTAL method as described previously (38). was also seen on Western blots (see Fig. 3b, lane 3) supporting this observation. Glycosylation of the major proteins was examined both by RESULTS staining of Western blots with biotinylated concanavalin A ISA virus structural proteins. Radioactively labeled virus (Fig. 1b, lane 1) and by RIPA of cell lysates labeled with preparations purified either by sucrose gradient centrifugation [3H]mannose (Fig. 1b, lane 2). The results revealed three or by affinity purification with immunomagnetic beads coated bands comigrating with the 42-, 50-, and 82-kDa proteins, with anti-HA MAb were analyzed by SDS-PAGE (Fig. 1a, indicating the glycosylated nature of these proteins. This was lanes 1 and 2). Both purification methods gave essentially the further confirmed by deglycosylation experiments performed same results, revealing four major structural proteins, as ob- with [35S]methionine-labeled viral proteins precipitated with 3066 FALK ET AL. J. VIROL.
demonstrates, for the first time, that the anti-HA MAb binds to gp42. Furthermore, in RIPA experiments with the anti-HA MAb examined in SDS–12% polyacrylamide gels, we also observed an 82-kDa glycoprotein. This protein was also seen, to a greater or less degree, in RIPA experiments with the anti- ISAV PAb. In addition, we also frequently observed a protein band in the interphase between the 5% stacking and 12% resolving gels. To find out whether these observations could be explained as a result of dimeric and trimeric HA, too tightly bound to be completely resolved by SDS-PAGE, we examined nonreduced, non-heat-treated samples of precipitated HA in an 8 to 18% gradient gel. The results are shown in Fig. 2b, lane 1, revealing three protein bands and thus suggesting that the ISAV HA exists at least as dimers and probably as trimers. It was also seen that the mass of gp82 relative to gp42 in these nonreduced samples had increased as measured by densitom- etry of scanned films, from approximately 1:5 to 1:2, further supporting this assumption. Location of the proteins in the virion. Purified [35S]methi- onine-labeled ISA virions were solubilized with 1% NP-40. FIG. 2. (a) Effect of trypsin treatment of immunoprecipitated 35 Following ultracentrifugation of the detergent-treated virions [ S]methionine-labeled ISAV HA. Following treatment, proteins through a sucrose layer, the supernatant and the pelleted frac- were resolved in SDS-12.5% polyacrylamide gels. Lanes: 1, trypsin treatment of proteins immunoprecipitated with an anti-HA MAb; 2, tion were recovered and analyzed by SDS-PAGE. The results nontreated control of proteins in lane 1; 3, nonreduced sample of are presented in Fig. 3a and show that this treatment solubi- trypsin-treated proteins in lane 1; 4, nontreated control of proteins in lized gp42, gp50, and a major part of vp22 (Fig. 3a, lane 1), lane 3. (b) SDS–8 to 18% polyacrylamide gels of nonreduced, non- leaving a minor part of vp22 together with all of vp66 in the heat-treated samples of the ISAV HA protein immunoprecipitated from [35S]methionine-labeled ISAV cell lysate, demonstrating that the pelleted fraction (Fig. 3a, lane 2). HA protein exists at least as dimers and probably as trimers (lane 1). To demonstrate that the vp22 found in the pelleted fraction Lane 2 is included for reference and contains proteins immunopre- was similar to the vp22 found in the soluble fraction, the cipitated with a polyclonal anti-whole virus antibody. experiment was repeated and the two fractions were analyzed
the anti-ISAV PAb. The results of these experiments are shown in Fig. 1b, lane 4, and indicate that the deglycosylated gp50 has a molecular mass of 45 kDa while deglycosylated gp42 resulted in a wide band peaking at 35 kDa (range, 34 to 37 kDa). The protein band just below the 45-kDa band in Fig. 1b, lane 4, comigrated with a corresponding band in the control (Fig. 1b, lane 6) and was considered nonspecific. Analysis of cell lysates labeled with inorganic 32P revealed one major band comigrating with the 66-kDa major protein. (Fig. 1c, lane 1). Two minor bands were also found in the control preparations (Fig. 1c, lane 2), and thus the 66-kDa protein is the only major phosphorylated protein of the virion. Trypsin treatment of proteins obtained by precipitation with the anti-HA MAb revealed that the gp42, as well as the gp82 also found by precipitation with this antibody, was almost com- pletely digested, leaving one band at 34 kDa (Fig. 2a, lane 1), indicating that the HA could be subjected to proteolytic acti- vation similar to that seen with influenza virus HA. However, when proteolytic activation of the influenza virus HA occurs, the two resulting proteins are bound together by S-S binding. FIG. 3. Dissociation of ISAV with NP-40. [35S]methionine-labeled To test whether this had happened during the trypsin digestion virus was purified by sucrose gradient centrifugation, treated with 1% of the ISAV HA, nonreduced preparations were examined. NP-40, loaded onto a 20% sucrose cushion, and centrifuged. The The results revealed a digestion profile similar to that with supernatant (lanes 1) and pellet (lanes 2) were then examined by SDS–12.5% PAGE. (a) Autoradiograms of the two fractions. (b) reduced samples, indicating no S-S-binding (Fig. 2a, lane 3) Western blot analysis of the two fractions stained with a PAb to and thus making the possibility of proteolytic activation of the recombinant vp22. Lane 3 is included for reference and contains pu- HA less likely. The control in this experiment (Fig. 2a, lane 2) rified virus stained with a polyclonal anti-whole virus antibody. VOL. 78, 2004 CHARACTERIZATION OF ISAV STRUCTURAL PROTEINS 3067
FIG. 4. Immunofluorescent staining of ISAV-infected ASK cells with PAbs to recombinant vp22 (green) (a and b) and whole virus (green) (c and d). All preparations were double stained with the anti-HA MAb (red). Neither vp22 nor HA was detected at 12 h p.i. (a and c), while virus protein was detected in the nucleus (c). At 24 h p.i., vp22 was detected in the nucleus (b), while HA was detected in the cytoplasm (b and d). The nuclear staining in panel d probably represents both the nucleoprotein and vp22. by Western blotting with rabbit antibodies to a recombinant results are presented in Fig. 4 and show that vp22 first appears protein encoded by the first ORF of genome segment 8 (anti- in the nucleus as well as in the cytoplasm together with the HA rVp22 PAb), which was recently shown to be associated with at 24 h p.i. (Fig. 4b). In contrast, staining with the anti-whole vp22 (3). The results of this experiment are presented in Fig. virus antibody revealed an early protein in the nucleus, pre- 3b and show that this antibody detects vp22 both in the solu- sumably the NP, at 12 h p.i. (Fig. 4c) The NP in other influenza bilized and in the pelleted fraction. An additional protein was viruses is known to be an early protein which initially accumu- detected in the pelleted fraction (Fig. 3b, lane 2); however, this late in the nucleus (21). This demonstrates both that the vp22 protein did not colocalize with any of the ISAV proteins, as accumulates in the nucleus during the infectious cycle and that shown in the control preparation (Fig. 3b, lane 3). The most vp22 and HA are late proteins. reasonable interpretation of these results is that the two gly- Biological activities associated with the virus particle. To coproteins in the soluble fraction are associated with the viral characterize hemagglutination and esterase activity, the two envelope; that the nonglycosylated vp22 found in both soluble serine hydrolase inhibitors DFP and DCIC were tested both by and pelleted fractions is analogous to the M protein of influ- HI, which showed an eventual lack of elution of the hemag- enza A, B, and C viruses; and that the vp66 found in the glutination reaction, and by the pNPA test. The results of the pelleted fraction is the NP. HI experiments are presented in Fig. 5 and show that these To further confirm the identity of the suggested M protein, inhibitors did not inhibit hemagglutination, while both DFP infected cell cultures on coverslips were fixed every4hand and DCIC inhibited elution from rabbit erythrocytes by the immunostained with the anti-rVp22 PAb. Parallel sections esterase at concentrations of as low as 0.1 mM and 12.5 M, were stained with the anti-whole virus antibody (anti-ISAV respectively. Similar results were obtained with horse and rain- PAb) in order to determine the relative time of appearance of bow trout RBC. The inhibition experiments were further con- the vp22. For reference purposes, the preparations were dou- firmed by testing the esterase inhibitors on purified virus and ble stained with antibodies to the HA (anti-HA MAb). The measuring esterase activity in solution by using the pNPA 3068 FALK ET AL. J. VIROL.
FIG. 5. Inhibition of virus elution by DFP and DCIC. Four HA units of virus was incubated with either 0.1 to 5 mM DFP or 12.5 to 100 FIG. 6. Analysis of [1,3-3H]DFP-labeled ISAV protein. Purified M DCIC, followed by addition of 0.75% rabbit RBC. Controls: 0, no 3 inhibitor; C, no virus. (a) Incubation for 1 h, showing complete agglu- ISAV was incubated with [1,3- H]DFP for1hatroom temperature, tination in all wells. (b) After6hofincubation, the agglutination had followed by an overnight incubation at 4°C. Viral proteins were ana- eluted in the control wells but not in wells containing esterase inhibi- lyzed by electrophoresis on a reducing SDS–12% polyacrylamide gel tors. (a) or a nonreducing SDS–8% polyacrylamide gel (b). The gels were then cut into two pieces, and one part of each gel was blotted onto nitrocellulose and probed with ISAV-specific antiserum. The rest of esterase assay. The results revealed a similar inhibition of the the gel was incubated with Amplify (Amersham-Pharmacia), dried, 3 esterase activity (data not shown). and subjected to fluorography. Lanes: 1, Western blot; 2, [1,3- H]DFP. To determine the location of the esterase activity, purified virus was incubated with [1,3H]DFP, followed by SDS-PAGE analysis of reduced and nonreduced samples, followed by au- influenza C virus, group 2 coronaviruses, and Breda torovirus. toradiography. This approach was used earlier to identify the As shown in Fig. 7A, substantial sequence similarities were HE proteins of influenza C virus (25, 37) and of bovine coro- observed with the E1 and EЈ regions (31) of the influenza C navirus (36). When we incubated purified ISAV Glesvaer/2/90 virus esterase. Specifically the region around the active-site with [1,3-3H]DFP, we identified a single tritiated protein after serine residue is conserved among all viral esterases. Amino SDS-PAGE and autoradiography. This protein comigrated acid sequences around the other residues of the catalytic triad with the 42-kDa HA protein, as shown by Western blot analysis are less well conserved. The putative active-site residues were (Fig. 6a). In nonreduced samples, an additional weak band was detected at positions 32 (serine) (Fig. 7A) and 261 (aspartic seen at 82 kDa, comigrating with the suggested dimeric HA acid) and 264 (histidine) (Fig. 7B) of the ISAV Glesvaer se- (Fig. 6b). Since the viral esterase activity is inhibited by DFP, quence. We found no substantial sequence similarities to the it appears likely that the labeled proteins represents the HA HAs of influenza A and B viruses. Our finding is consistent and the esterase. with the lack of esterase activity in those viruses. As demon- In order to confirm these results, the ISAV HA protein was strated earlier by the structural analysis of the influenza C virus depleted from a Triton X-100 lysate of infected cells by using surface glycoprotein by Rosenthal et al. (31), the RDE domain immunomagnetic beads coated with the anti-HA MAb. Fol- is absent in the HA proteins of influenza A and B viruses. lowing the first round of depletion, new antibody-coated beads were added to the original virus lysate in order to pick up any remaining HA protein. Altogether, three rounds were per- formed, and the lysate and beads were tested for esterase TABLE 1. Repeated depletion of ISAV esterase from a cell lysate activity after each round by using the pNPA esterase assay. The of ISAV-infected cells by using immunomagnetic beads results are presented in Table 1 and show that the esterase coated with an anti-ISAV HA MAb activity in the lysate decreased after each round, leaving the Esterase activity measured activity on the immunomagnetic beads, which confirms that the Precipitation by pNPA assay in: esterase activity is indeed located on the viral HA protein. Lysate (mU) Beads (absorbancea) Radioimmunoprecipitation of [35S]methionine-labeled Triton Control 6.9 0 X-100 cell lysates with the same coated beads was used to con- First round of depletion 2.3 0.52 firm that gp42, but not gp50, was precipitated by the beads, and Second round of depletion 1.2 0.33 the results were similar to those presented in Fig. 2a, lane 2. Third round of depletion 0.3 0.03 These findings were also corroborated by a comparison of a Only absorbance values were measured, as it was not possible to determine the amino acid sequence of the ISAV protein with the HEs of units in these samples. VOL. 78, 2004 CHARACTERIZATION OF ISAV STRUCTURAL PROTEINS 3069
tion. These results confirm that the two glycoproteins are sur- face proteins and also suggest that the nonglycosylated vp22 represents the ISAV M protein, analogous to the influenza virus M1 protein. The major protein in the pelleted fraction was the phosphorylated vp66, and there was also a minor fraction of vp22. Thus, vp66 represents the viral NP, which is the major part of the RNP complex, together with the viral RNA and the viral polymerases, in influenza viruses. Also, in influenza viruses this complex can be pelleted following solu- bilization. The finding of M protein in the pelleted fraction was not surprising, as complete separation of M1 from the RNP complex by using nonionic detergents is difficult to achieve and is dependent on NaCl concentration and pH in both ortho- myxo- and paramyxoviruses (39). Attempts to demonstrate the effect of NaCl concentration and pH on solubilization were not successful, although indications that higher NaCl concentra- tion promoted the separation of these proteins were observed (data not shown). The finding that vp66 represents the NP is supported by computer simulation studies of gene segment 3, which is thought to code for the vp66 (6, 29). By immunofluorescence and confocal microscopy with an anti-vp22 immune serum, we were able to demonstrate that the putative ISAV M protein both accumulated in the nucleus and was a late protein. The M1 protein of the influenza viruses is the most abundant protein and has an important structural role in the influenza virus virion (21). It is located on the interior side of the lipid bilayer, forming a shell which sur- rounds the RNP complex. After entry of the virus through endosomal vesicles, the M1 protein undergoes a pH-depen- dent conformational change, resulting in release of the vRNPs FIG. 7. Alignment of amino acid sequences around the active-site into the cytoplasm. This is followed by vRNP import into the residues. The HA sequences of ISAV Glesvaer/2/90 and ISAV Bay of Fundy/97 were aligned by using the CLUSTAL algorithm with the nucleus, where the viral genome is transcribed and replicated sequences around the active-site serine residue (A) and Asp-352/His- (21). In the course of the infection cycle, the M1 accumulates 355 (B) of the HE proteins of influenza C virus, mouse hepatitis virus in the nucleus like the NP does, but in contrast to the NP, the strain JHM (MHV JHM), bovine coronavirus (BCoV) strain Mebus, M1 protein is a late protein, and it has been shown to inhibit and Breda torovirus. Amino acid residues identical to the consensus sequence are in boldface, and gaps are indicated by hyphens. Amino viral transcription and may contribute to the shift of viral RNA acid residues are numbered according to the GenBank entries. Active- synthesis towards replication in the late phase of infection (5, site residues are marked by asterisks. 21, 22). Furthermore, the nuclear accumulation of the M1 protein is a prerequisite for the nuclear export of newly syn- thesized vRNPs in the late phase of infection (23). Thus, based Instead of an esterase, those viruses possess a sialidase activity, on the facts that the ISAV vp22 is the most abundant protein which is encoded by the neuraminidase gene (21). in the virion, that it is the only nonglycosylated soluble protein, and that it is a late protein that accumulates in the nucleus DISCUSSION during the infectious cycle, we conclude that the vp22 is the ISAV M protein, analogous to the influenza virus M1 protein. Virus purified by two independent methods revealed the In ISAV we found only the NP protein to be phosphory- same four major structural proteins that have been described lated. This was surprising, as previous studies have indicated earlier (12, 14). However, the estimated molecular masses, i.e., major similarities between the ISAV and influenza virus struc- 22, 42, 50, and 66 kDa, differed slightly, probably due to the use tures and reproduction cycles (12, 32). In influenza A, B, and of different molecular mass standards. Further, these new es- C viruses, both NP and M1 are phosphorylated, a property that timates are closer to the predicted molecular masses, which are it is thought to be associated with the active transport of these 22.0, 42.4, 48.7, and 68.0 kDa, respectively (3, 6, 17). Metabolic proteins in and out of the nucleus during the infection cycle (5, labeling with tritiated mannose or with 32P established that the 27). 42- and 50-kDa proteins were glycosylated, while the 66-kDa Previously, gp42 has been shown to hold the hemagglutinat- protein was the only phosphorylated structural protein. The ing activity and to be encoded by ISAV gene segment 6 (17, glycosylated nature of the gp42 and gp50 was further substan- 28). Our findings further support this conclusion, showing the tiated by lectin binding and deglycosylation experiments. glycosylated nature of this protein, which it is solubilized by When purified virions were solubilized by NP-40 treatment NP-40, and, by using RIPA, that the anti-ISAV HA MAb followed by ultracentrifugation, the two glycoproteins and the actually binds to gp42 (Fig. 2, lane 4). Both the RIPA using the nonglycosylated vp22 were recovered in the solubilized frac- anti-ISAV HA MAb with either [35S]methionine-labeled or 3070 FALK ET AL. J. VIROL.
[3H]mannose-labeled cell lysates and the [1,3-3H]DFP-label- treatment during replication in cell cultures have previously ing experiment revealed a minor 82-kDa glycosylated protein. been presented (12). In the present work, trypsin treatment of This 82-kDa glycoprotein had approximately twice the molec- immunoprecipitated gp42 followed by SDS-PAGE analysis re- ular mass of gp42, suggesting that it might be a dimer of gp42. vealed a 35-kDa breakdown product, suggesting that this pro- When nonreduced, non-heat-treated samples were examined tein could be subjected to proteolytic activation. However, in an 8 to 18% gradient gel, the relative proportion of this examination of nonreduced samples revealed the same results, protein increased and a third protein also was detected (Fig. indicating no S-S binding of the cleaved products, and there- 2b, lane 1). However, this possible trimeric form of gp42 was fore it is not likely that gp42 is subjected to proteolytic activa- not detected in the [1,3-3H]DFP-labeling experiment, which tion. In the influenza viruses, HA or HE is synthesized as a could be due to low sensitivity in this assay. Thus, the existence precursor, which upon cleavage activation generates the two of a trimeric form of gp42 remains to be further documented. subunits, the HA1 (or HE1) and the N terminus of HA2 (or
In addition to the hemagglutinating activity, the surface gly- HE2) bound together by an S-S bridge. This cleavage primes coproteins of the influenza viruses exhibit RDE activity and the HA or HE for activation of its fusion activity and is re- fusion activity. Both of these activities have been detected in quired for the viruses to be infectious (21). The function of the ISAV (9, 12); however, the localization of these activities has gp50 surface glycoprotein is currently not known. Based on the so far not been determined. Also, the RDE of ISAV has been fact that the hemagglutinating and esterase activities are asso- suggested to be an acetylesterase different from that found in ciated with gp42, it is tempting to suggest that this protein influenza C viruses (12). We demonstrated here that the ISAV holds the fusion activity. However, no documentation or indi- RDE, but not hemagglutination, is inhibited by the serine cations supporting such an assumption have so far been pre- hydrolase inhibitors DFP and DCIC, further supporting the sented, and hence this question remains to be resolved. In idea that the ISAV RDE indeed is an acetylesterase. Both of summary, we provide experimental evidence that the ISAV these inhibitors have been shown to be potent inhibitors of the vp66 represents the phosphorylated NP, the gp42 is the viral influenza C virus esterase (37). HE, and the vp22 represents the analogue to the influenza In addition to influenza C viruses, several coronaviruses, virus M protein. including human and bovine coronavirus, hemagglutinating encephalomyelitis virus, mouse hepatitis virus, puffinosis coro- ACKNOWLEDGMENTS navirus and sialodacryoadenitis virus, have also been shown to possess an esterase as the RDE (10, 35). All these viruses have We thank Hilde Welde and Ulrike Vilas for technical assistance, Ducan Colquhoun for proofreading, and Intervet Norbio for supplying a surface HE glycoprotein; i.e., both receptor binding and recombinant proteins for immunization of rabbits. RDE activities are located on the same protein and they bind This study was funded by grants 128044/103 and 146845/120 from to cellular receptors, which contain O-acetylated sialic acids as the Norwegian Research Council, by project P 14104-Med from the the major receptor determinant. However, it should be noted Austrian Science Fund, and by Intervet International. that in coronaviruses the second surface glycoprotein, termed REFERENCES spike protein, is the major receptor-binding protein, whereas 1. Anonymous. 2003. Infectious salmon anaemia, p. 152–161. In OIE manual of the coronavirus HE is a minor HA. On the other hand, both diagnostic tests for aquatic animals. Office International des Epizooties, influenza A and B viruses, which also possess two surface Paris, France. structural glycoproteins, have hemagglutinating and fusion ac- 2. Anonymous. 2003. Infectious salmon anaemia in the Faroe Islands. Dis. Infect. (O. I. E.) 14:60. tivities on one protein and RDE (a neuraminidase) activity on 3. Biering, E., K. Falk, E. Hoel, J. Thevarajan, M. Joerink, A. Nylund, C. the other (21). We now present data showing that we have Endresen, and B. Krossoy. 2002. Segment 8 encodes a structural protein of infectious salmon anaemia virus (ISAV); the colinear transcript from seg- identified another HE protein in ISAV. By labeling purified ment 7 probably encodes a non-structural or minor structural protein. Dis. 3 ISAV with the serine hydrolase inhibitor [1,3- H]DFP, we de- Aquat. Org. 49:117–122. tected one tritiated protein band on SDS-PAGE that comi- 4. Bouchard, D. A., K. Brockway, C. Giray, W. Keleher, and P. L. Merrill. 2001. First report of infectious salmon anemia (ISA) in the United States. Bull. grated with the viral HA. This finding was further confirmed by Eur. Assoc. Fish Pathol. 21:86–88. the demonstration of acetylesterase activity in preparations of 5. Bui, M., E. G. Wills, A. Halenius, and G. R. Whittaker. 2000. Role of the affinity-purified viral HA. Finally, by comparing the amino acid influenza virus M1 protein in nuclear export of viral ribonucleoproteins. J. Virol. 74:1781–1786. sequence of the ISAV HA protein with those of the HEs of 6. Clouthier, S. C., T. Rector, N. E. C. Brown, and E. D. Anderson. 2002. influenza C virus and several coronaviruses, substantial se- Genomic organization of infectious salmon anaemia virus. J. Gen. Virol. 83:421–428. quence similarities were observed. Studies of the three-dimen- 7. Dannevig, B. H., K. Falk, and E. Namork. 1995. Isolation of the causal virus sional structure of influenza C virus have revealed two different of infectious salmon anaemia (ISA) in a long-term cell line from Atlantic binding sites for O-acetylated sialic acids: the receptor-binding salmon head kidney. J. Gen. Virol. 76:1353–1359. 8. Devold, M., B. Krossoy, V. Aspehaug, and A. Nylund. 2000. Use of RT-PCR domain at the top of the trimeric molecule and the catalytic for diagnosis of infectious salmon anaemia virus (ISAV) in carrier sea trout site, which is present at a position closer to the viral membrane. Salmo trutta after experimental infection. Dis. Aquat. Org. 40:9–18. The active site is built by a catalytic triad composed of a serine 9. Eliassen, T. M., M. K. Froystad, B. H. Dannevig, M. Jankowska, A. Brech, K. Falk, K. Romoren, and T. Gjoen. 2000. Initial events in infectious salmon residue, a histidine residue, and an aspartic acid residue, lo- anemia virus infection: evidence for the requirement of a low-pH step. cated at positions 57, 352, and 355, respectively (30). In ISAV J. Virol. 74:218–227. 10. Enjuanes, L., D. A. Brian, D. Cavanagh, K. V. Holmes, M. M. C. Lai, H. strain Glesvaer/2/90, these residues were identified at positions Laude, P. S. Masters, P. Rottier, S. Siddell, W. Spaan, F. Taguchi, and P. J. 32, 261, and 264, respectively. Thus, in analogy to the HEs of Talbot. 2000. Nidovirales, p. 827–857. In M. H. V. van Regenmortel, C. M. influenza C virus and coronaviruses, it is proposed that the Fauquet, and D. H. L. Bishop (ed.), Virus taxonomy. Classification and nomenclature of Viruses. Seventh report of the International Committee on ISAV protein be renamed HE protein. Taxonomy of Viruses. Academic Press, San Diego, Calif. Data suggesting proteolytic activation of ISAV by trypsin 11. Falk, K., E. Namork, and B. H. Dannevig. 1998. Characterization and ap- VOL. 78, 2004 CHARACTERIZATION OF ISAV STRUCTURAL PROTEINS 3071
plications of a monoclonal antibody against infectious salmon anaemia virus. salmon (Salmo salar L.): An orthomyxo-like virus in a teleost. J. Virol. 71: Dis. Aquat. Org. 34:77–85. 7681–7686. 12. Falk, K., E. Namork, E. Rimstad, S. Mjaaland, and B. H. Dannevig. 1997. 25. Muchmore, E. A., and A. Varki. 1987. Selective inactivation of influenza C Characterization of infectious salmon anemia virus, an orthomyxo-like virus esterase: a probe for detecting 9-O-acetylated sialic acids. Science 236:1293– isolated from Atlantic salmon (Salmo salar L.). J. Virol. 71:9016–9023. 1295. 12a.Hellebø, A., U. Vilas, K. Falk, and R. Vlasak. 2004. Infectious salmon anemia 26. Mullins, J., D. Groman, and D. Wadowska. 1998. Infectious salmon anemia virus specifically binds to and hydrolyzes 4-O-acetylated sialic acids. J. Virol. in salt water Atlantic salmon (Salmo salar L.) in New Brunswick, Canada. 78:3055–3062. Bull. Eur. Assoc. Fish Pathol 18:110–114. 13. Kibenge, F. S. B., O. N. Garate, G. Johnson, R. Arriagada, M. J. T. Kibenge, 27. Neumann, G., M. R. Castrucci, and Y. Kawaoka. 1997. Nuclear import and and D. Wadowska. 2001. Isolation and identification of infectious salmon export of influenza virus nucleoprotein. J. Virol. 71:9700. anaemia virus (ISAV) from Coho salmon in Chile. Dis. Aquat. Org. 45:9–18. 28. Rimstad, E., S. Mjaaland, M. Snow, A. B. Mikalsen, and C. O. Cunningham. 14. Kibenge, F. S. B., J. R. Lyaku, D. Rainnie, and K. L. Hammell. 2000. Growth 2001. Characterization of the infectious salmon anemia virus genomic seg- of infectious salmon anaemia virus in CHSE-214 cells and evidence for ment that encodes the putative hemagglutinin. J. Virol. 75:5352–5356. phenotypic differences between virus strains. J. Gen. Virol. 81:143–150. 29. Ritchie, R. J., J. Heppell, M. B. Cook, S. Jones, and S. G. Griffiths. 2001. 15. Kibenge, F. S. B., S. K. Whyte, K. L. Hammell, D. Rainnie, M. T. Kibenge, Identification and characterization of segments 3 and 4 of the ISAV genome. and C. K. Martin. 2000. A dual infection of infectious salmon anaemia (ISA) Virus Genes 22:289–297. virus and a togavirus-like virus in ISA of Atlantic salmon Salmo salar in New 30. Rodger, H. D., T. Turnbull, F. Muir, S. Millar, and R. H. Richards. 1998. Brunswick, Canada. Dis. Aquat. Org. 42:11–15. Infectious salmon anaemia (ISA) in the United Kingdom. Bull. Eur. Assoc. 16. Klausegger, A., B. Strobl, G. Regl, A. Kaser, W. Luytjes, and R. Vlasak. 1999. Fish Pathol. 18:115–116. Identification of a coronavirus hemagglutinin-esterase with a substrate spec- 31. Rosenthal, P. B., X. Zhang, F. Formanowski, W. Fitz, C. H. Wong, H. ificity different from those of influenza C virus and bovine coronavirus. Meier-Ewert, J. J. Skehel, and D. C. Wiley. 1998. Structure of the haemag- J. Virol. 73:3737–3743. glutinin-esterase-fusion glycoprotein of influenza C virus. Nature 396:92–96. 17. Krossoy, B., M. Devold, L. Sanders, P. M. Knappskog, V. Aspehaug, K. Falk, 32. Sandvik, T., E. Rimstad, and S. Mjaaland. 2000. The viral RNA 3Ј- and A. Nylund, S. Koumans, C. Endresen, and E. Biering. 2001. Cloning and 5Ј-end structure and mRNA transcription of infectious salmon anaemia virus identification of the infectious salmon anaemia virus haemagglutinin. J. Gen. resemble those of influenza viruses. Arch. Virol. 145:1659–1669. Virol. 82:1757–1765. 33. Snow, M., R. Ritchie, O. Arnaud, S. Villoing, V. Aspehaug, and C. O. 18. Krossoy, B., I. Hordvik, F. Nilsen, A. Nylund, and C. Endresen. 1999. The Cunningham. 2003. Isolation and characterisation of segment 1 of the in- putative polymerase sequence of infectious salmon anemia virus suggests a fectious salmon anaemia virus genome. Virus Res. 92:99–105. new genus within the Orthomyxoviridae. J. Virol. 73:2136–2142. 34. Thorud, K. E., and H. O. Djupvik. 1988. Infectious anaemia in Atlantic 19. Krossoy, B., F. Nilsen, K. Falk, C. Endresen, and A. Nylund. 2001. Phylo- salmon (Salmo salar L.). Bull. Eur. Assoc. Fish Pathol. 8:109–111. genetic analysis of infectious salmon anaemia virus isolates from Norway, 35. Vlasak, R., M. Krystal, M. Nacht, and P. Palese. 1987. The influenza-C virus Canada and Scotland. Dis. Aquat. Org. 44:1–6. glycoprotein (He) exhibits receptor-binding (hemagglutinin) and receptor- 20. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of destroying (esterase) activities. Virology 160:419–425. the head of bacteriophage T4. Nature 227:680–685. 36. Vlasak, R., W. Luytjes, J. Leider, W. Spaan, and P. Palese. 1988. The E3 21. Lamb, R. A., and R. M. Krug. 2001. Orthomyxoviridae: the viruses and their protein of bovine coronavirus is a receptor-destroying enzyme with acetyles- replication, p. 1487–1579. In B. N. Fields, D. M. Knipe, P. M. V. Howley, and terase activity. J. Virol. 62:4686–4690. D. E. Griffin (ed.), Field’s virology, 4th ed. Lippincott Williams & Wilkins, 37. Vlasak, R., T. Muster, A. M. Lauro, J. C. Powers, and P. Palese. 1989. New York, N.Y. Influenza C virus esterase: analysis of catalytic site, inhibition, and possible 22. Martin, K., and A. Helenius. 1991. Nuclear transport of influenza virus function. J. Virol. 63:2056–2062. ribonucleoproteins: the viral matrix protein (M1) promotes export and in- 38. Wurzer, W. J., K. Obojes, and R. Vlasak. 2002. The sialate-4-O-acetylester- hibits import. Cell 67:117–130. ases of coronaviruses related to mouse hepatitis virus: a proposal to reorga- 23. Martin, K., and A. Helenius. 1991. Transport of incoming influenza virus nize group 2 Coronaviridae. J. Gen. Virol. 83:395–402. nucleocapsids into the nucleus. J. Virol. 65:232–244. 39. Zhirnov, O. P., and V. B. Grigoriev. 1994. Disassembly of influenza C viruses, 24. Mjaaland, S., E. Rimstad, K. Falk, and B. H. Dannevig. 1997. Genomic distinct from that of influenza A and B viruses requires neutral-alkaline pH. characterization of the virus causing infectious salmon anemia in Atlantic Virology 200:291.
Paper II
Virus Research 106 (2004) 51–60
Infectious salmon anemia virus (ISAV) genomic segment 3 encodes the viral nucleoprotein (NP), an RNA-binding protein with two monopartite nuclear localization signals (NLS)ଝ
Vidar Aspehauga,b, Knut Falkb, Bjørn Krossøyc, Jegatheswaran Thevarajanc, Lisette Sandersd, Lindsey Mooree, Curt Endresena, Eirik Bieringc,∗
a Department of Biology, University of Bergen, Bergen, Norway b Section for Fish Health, National Veterinary Institute, Oslo, Norway c Intervet Norbio, Thormohlensgt. 55 Bergen, 5020 Norway d Intervet International BV, Boxmeer, The Netherlands e Department of Microbiology and Immunology, Centre for Research in Virology, The Gade Institute, Bergen, Norway Received 11 February 2004; received in revised form 4 June 2004; accepted 4 June 2004 Available online 5 August 2004
Abstract
Infectious salmon anemia virus (ISAV) is the type species of the genus Isavirus belonging to the Orthomyxoviridae, and causes serious disease in Atlantic salmon (Salmo salar). This study presents the expression and functional analysis of the ISAV genome segment 3, and provides further evidence that it encodes the viral nucleoprotein (NP). The encoded protein was expressed in a baculovirus system, and Western blot analysis showed that it corresponds to the 66–71 kDa structural protein previously found in purified ISAV preparations. RNA-binding activity was established by the interaction of viral and recombinant NP with single-stranded RNA transcribed in vitro. Immunofluorescence studies of infected cells showed the ISAV NP to be an early protein. It locates to the nucleus of infected cells before it is transported to the cytoplasm prior to virus assembly. A similar localization pattern was observed in cells transfected with the NP gene, confirming that the encoded protein has an intrinsic ability to be imported into the nucleus. Two monopartite nuclear localization signals (NLS) at amino acids 230RPKR233 and 473KPKK476 were identified by computer analysis, and validated by site-directed mutagenesis. In contrast to other orthomyxovirus-NPs, that have several NLSs that function independent of each other, both NLSs had to be present for the ISAV NP protein to be transported into the nucleus, indicating that these motifs cooperate to target the protein to the nucleus. © 2004 Elsevier B.V. All rights reserved.
Keywords: ISAV; Isavirus; Orthomyxoviridae; Nucleoprotein; NP
1. Introduction The virus has also been isolated from Coho salmon (Oncorhynchus kisutch) in Chile (Kibenge et al., 2001). Infectious salmon anemia virus (ISAV) is a pathogen ISAV is the type species of the genus Isavirus belong- of Atlantic salmon (Salmo salar) in Norway, Scotland, ing to the Orthomyxoviridae (ICTV index of viruses, the Faeroe Islands, Canada, and the United States (Lovely http://www.ncbi.nlm.nih.gov/ICTVdb/Ictv/index.htm), and et al., 1999; Mullins et al., 1998; Rodger and Richards, shares several properties with the influenza viruses, including 1998; Schyth et al., 2003; Thorud and Djupvik, 1988). genetic as well as biochemical, physiochemical, and morpho- logical properties (Eliassen et al., 2000; Falk et al., 1997; ଝ Koren and Nylund, 1997; Krossøy et al., 2001a, 1999; Note: GenBank accession number: AX137949. ∗ Corresponding author. Tel.: +47 55 54 37 63; fax: +47 55 96 01 35. Mjaaland et al., 1997; Sandvik et al., 2000). The ISAV E-mail address: [email protected] (E. Biering). genome is composed of eight negative sense, single stranded
0168-1702/$ – see front matter © 2004 Elsevier B.V. All rights reserved. doi:10.1016/j.virusres.2004.06.001 52 V. Aspehaug et al. / Virus Research 106 (2004) 51–60
(ss) RNA segments, and nucleotide sequences of all segments pursue a nuclear replication strategy similar to the influenza have been published (Biering et al., 2002; Clouthier et al., viruses (Falk et al., 1997), and nuclear localization signals 2002; Krossøy et al., 2001a, 1999; Mjaaland et al., 1997; (NLS) have been suggested in the putative NP (Rimstad and Rimstad et al., 2001; Ritchie et al., 2001; Snow and Cunning- Mjaaland, 2002). Recently, we demonstrated that the 66 kDa ham, 2001; Snow et al., 2003). Segment 2 encodes the poly- protein is a phosphorylated protein associated with the inter- merase basic protein 1 (PB1) as evident by the presence of nal structures of the virus particle (Falk et al., 2004), sup- polymerase motifs characteristic to all viral RNA-dependent porting that it represents the viral NP. The present study was RNA-polymerases. The coding assignments of the remaining undertaken to verify that the ISAV genomic segment 3 en- genomic segments needs to be elucidated by functional stud- codes the 66 kDa protein, and to provide further evidence that ies, since they do not show significant sequence homology to this is the viral NP. We have shown experimentally that the other known genes, neither at the nucleotide nor at the amino encoded protein exhibit the general characteristics described acid (aa) level. for NPs of the influenza viruses. Transfection experiments Four major structural proteins with estimated molecular showed that the NP localized to the nucleus in the absence weights (MW) of 22–24, 42–43, 50–53, and 66–71 kDa have of other viral proteins, indicating the presence of at least one been detected in purified ISAV particles (Falk et al., 2004, functional NLS within the protein. This was substantiated 1997; Kibenge et al., 2000). The estimated molecular masses by mutation studies, and two cooperating monopartite NLSs of these proteins differ slightly in the literature, probably due were identified. to differences in experimental conditions, but 22, 42, 50, and 66 kDa will be used in the following. The 22 kDa protein has been linked to one of the two open 2. Materials and methods reading frames (ORF) of segment 8 (Biering et al., 2002), and was recently suggested to represent the matrix protein 2.1. Virus and cells (Falk et al., 2004). Several studies has established that the 42 kDa protein is encoded by segment 6, and that it is a viral Two virus isolates were used in this study. The cloning hemagglutinin-esterase (HE) (Clouthier et al., 2002; Falk et was performed using a virus strain isolated by Krossøy et al. al., 2004, 1998; Griffiths et al., 2001; Hellebø et al., 2004; (2001b), designated Bremnes/98. Unless otherwise is stated, Krossøy et al., 2001a; Rimstad et al., 2001), and Clouthier other assays were performed using the ISAV strain isolated et al. (2002) determined the 50 kDa protein to be encoded by Dannevig et al. (1995), designated Glesvær/2/90. Virus by segment 5, but the function of this protein remains to be stocks were prepared in salmon head kidney (SHK-1) cells elucidated. (Dannevig et al., 1995), and all assays were performed with Three separate studies have reported the cloning of a fourth or fifth passages of the virus. Functional assays were cDNA sequence corresponding to genomic segment 3 of the performed using Atlantic salmon kidney (ASK) cells (Devold ISAV (Clouthier et al., 2002; Ritchie et al., 2001; Snow and et al., 2000). Infections were performed as reported by Falk Cunningham, 2001), and they suggest that this sequence en- et al. (1997). Chinook salmon embryo cells (CHSE-214) codes the NP. These studies also suggested an RNA-binding (Lannan et al., 1984), plated on glass coverslips at 50–70% domain in the putative protein, based on computer simula- confluency 12–24 h (h) earlier, were used for transfection. All tions of the physicochemical nature of the aa residues in the cell types were grown as previously described. Cell lysates region, and on aa alignments with the RNA-binding domain were prepared 4 days post infection (p.i.) in TNE buffer of the NP from influenza A and B. The region is however (10 mM Tris–HCl [pH 7.4], 100 mM NaCl, 1 mM EDTA) not well conserved between influenza and ISAV. All viruses with 1% NP-40 (lysis buffer). Insoluble debris was removed with negative sense RNA genomes encode a NP which binds by centrifugation at 20,000 × g for 20 min at 4 ◦C. Lysates ss RNA. In orthomyxoviruses, the NP is the major struc- were stored at −80 ◦C until used. tural protein that interacts with the RNA segments (Lamb Sf9 cells grown in suspension culture were infected with and Krug, 1996), and its primary function is to encapsidate baculovirus at 28 ◦C and harvested 5 days p.i. by centrifu- the virus genome to facilitate RNA transcription, replication, gation at 750 × g for 20 min at 4 ◦C. The cell pellet was and packaging (Portela and Digard, 2002). Along with the resuspended in lysis buffer, and used for immunization and polymerase proteins (PB1, PB2, and PA) and viral RNA, the functional assays. NP forms viral ribonucleoprotein (RNP) complexes that rep- Radiolabelled cell lysates of ISAV- or mock-infected ASK resent the minimal components required for transcription and cells were prepared by incubating cells grown in 25 cm2 tissue replication of viral RNA (Huang et al., 1990; Lamb and Krug, culture flasks with 350 Ci of [35S]methionine (Amersham 1996; Lee et al., 2002). Similar RNP-like particles appear- Biosciences) in 2.5 ml methionine free DMEM. At 4 days p.i., ing as right-handed double helices have been observed in the cells were washed twice with 10 mM phosphate buffered electron microscopy studies of purified, lysed ISAV prepa- saline [pH 7.4] (PBS) and lysed on ice for 15 min in lysis rations (Falk et al., 1997). Also, immunofluorescence stain- buffer. Radiolabelled cell lysates of Sf9 cells were prepared ing of ISAV infected cells using a polyclonal antibody pre- by adding 350 Ci of [35S]methionine (Pro-Mix; Amersham pared against purified whole virus indicates that the ISAV Biosciences) directly to a 10 ml suspension culture at 48 h V. Aspehaug et al. / Virus Research 106 (2004) 51–60 53 p.i., followed by incubation another 48 h at 28 ◦C. The cells conjugated peptides were pooled and injected in two rabbits were washed twice with PBS by centrifugation at 750 × g according to Eurogentec’s procedures. An antiserum against for 10 min at 4 ◦C, and lysed on ice for 15 min in lysis buffer. the baculovirus expressed 1H protein (anti-1H) was prepared Insoluble debris was removed by centrifugation at 20,000 × by immunizing a rabbit four times with four weeks intervals g for 20 min at 4 ◦C. Lysates were stored at −80 ◦C until used. using approximately 200 g protein from a crude lysate of Purified ISAV preparations were made by sucrose gradi- Sf9 cells infected with 1H-recombinant baculovirus. ent centrifugation as described previously (Falk et al., 1997). Two polyclonal antisera prepared against whole ISAV, ISAV infectivity was determined by endpoint titration in 96- ISAV-PAb1 (Falk and Dannevig, 1995), and ISAV-PAb2 well culture plates, using an immunofluorescence assay as (Krossøy et al., 2001a), and a monoclonal antiserum directed published by Falk et al. (1997). against the ISAV HE, anti-HE MAb (Falk et al., 1998), were also used in this study. All polyclonal antisera were adsorbed 2.2. Cloning, sequencing, and sequence analysis by incubation on monolayers of acetone fixed ASK cells prior to use. A unidirectional cDNA library from ISAV infected ASK cells was constructed in bacteriophage Lambda as previ- 2.5. SDS–PAGE and Western blot (WB) analysis ously described (Krossøy et al., 2001a), and a clone des- ignated 1H was identified by immunoscreening with a poly- Purified ISAV and lysates of Sf9 cells were resolved by clonal anti-ISAVrabbit serum (ISAV-PAb2, see below) using SDS–PAGE and transferred to a nitrocellulose membrane as the picoBlue immunoscreening kit (Stratagene). The pBlue- previously described (Krossøy et al., 2001a). The membrane Script plasmid containing the 1H sequence was excised by was treated with blocking solution (PBS, 0.1% Tween-20, use of the ExAssist helper phage and the SOLR strain of 5% non-fat dry milk, 0.01% anti-foam A (Sigma)) overnight Escherichia coli (Stratagene). Complete sequencing was per- at 4 ◦C followed by a 1 h incubation with the primary rab- formed on the isolated plasmid. To obtain a full-length cDNA bit immune serum. The membrane was then washed three sequence, 5 RACE was performed with the 5 RACE sys- times in blocking solution and incubated with goat anti-rabbit tem, version 2.0 (Life Technologies). RACE products were horseradish peroxidase (HRP) conjugate (AMDEX: Amer- cloned into the pCR 2.1-TOPO vector using the TOPO TA sham Biosciences) for 1 h at room temperature (RT). Di- cloning kit (Invitrogen) and sequenced. For sequencing, the aminobenzidine was used as a color reagent for detection BigDye terminator sequencing kit (PE Biosystems) and an of bound HRP-conjugate (Sigma). ABI 377 DNA analyzer (PE Biosystems) were used. Se- quences were assembled with the Sequencher software (Gene 2.6. Affinity purification/radioimmune precipitation Codes Corporation), and GeneBank searches were performed assay (RIPA) with BLAST (http://www.ncbi.nlm.nih.gov/BLAST/). Prot- Param tool (http://us.expasy.org/tools/protparam.html)was Anti-rabbit IgG-conjugated immunomagnetic beads used to calculate the pI and theoretical MW of the full (Dynabeads M-280; Dynal, Norway) were incubated with length protein and the C-terminal 30 residues. The pre- rabbit immune serum in PBS for 1 h, followed by washing dicted aa sequence was analyzed for NLSs using PSORT with RIPA-buffer (PBS, 1% Triton X-100, 1 mg/mL BSA, 1% (http://psort.nibb.ac.jp/). sodium deoxycholate, 0.5 M lithium chloride, 0.1% SDS). Coated beads were incubated with the cell lysates for 1 h 2.3. Baculovirus expression of 1H cDNA in RIPA-buffer, and washed two times in RIPA-buffer fol- lowed by washing in PBS and 50 mM Tris–HCl [pH 6.8]. 1H cDNA was amplified using primers 5 -cgggatccat- Beads were then either analyzed by SDS–PAGE followed ggccgataaaggtatgac-3 and 5 -ggggtacctgcagtttcaaatgtcagt- by autoradiography to confirm the purity of the protein gtc-3 and cloned into the pFastBac1 vector (Life Tech- preparations, or used in the RNA-binding assay described nologies) using the BamHI and KpnI restriction enzymes below. (Promega). The construct was transformed into TOP 10 cells (Invitrogen) and the isolated plasmids were used to transform 2.7. RNA-binding assay DH10Bac competent cells (Life Technologies). Recombinant baculovirus was constructed according to Life Technologies’ 32P-labeled RNA was made by using a full length clone recommendations. of the ISAV HE gene in the pVAX1 vector (Invitrogen), which was linearized using BamHI (Promega). One g lin- 2.4. Antisera earized DNA template was transcribed into RNA with T7 RNA polymerase using an RNA transcription kit (Strata- Antiserum against peptides derived from the 1H sequence gene). The RNA was transcribed in the presence of 50 Ci (anti-pep1H) were prepared by Eurogentec (Belgium) us- 32P-rUTP (Amersham Biosciences), giving a labeled prod- ing the peptides SRPKRSDYRKGQGSKC and CIEFDED- uct of 294 bases of positive sense, of which approximately DQEEEDTDI coupled to keyhole limpet haemocyanin. The 100 bases originated from the vector sequence. Dynabeads 54 V. Aspehaug et al. / Virus Research 106 (2004) 51–60 with bound protein were washed three times in RNAse-free (Molecular Probes) and examined in a confocal microscope PBS, and incubated with the 32P-labeled RNA for 15 min (Leica, TCS-SP). at rt. Unbound RNA was removed by washing three times in RNAse-free 10 mM Tris–HCl [pH 8.0]. The Dynabeads 2.9. NLS mutation and transfection were dotted onto nitrocellulose membranes which were dried and exposed to a Kodak BioMax MS film for 7 days at − The ORF of the 1H-gene was amplified by PCR using 80 ◦C. primers 5 -ggggtaccatggccgataaaggtatgac-3 and 5 -ccgct- cgagtgcagtttcaaatgtcagtgtc-3 , and cloned into the KpnI and 2.8. Immunofluorescence XhoI sites of the pVAX1 vector (Invitrogen). The con- struct was designated 1H-pVAX1. Two putative NLSs (des- Coverslips with attached cells were washed in PBS and ignated NLS1 and NLS2) were subjected to mutagenesis. fixed with 3.7% formaldehyde in PBS for 20 min, rinsed in The 230RPKR233 motif in NLS1 was mutated to AAAA PBS, and subsequently permeabilized with 0.2% Triton X- by use of primers 5 -gctttcagacagagcgcagccgcagcgtcagactac- 100 in PBS for 30 min followed by blocking in 5% non- aggaaag-3 and 5 -ctttcctgtagtctgacgctgcggctgcgctctgtctgaa- fat dry milk in PBS for 30 min. The cells were incubated agc-3 , and the 473KPKK476 motif in NLS2 was mutated with the primary antibodies diluted in 2.5% non-fat dry milk to AAAA by use of primers 5 -caaggcaaacacaaccgcagccgc- in PBS for 1 h and washed in PBS. Bound antibodies were ggcggactcaacatacac-3 and 5 -gtgtatgttgagtccgccgcggctgc- detected using goat anti-mouse FITC or goat anti-rabbit FITC ggttgtgtttgccttg-3 . Both mutations were performed with (Southern Biotechnology Associates Inc.). In double labeling the QuickChange XL site-directed mutagenesis kit (Strata- experiments, rabbit antibodies were detected using goat anti- gene), and the resulting constructs were designated rabbit biotin (VECTOR) visualized by a Neutralite Avidin- 1H-pVAX1- NLS1 and 1H-pVAX1- NLS2, respectively. Texas red (Southern Biotechnology Associates Inc.). After In order to generate the double mutant 1H-pVAX1- washing, the cells were mounted with SlowFade antifade kit NLS1 NLS2, the 230RPKR233 motif in the NLS1 region
Fig. 1. Alignment of three isolates of the ISAV segment 3 indicating the putative RNA-binding region (underlined) and the NLSs (shaded gray). The acid region in the C-terminal is framed. The isolates are Bremnes/98 (accession no. AX137949), Scotland (accession no. AJ276858) and Canada (accession no. AF306549). V. Aspehaug et al. / Virus Research 106 (2004) 51–60 55 of 1H-pVAX1- NLS2 was mutated to AAAA by use of primers 5 -gctttcagacagagcgcagccgcagcgtcagactacaggaaag- 3 and 5 -ctttcctgtagtctgacgctgcggctgcgctctgtctgaaagc-3 . All constructs were sequenced. Transfections were performed in 24-well plates on CHSE-214 cells using the FuGENE 6 trans- fection reagent (Roche Diagnostics). Transfected cells were analyzed by immunofluorescence using the anti-1H antisera. ASK and SHK-1 cells were also transfected with the above mentioned constructs to confirm that the localization did not vary with cell type, and although transfected cells were ob- served, the transfection efficacy proved very low. This is a very common problem with some fish cell systems.
3. Results
3.1. ISAV segment 3 shows identity to previously published ISAV sequences and has two putative NLSs Fig. 2. WB analyses of recombinant proteins (a) and purified ISAV(b). Anti- bodies are indicated on the top, antigens in each lane, and molecular sizes are indicated on the right. (a) A polyclonal antiserum prepared against purified Immunoscreening of the bacteriophage Lambda cDNA li- virus preparations (ISAV-PAb1) (lanes 1 and 2), and an antiserum prepared brary with the ISAV-PAb2 identified an ISAV clone desig- against peptides derived from the 1H-sequence (anti-pep1H) (lanes 3 and 4) nated 1H with one ORF of 1851 bases, theoretically encod- both reacted with the 66 kDa gene product of segment 3 expressed in SF9 ing a protein of 616 aa with an estimated MW of 68 kDa cells (lanes 1 and 3). Lysates of Sf9 cells infected with non-recombinant baculovirus was negative (lanes 2 and 4). (b) The anti-pep1H and an anti- andapI of 8.2. The C-terminal 30 aa residues of the theoreti- serum prepared against lysates of Sf9 cells expressing 1H (anti-1H) reacted cal protein were markedly rich in acidic amino acid residues, with a 66 kDa protein in purified ISA-virus (lanes 1 and 2). The ISAV-PAb1 with a pI of 3.3 (Fig. 1). The cDNA contained the conserved reacted with four major ISAV structural proteins of indicated sizes (lane 3). nucleotide sequence 5 -agcaaaga-3 at the 5 end as earlier reported for ISAV genomic segments (Krossøy et al., 1999; PAb1 which is prepared against whole virus reacted with the Ritchie et al., 2001; Sandvik et al., 2000; Snow and Cunning- four major structural proteins in WB analysis of purified virus ham, 2001). Database searches showed that at the nucleotide (Fig. 2b, lane 3), which is in agreement with previous reports level the 1H sequence shared 99% and 85% identity with (Falk et al., 2004, 1997; Krossøy et al., 2001a). the Scottish and the Canadian segment 3 sequences, respec- tively (Clouthier et al., 2002; Ritchie et al., 2001; Snow and 3.3. The 66 kDa protein has RNA-binding activity Cunningham, 2001). At the aa level, only two substitutions were found compared to the Scottish sequence, whereas the The 1H protein and the viral 66 kDa protein were affin- similarity to the Canadian sequences was 96% (Fig. 1). No ity purified from Sf9 cells infected with recombinant 1H- significant similarity to other sequences was found. Using baculovirus using ISAV-PAb1, and from ISAV-infected ASK PSORT (http://psort.nibb.ac.jp/), two theoretical NLS were cells using anti-1H antiserum, respectively. Both the recom- predicted at aa 230RPKR233 and 473KPKK476 (Fig. 1). These binant and the viral protein exhibited RNA-binding activity NLSs were conserved in all ISAV segment 3 sequences pub- as demonstrated in Fig. 3a (boxes 1 and 3). The corresponding lished, and were designated NLS1 and NLS2, respectively. controls were negative (Fig. 3a (boxes 2 and 4)). The purity of the protein preparations prepared by affinity purification 3.2. The 1H sequence encodes the 66 kDa structural were demonstrated by SDS–PAGE analysis on preparations protein of ISAV prepared likewise from corresponding cell lysates labeled by [35S]methionine (Fig. 3b). WB analysis of lysates of Sf9 cells expressing the 1H gene using the ISAV-PAb1 showed one major band of 66 kDa, and 3.4. The putative NP is an early protein shuttling two minor bands of approximately 58 and 43 kDa (Fig. 2a, between the nuclei and cytoplasm lane 1). Similar results were obtained using the anti-pep1H antiserum (Fig. 2a, lane 3). The antibodies did not react ISAV- and mock-infected ASK cells fixed every fourth with lysates of Sf9 cells infected with non-recombinant bac- hour from 4 to 24 h p.i., at 36 and at 48 h p.i. were analyzed by ulovirus (Fig. 2a, lanes 2 and 4). Furthermore, the anti-pep1H immunofluorescence using the anti-1H rabbit immune serum antiserum bound exclusively to the 66 kDa protein of puri- and the anti-HE MAb. No staining was observed in ISAV- fied virus preparations (Fig. 2b, lane 1), whereas the anti-1H infected cells until 8 h p.i. Faint nuclear staining with the antiserum gave a minor band of approximately 43 kDa in anti-1H was detected at 8 h p.i. (Fig. 4a and b), increasing in addition to the major band of 66 kDa (Fig. 2b, lane 2). ISAV- intensity until the HE was detected at 20 h p.i. using the anti- 56 V. Aspehaug et al. / Virus Research 106 (2004) 51–60
Fig. 4. Kinetics of cellular localization of NP (red) and HA (green) in ISAV infected ASK-cells. Immunofluorescence analysis are shown from 8 (a and b), 20 (c) and 48 (d) h p.i. using the Glesvær/2/90 isolate. The NP can be detected in the nucleus at 8 h p.i. (a and b), while the HA appears at about 20 h p.i. (c). At 48 h p.i., the NP has been exported to the cytoplasm (d). Using the Glesvær/2/90 isolate, the NP was observed sporadically in the nucleolus, seemingly very early after the onset of NP detection (b, indicated by arrows), while the nucleolus appeared devoid of NP during the remaining of the infectious cycle (c and d).
HE MAb, indicating that the 1H is an early protein. Weak anti-1H staining was observed in the nucleolus in a few cells at the onset of 1H detection (Fig. 4b). Preceding the onset of HE detection, the anti-1H staining had only been observed in the nucleus. At 20 h p.i., most cells showed strong nuclear staining using the anti-1H, whereas a more limited and dis- persed fluorescence was found in the cytoplasm (Fig. 4c). Thus, it seemed that the initiation of the export of the protein detected by the anti-1H to the cytoplasm coincided with the first detection of the HE. At 36 and 48 h p.i., anti-1H staining Fig. 3. RNA-binding assay. (a) Affinity purified viral and recombinant pro- exhibited increasing cytoplasmic fluorescence with little if tein were allowed to react with radioactively labeled RNA, washed, and ap- any nuclear fluorescence at 48 h p.i. (Fig. 4d). At this time plied to a nitrocellulose membrane. The dried membrane was exposed to an autoradiographic film. Protein purified from lysates of ISAV-infected ASK point, the HE was located to the cell membrane of most cells. cells using the anti-1H (NP) gave a clear reaction with the labeled RNA (box Mock-infected cells did not show any staining at any time. 1), while the corresponding extract from mock-infected cells gave no reac- tion (box 2). Similarly, protein extracted from lysates of Sf9 cells expressing 3.5. The putative NP contains two NLSs 1H gave a weaker but still clear reaction with the RNA (box 3), while the Sf9 cells infected with non-recombinant baculovirus (Bac) did not (box 4). (b) The purity of the protein preparations prepared by affinity purification Following transfection of CHSE-214 cells with 1H- were demonstrated by SDS–PAGE analysis on preparations prepared like- pVAX1, approximately 5% of the cells expressed 1H 5 days wise as the ones used for the RNA-binding assay, from the corresponding cell post transfection (p.t.). Twenty-four hours p.t. (Fig. 5a) im- lysates labeled by [35S]methionine. Autoradiography revealed one unique munofluorescence staining with the ISAV-PAb1 revealed a band of 66 kDa from both the ISAV-infected ASK cells (lane 1), and from Sf9 cells expressing 1H (lane 3), while mock infected ASK-cells and Sf9 distinct staining in the nucleolus, and a more evident nucle- cells infected with non-recombinant baculovirus gave no such band. Boxes oplasmic staining escalating in cells expressing more pro- and lanes holding the same numbers in (a) and (b) have the corresponding tein. At 48 h p.t. (Fig. 5b), the number of cells expressing protein preparations. the protein in the nucleoplasm increased, but still a distinct staining was observed in the nucleolus of transfected cells. At 70 h p.t. (Fig. 5c), staining was still observed predomi- nantly in the nucleus, but also dispersed throughout the cy- V. Aspehaug et al. / Virus Research 106 (2004) 51–60 57
Fig. 5. Cellular localization of the NP in CHSE-214 cells transfected with constructs of the Bremnes/98 segment 3. The full length clone encoded a protein that initially was detected in the nucleoli (indicated by stretched arrows) followed by the detection in the nucleoplasm (a and b). Localization to structures resembling Cajal bodies were also observed in transfected cells (a and b, indicated by arrowheads). The nucleoli staining became less prominent as the protein was exported to the cytoplasm (c), and at 7 days p.t. most of the staining was observed in the cytoplasm (d). The mutant lacking NLS-1 located exclusivelyto the cytoplasm (e) while the mutant lacking NLS-2 located to the nucleoli and the cytoplasm (f). The double mutant encoded a protein that located exclusively to the cytosol (g). toplasma, whereas the nucleolus staining was less promi- that this protein is encoded by segment 3. We demonstrate nent. Cells were also inspected at day 7 p.t., and at that that the protein share several properties with the influenza time most of the staining was located to the cytoplasm NP, including RNA-binding activity. It is an early protein (Fig. 5d). The distinct nucleolus staining observed in the initially detected in the nuclei which is transported out of the transfected cells using the Bremnes/98 segment 3 genome nuclei at the onset of the production of the late proteins, rep- sequence was observed a few times in infected cells whether resented here by the HE. Transfection studies confirmed that the Glesvær/2/90 or the Bremnes/98 isolate was used (Fig. 4b, the nucleoprotein has intrinsic ability to be imported into the showing Glesvær/2/90). nucleus, and two monopartite NLSs at aa 230RPKR233 and Cells transfected with the NLS-mutants were fixed 48 h 473KPKK476 were identified by computer analysis, and con- p.t. The NLS mutant 1H-pVAX1- NLS1 showed a clear firmed by site-directed mutagenesis. Segment 3 seemed to be cytoplasmic localization with no staining of the nucleus conserved between known ISAVisolates, like the NP-gene of (Fig. 5e). The 1H-pVAX1- NLS2 showed a similar stain- the influenza viruses. In addition to the previously reported ing pattern as 1H-pVAX1- NLS1, except that some of the sequence analysis data (Clouthier et al., 2002; Ritchie et al., cells showed a distinct staining in the nucleolus (Fig. 5f). The 2001; Snow and Cunningham, 2001), it was found that the same staining pattern as 1H-pVAX1- NLS1 was observed C-terminal 30 aa residues of the predicted ISAV segment 3 for the double mutant 1H-pVAX1- NLS1 NLS2 (Fig. 5g). protein were markedly rich in acidic amino acid residues, with a pI of 3.3, comparable to the equivalent aa residues in the influenza NP (Portela and Digard, 2002). 4. Discussion WB analysis of lysates of Sf9 cells expressing the 1H gene using the ISAV-PAb1 and the anti-pep1H antibody showed In this report, we describe the expression and functional one major band of 66 kDa. In addition, some minor bands in analysis of the gene product of ISAV genomic segment 3. the range of approximately 43–58 kDa were detected, possi- WB analysis revealed that the expressed protein was equiv- bly representing incomplete proteins or breakdown products alent to the 66 kDa protein previously detected in purified of the 66 kDa protein. No reaction was detected with lysates ISAV preparations (Falk et al., 2004, 1997), documenting of Sf9 cells infected with non-recombinant baculovirus. The 58 V. Aspehaug et al. / Virus Research 106 (2004) 51–60 anti-pep1H antiserum bound exclusively to the 66 kDa pro- of viral RNA into viral mRNA, and because it is a major reg- tein of purified virus preparations, whereas the anti-1H anti- ulator of nuclear export of viral RNP (Bui et al., 2000; Lamb serum also gave a minor band of approximately 43 kDa sub- and Krug, 1996; Martin and Helenius, 1991). Given that the stantiating that this band may represent an incomplete protein ISAV uses a similar replication control system as influenza or breakdown product of the 66 kDa protein. viruses, these observations, together with the RNA-binding The primary function of the NP in orthomyxoviruses is to properties of the protein, support that the protein encoded encapsidate the virus genome to facilitate RNA transcription, by ISAV segment 3 corresponds to the NP. This is also sup- replication, and packaging (Portela and Digard, 2002). Sev- ported by studies showing that this protein is one of the major eral studies have demonstrated the non-specific binding of structural proteins of the ISAV(Falk et al., 1997), and a major ssRNA to the influenza NP (Albo et al., 1995; Galarza et al., structural component of the RNP-complex (Falk et al., 2004). 1992; Harley et al., 1990; Kingsbury et al., 1987; Scholtissek Transfections using the 1H-pVAX1, corresponding to the and Becht, 1971). The RNA-binding properties of the ISAV ORF of segment 3, confirmed that the encoded protein has NP was confirmed by the interaction of purified viral and re- an intrinsic ability to be imported into the nucleus, and to be combinant protein with ssRNA transcribed in vitro, demon- exported from the nucleus to the cytoplasm later on. These strating that this protein has one of the key features of a NP. results are in agreement with previous reports on the NP of in- Time-course immunofluorescence studies of ISAV in- fluenza viruses (Bullido et al., 2000; Neumann et al., 1997). fected ASK cells using the anti-1H antiserum gave a local- However, the expressed protein initially located to the nu- ization pattern comparable to that of the influenza NP. The cleolus in the transfected cells, whereas a more evident nu- ISAV putative NP was first detected 8 h p.i., and was located cleoplasmic staining escalated in cells expressing more pro- exclusively in the nucleus until the onset of HE detection tein. A similar nucleolus localization of the NP was observed 12 h later. This is in agreement with reports on the NP of in ISAV-infected cells, but to a much lesser extent. The lo- influenza virus which is an early protein detectable 2.5–3 h calization of the NP to the nucleolus is a feature that has p.i., as opposed to the matrix (M1) and haemagglutinine (HA) been described in the influenza literature (Davey et al., 1985; which are late proteins that become detectable 1–4 h after the Hiscox, 2002; Stevens and Barclay, 1998), but many studies NP, depending on the infectious dose (Inglis et al., 1976; also report that the NP is absent from the nucleolus (Bucher et Maeno and Kilbourne, 1970; Martin and Helenius, 1991; al., 1989; Martin and Helenius, 1991). Observations done in Skehel, 1973; Sugawara et al., 1991). Time-course studies this study indicate that the ISAV NP enters the nucleolus ini- have demonstrated that the production of influenza M1 and tially in the replication process, but seems to be absent from HA in infected cells coincide, and that this event again co- the nucleolus in the remaining of the infection cycle. In trans- incides with the appearance of NP in the cytoplasm (Martin fected cells however, the nucleolus was distinctly positive for and Helenius, 1991). Since the anti-HE MAb is the only char- at least 48 h p.t., and the export of NP to the cytoplasm was acterized ISAV monoclonal antibody (Falk et al., 1998), the initiated much later than during a viral infection. This could ISAV-HE was used as a representative of the late proteins in indicate the need for another viral protein to facilitate the the present study. Thus, the appearance of the HE was used transport of the NP, even from the nucleolus to the nucleo- as an indicator to determine the relative time of appearance plasm. as compared to the protein detected by the anti-1H antiserum Proteins less than 30–40 kDa can be transported through in ISAV infected cells. The initiation of nuclear export of the the nuclear pore complex by diffusion (Gant and Wilson, ISAV putative NP coincided with the first appearance of HE, 1997), while larger molecules generally require a specific and continued until the nuclei appeared devoid of detectable NLS. NLSs have been identified for a number of viral and cel- protein, approximately 48 h p.i. Thus the protein detected lular proteins which have been classified as either monopar- with the anti-1H antiserum shares several properties with the tite or bipartite, depending on whether or not stretches of influenza NP, including it being an early protein, initially de- basic residues are interrupted by a 10 aa space region (Silver tected in the nuclei, followed by transport out of the nuclei and Ferrigno, 2000). The ISAV NP is 66 kDa, and almost at the onset of the production of the late proteins represented certainly relies on an active transport into the nucleus by here by the HE. The optimal replication temperature for the one or several NLSs, similar to the influenza A NP. Here, ISAV is 15 ◦C(Falk et al., 1997), thus as expected, the ISAV we identified two monopartite NLSs at aa 230RPKR233 and replication is slower than that of the influenza viruses. How- 473KPKK476 designated NLS1 and NLS2, respectively, by ever, the relative time of appearance of the different proteins computer analysis and site-directed mutagenesis. Transfec- should be correlated to the replication control systems used tion studies demonstrated that both NLSs were required for by the virus in the cells. It is assumed that a significant part of the transport of NP into the nuclei. However, some of the cells the replication control system established by influenza virus transfected using the mutant lacking NLS2 showed a distinct in infected cells is directed at the early synthesis of NP, while nucleolus staining in addition to the cytoplasmic staining, delaying the synthesis of the M1 protein. The NP is synthe- while no mutants lacking NLS1 localized to the nucleolus. sized early, presumably because it is needed for the synthesis This might indicate that the region around NLS1 is involved of template RNAs and viral RNAs. The synthesis of the M1 is in the nucleolus targeting of the protein in addition to the delayed, probably because this protein stops the transcription nuclear import. Since both NLSs had to be present for the V. Aspehaug et al. / Virus Research 106 (2004) 51–60 59 protein to localize in the nucleus, it is concluded that these Devold, M., Krossoy, B., Aspehaug, V., Nylund, A., 2000. Use of RT-PCR NLSs cooperate to target the protein to the nucleus, and that for diagnosis of infectious salmon anaemia virus (ISAV) in carrier sea no independent NLSs can be present in the ISAV NP. This trout Salmo trutta after experimental infection. Dis. Aquat. Organ. 40 (1), 9–18. is in contrast to previous findings that suggest that the NP of Eliassen, T.M., Froystad, M.K., Dannevig, B.H., Jankowska, M., Brech, orthomyxoviruses have independent NLSs (Neumann et al., A., Falk, K., Romoren, K., Gjoen, T., 2000. Initial events in infectious 1997; Weber et al., 1998). salmon anemia virus infection: evidence for the requirement of a low- In conclusion, the data presented provide further evidence pH step. J. Virol. 74 (1), 218–227. that the ISAV segment 3 encodes the NP, and that the ISAV Falk, K., Aspehaug, V., Vlasak, R., Endresen, C., 2004. Identification and partial characterisation of viral structural proteins of infectious NP shows several characteristics similar to the NP of the salmon anaemia (ISA) virus. J. Virol. 78 (6), 3063–3071. influenza virus. These include intracellular localization and Falk, K., Dannevig, B.H., 1995. Demonstration of infectious salmon migration, time of expression and detection in cell culture, anaemia (ISA) viral antigens in cell cultures and tissue sections. Vet. and RNA-binding activity. Two NLSs have been identified, Res. 26 (5–6), 499–504. but in contrast to other orthomyxoviruses that have indepen- Falk, K., Namork, E., Dannevig, B.H., 1998. Characterization and appli- cations of a monoclonal antibody against infectious salmon anaemia dent NLSs, these seem to cooperate in the nuclear import of virus. Dis. Aquat. Organ. 34 (2), 77–85. the ISAV NP. The distinct nucleolus staining observed in the Falk, K., Namork, E., Rimstad, E., Mjaaland, S., Dannevig, B.H., 1997. transfected cells indicate that there is a nucleolus localization Characterization of infectious salmon anemia virus, an orthomyxo- sequence in the NP, and mutagenesis studies indicate that the like virus isolated from Atlantic salmon (Salmo salar L.). J. Virol., region around NLS1 may be involved in this nucleolus tar- 9016–9023. Galarza, J.M., Sowa, A., Hill, V.M., Skorko, R., Summers, D.F., 1992. In- geting of the protein, however, further studies are needed to fluenza A virus NP protein expressed in insect cells by a recombinant confirm this nucleolus localization signal. baculovirus is associated with a protein kinase activity and possesses single-stranded RNA binding activity. Virus Res. 24 (1), 91–106. Gant, T.M., Wilson, K.L., 1997. Nuclear assembly. Annu. Rev. Cell Dev. Biol. 13, 669–695. Acknowledgements Griffiths, S., Cook, M., Mallory, B., Ritchie, R., 2001. Characterisation of ISAV proteins from cell culture. Dis. Aquat. Organ. 45, 19–24. The authors would like to thank A.M. Szilvay and A. Harley, V.R., Mather, K.A., Power, B.E., McKimm-Breschkin, J.L., Hud- Hellebø for helpful comments on the manuscript. This study son, P.J., 1990. Characterisation of an avian influenza virus nucleo- protein expressed in E. coli and in insect cells. Arch. Virol. 113 (3–4), was funded by Intervet International and by grant 128044/103 267–277. from the Norwegian Research Council. Hellebø, A., Vilas, U., Falk, K., Vlasak, R., 2004. Infectious salmon anemia virus specifically binds to and hydrolyzes 4-O-acetylated sialic acids. J. Virol. 78 (6), 3055–3062. Hiscox, J.A., 2002. The nucleolus—a gateway to viral infection? Arch. References Virol. 147, 1077–1089. Huang, T.-S., Palese, P., Krystal, M., 1990. Determination of influenza Albo, C., Valencia, A., Portela, A., 1995. Identification of an RNA binding virus proteins required for genome replication. J. Virol. 64 (11), region within the N-terminal third of the influenza A virus nucleo- 5669–5673. protein. J. Virol. 69 (6), 3799–3806. Inglis, S.C., Carroll, A.R., Lamb, R.A., Mahy, B.W., 1976. Polypeptides Biering, E., Falk, K., Hoel, E., Thevarajan, J., Joerink, M., Nylund, A., specified by the influenza virus genome I. Evidence for eight dis- Endresen, C., Krossøy, B., 2002. Segment 8 encodes a structural pro- tinct gene products specified by fowl plague virus. Virology 74 (2), tein of infectious salmon anaemia virus (ISAV); the co-linear transcript 489–503. from segment 7 probably encodes a non-structural or minor structural Kibenge, F.S., Garate, O.N., Johnson, G., Arriagada, R., Kibenge, M.J., protein. Dis. Aquat. Organ. 49 (2), 117–122. Wadowska, D., 2001. Isolation and identification of infectious salmon Bucher, D., Popple, S., Baer, M., Mikhail, A., Gong, Y.F., Whitaker, anaemia virus (ISAV) from Coho salmon in Chile. Dis. Aquat. Organ. C., Paoletti, E., 1989. M protein (M1) of influenza virus: antigenic 45 (1), 9–18. analysis and intracellular localization with monoclonal antibodies. J. Kibenge, F.S., Lyaku, J.R., Rainnie, D., Hammell, K.L., 2000. Growth of Virol. 63 (9), 3622–3633. infectious salmon anaemia virus in CHSE-214 cells and evidence for Bui, M., Wills, E.G., Helenius, A., Whittaker, G.R., 2000. Role of the in- phenotypic differences between virus strains. J. Gen. Virol. 81 (1), fluenza virus M1 protein in nuclear export of viral ribonucleoproteins. 143–150. J. Virol. 74 (4), 1781–1786. Kingsbury, D.W., Jones, I.M., Murti, K.G., 1987. Assembly of influenza Bullido, R., Gomez-Puertas, P., Albo, C., Portela, A., 2000. Several pro- ribonucleoprotein in vitro using recombinant nucleoprotein. Virology tein regions contribute to determine the nuclear and cytoplasmic lo- 156 (2), 396–403. calization of the influenza A virus nucleoprotein. J. Gen. Virol. 81 Koren, C.W.R., Nylund, A., 1997. Morphology and morphogenesis of (Pt 1), 135–142. infectious salmon anaemia virus replicating in the endothelium of Clouthier, S.C., Rector, T., Brown, N.E., Anderson, E.D., 2002. Genomic Atlantic salmon Salmo salar. Dis. Aquat. Organ. 29, 99–109. organization of infectious salmon anaemia virus. J. Gen. Virol. 83 (Pt Krossøy, B., Devold, M., Sanders, L., Knappskog, P.M., Aspehaug, V., 2), 421–428. Falk, K., Nylund, A., Koumans, S., Endresen, C., Biering, E., 2001a. Dannevig, B.H., Falk, K., Namork, E., 1995. Isolation of the causal virus Cloning and identification of the infectious salmon anaemia virus of infectious salmon anemia (ISA) in a long-term cell-line from At- haemagglutinin. J. Gen. Virol. 82 (Pt 7), 1757–1765. lantic salmon head kidney. J. Gen. Virol. 76, 1353–1359. Krossøy, B., Hordvik, I., Nilsen, F., Nylund, A., Endresen, C., 1999. Davey, J., Colman, A., Dimmock, N.J., 1985. Location of influenza virus The putative polymerase sequence of infectious salmon anemia virus M, NP and NS1 proteins in microinjected cells. J. Gen. Virol. 66 (Pt suggests a new genus within the Orthomyxoviridae. J. Virol. 73 (3), 11), 2319–2334. 2136–2142. 60 V. Aspehaug et al. / Virus Research 106 (2004) 51–60
Krossøy, B., Nilsen, F., Falk, K., Endresen, C., Nylund, A., 2001b. Phy- Ritchie, R.J., Heppell, J., Cook, M.B., Jones, S., Griffiths, S.G., 2001. logenetic analysis of infectious salmon anaemia virus isolates from Identification and characterization of segments 3 and 4 of the ISAV Norway, Canada and Scotland. Dis. Aquat. Organ. 44 (1), 1–6. genome. Virus Genes 22 (3), 289–297. Lamb, R.A., Krug, R.M., 1996. Orthomyxoviridae: the viruses and Rodger, H.D., Richards, R.H., 1998. Haemorrhagic smolt syndrome: a their replication. In: Fields, B.M., Knipe, D.M., Howley, P.M., severe anaemic condition in farmed salmon in Scotland. Vet. Rec., Chanock, R.M., Melnick, J.L., Monath, T.P., Roizman, B., Straus, S.E. 538–541. (Eds.), Fields Virology. Lippincott-Raven, Philadelphia, PA, pp. 1353– Sandvik, T., Rimstad, E., Mjaaland, S., 2000. The viral RNA 3 - and 5 - 1395. end structure and mRNA transcription of infectious salmon anaemia Lannan, C.N., Winton, J.R., Fryer, J.L., 1984. Fish cell lines: establish- virus resemble those of influenza viruses. Arch. Virol. 145 (8), ment and characterization of nine cell lines from salmonids. In Vitro 1659–1669. 20 (9), 671–676. Scholtissek, C., Becht, H., 1971. Binding of ribonucleic acids to the RNP- Lee, M.T., Bishop, K., Medcalf, L., Elton, D., Digard, P., Tiley, L., 2002. antigen protein of influenza viruses. J. Gen. Virol. 10 (1), 11–16. Definition of the minimal viral components required for the initia- Schyth, B.D., Olesen, N.J., Østergard,˚ P., Falk, K., 2003. Laboratory tion of unprimed RNA synthesis by influenza virus RNA polymerase. diagnosis of infectious salmon anemia (ISA): experience gained from Nucleic Acids Res. 30 (2), 429–438. the outbreaks on the Faroe Islands 2000–2003. In: Diseases of Fish Lovely, J.E., Dannevig, B.H., Falk, K., Hutchin, L., MacKinnon, A.M., and Shellfish, 11th International Conference of the EAFP, vol. 11, p. Melville, K.J., Rimstad, E., Griffiths, S.G., 1999. First identification of O-79. infectious salmon anaemia virus in North America with haemorrhagic Silver, P.A., Ferrigno, P., 2000. Nuclear–cytoplasmic transport. In: kidney syndrome. Dis. Aquat. Organ. 35 (2), 145–148. Nature Encyclopedia of Life Sciences. Nature Publishing Group. Maeno, K., Kilbourne, E.D., 1970. Developmental sequence and intracel- http://www.els.net/ [doi:10.1038/npg.els.0001351]. lular sites of syntehsis of three structural protein antigens of influenza Skehel, J.J., 1973. Early polypeptide synthesis in influenza virus-infected A2 virus. J. Virol. 5 (2), 153–164. cells. Virology 56 (1), 394–399. Martin, K., Helenius, A., 1991. Nuclear transport of influenza virus ri- Snow, M., Cunningham, C.O., 2001. Characterisation of the putative nu- bonucleoproteins: the viral matrix protein (M1) promotes export and cleoprotein gene of infectious salmon anaemia virus (ISAV). Virus inhibits import. Cell 67 (1), 117–130. Res. 74 (1–2), 111–118. Mjaaland, S., Rimstad, E., Falk, K., Dannevig, B.H., 1997. Genomic char- Snow, M., Ritchie, R., Arnaud, O., Villoing, S., Aspehaug, V., Cunning- acterization of the virus causing infectious salmon anemia in Atlantic ham, C.O., 2003. Isolation and characterisation of segment 1 of the salmon (Salmo salar L.): an orthomyxo-like virus in a teleost. J. Virol. infectious salmon anaemia virus genome. Virus Res. 92 (1), 99–105. 71 (10), 7681–7686. Stevens, M.P., Barclay, W.S., 1998. The N-terminal extension of the in- Mullins, J.E., Groman, D., Wadowska, D., 1998. Infectious salmon fluenza B virus nucleoprotein is not required for nuclear accumulation anaemia in salt water Atlantic salmon (Salmo salar L.) in New or the expression and replication of a model RNA. J. Virol. 72 (6), Brunswick, Canada. Bull. Eur. Assoc. Fish Pathol. 18 (4), 110–114. 5307–5312. Neumann, G., Castrucci, M.R., Kawaoka, Y., 1997. Nuclear import and Sugawara, K., Nishimura, H., Hongo, S., Kitame, F., Nakamura, K., 1991. export of influenza virus nucleoprotein. J. Virol. 71 (12), 9690–9700. Antigenic characterization of the nucleoprotein and matrix protein of Portela, A., Digard, P., 2002. The influenza virus nucleoprotein: a mul- influenza C virus with monoclonal antibodies. J. Gen. Virol. 72 (Pt tifunctional RNA-binding protein pivotal to virus replication. J. Gen. 1), 103–109. Virol. 83 (Pt 4), 723–734. Thorud, K., Djupvik, H.O., 1988. Infectious salmon anaemia in Atlantic Rimstad, E., Mjaaland, S., 2002. Infectious salmon anaemia virus. Apmis salmon (Salmo salar L.). Bull. Eur. Assoc. Fish Pathol. 8, 109–111. 110 (4), 273–282. Weber, F., Kochs, G., Gruber, S., Haller, O., 1998. A classical bipartite Rimstad, E., Mjaaland, S., Snow, M., Mikalsen, A.B., Cunningham, C.O., nuclear localization signal on Thogoto and influenza A virus nucleo- 2001. Characterization of the infectious salmon anemia virus genomic proteins. Virology 250 (1), 9–18. segment that encodes the putative hemagglutinin. J. Virol. 75 (11), 5352–5356.
Paper III
Aspehaug et al: First Characterization of the ISAV Fusion Protein
First Characterization of the Infectious Salmon Anemia Virus
Fusion Protein
Vidar Aspehaug1*, Aase B. Mikalsen2, Mike Snow3, Eirik Biering4† and Stephane Villoing4
1 Department of Biology, University of Bergen, Bergen, Norway
2 Norwegian School of Veterinary Science, Oslo, Norway
3 FRS Marine Laboratory, Aberdeen, UK
4 Intervet Norbio, Bergen, Norway
† Current address: Institute of Marine Research, Bergen, Norway
*Corresponding author:
Vidar Aspehaug, Department of Biology, University of Bergen, Thormøhlensgate 55, 5020
Bergen, Norway e-mail: [email protected]
Tlf: +47 55 58 44 06
Fax: +47 55 58 44 50
Word count summary: 257
Word count main text: 6537
Running title: First Characterization of the ISAV Fusion Protein
Key words: orthomyxovirus, ISAV, fusion protein, coiled-coil, fusion peptide, metastable, F0, F1,
F2, proteolytic activation, proteolytic cleavage, structural proteins.
The GenBank accession numbers of the sequences reported in this study are CAD99169 (protein sequence) and AX752070 (nucleotide sequence).
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Summary
Infectious salmon anemia virus (ISAV) is an orthomyxovirus causing serious disease in Atlantic salmon (Salmo salar L.). This study presents the characterization of the ISAV 50 kDa glycoprotein encoded by segment 5, and we propose that it should be termed the viral membrane fusion protein (F). This is the first description of a separate orthomyxovirus F protein, and to our knowledge, the first pH dependent separate viral F protein described. Our data demonstrate that the F protein is synthesized as a precursor protein F0 which is proteolytically cleaved to F1 and
F2, held together by disulfide bridges. The cleaved protein is in a metastable, fusion activated state that can be triggered by low pH, high temperature, or a high concentration of urea. Cell-cell fusion in ISAV infected and transfected cells can be initiated by treatment with trypsin and low pH. Fusion is initiated at pH 5.4-5.6, and the fusion process is coincident with the trimerization of the F protein, or a stabilization of the trimer, providing strong evidence that it represents the formation of the fusogenic structure. Exposure to trypsin and low pH prior to infection inactivated the virus, demonstrating the non-reversibility of this conformational change.
Sequence analyses indicate that the protein carries a coiled-coil and a fusion peptide. Size estimates of F1 and F2 and the localization of the putative fusion peptide and theoretical trypsin cleavage sites suggest that the proteolytic cleavage site is after residue K276 in the protein sequence. The cleavage site structure is probably not a major determinant of pathogenicity in the
ISAV.
Page 2
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Introduction
Infectious salmon anemia virus (ISAV) is an enveloped virus belonging to the family
Orthomyxoviridae, genus Isavirus, causing serious disease in Atlantic salmon (Salmo salar L.) aquaculture (53, 59, 69, 72, 81). The ISAV genome is composed of eight negative-sense, single- stranded RNA segments, and whilst nucleotide sequences of all segments have been published
(9, 45, 46, 57, 67, 68, 75, 76), much remains to be elucidated with respect to protein identification and characterization. A total of 12 proteins have been detected by immunoprecipitation of lysates from radiolabeled infected cells (42), while four major structural proteins have been recognized in purified ISAV particles, including the matrix (M1; 22–24 kDa)
(7, 24), the nucleoprotein (NP; 66-71 kDa) (3, 24), and two membrane glycoproteins (24). The receptor-binding and receptor-destroying activities are associated with the 42 kDa glycoprotein encoded by segment 6, termed the hemagglutinin-esterase (HE) (24, 25, 36, 44, 45, 67), while the activities of the second glycoprotein, glycoprotein 50 (Gp50) encoded by segment 5 (9), have not been described previously.
ISAV pursues a nuclear replication strategy similar to the influenza viruses (3, 26), which is initiated by receptor-binding and internalization into cellular endosomes where the viral and cellular membranes fuse in response to low pH (21). The addition of trypsin to the culture medium during ISAV replication has been demonstrated to have a beneficial effect on the production of infective virus particles (26), suggesting that ISAV replication depends on proteolytic activation to exert infectivity.
Fusion between viral and cellular membranes is mediated by viral membrane fusion glycoproteins, which are usually divided into two distinct categories. Type I fusion proteins are activated by proteolytic cleavage, and include the fusion proteins of orthomyxo-, paramyxo-,
Page 3
Aspehaug et al: First Characterization of the ISAV Fusion Protein
retro-, and filoviruses (19). Type II fusion proteins comprise the fusion proteins of flaviviruses, alphaviruses, and bunyaviruses, and these do not depend on proteolytic cleavage for activation, but are associated with a second protein whose cleavage is essential for establishing fusion competence (30, 34, 35).
Type I fusion proteins are synthesized as single-chain precursors which assemble into homotrimers (13). An essential step in rendering the proteins fusion competent, is the cleavage of the protein by host proteases to generate two subunits bound together by disulfide bridges
(50). This cleaved form of the protein is in a metastable state, trapped from achieving its lower energy state by a kinetic barrier, and is readily activated by destabilization such as receptor- binding or low pH (50). Once activated, the protein refolds into a highly stable conformation
(12). Type I fusion proteins contain a hydrophobic sequence, known as the fusion peptide (FP), at or near the new amino-terminal region created by the cleavage event (58, 63, 77), and their final (post-fusion) state contains a characteristic -helical coiled-coil core structure corresponding to a heptad-repeat motif (12, 58). In recent years, these structures have been the target for development of new anti-viral drugs, including fusion inhibiting peptides and antibodies (20, 52, 83), suggesting that fusion proteins might be important candidates both for vaccination and as therapeutic targets.
Fusion of influenza A viruses to the cell membrane is mediated through the hemagglutinin (HA), and although the pathogenicity of influenza viruses is polygenic, numerous studies have established that the cleavage site structure of the HA precursor is the most significant determinant of pathogenicity (reviewed in 65, 78). Generally, HAs of avirulent strains are cleaved by a restricted number of host proteases. More virulent strains convey enhanced HA- cleavability due to basic residues within the cleavage site, and can be cleaved by a wide range of host proteases, leading to systemic infection and a higher pathogenicity. A similar correlation Page 4
Aspehaug et al: First Characterization of the ISAV Fusion Protein
between F protein cleavage site structure and pathogenicity has been observed in paramyxoviruses (32, 79, 82), and may also be important in the pathogenicity of ISAV. Thus, the identification of the F protein and its proteolytic cleavage site might be key factors in establishing the virulence factors of the ISAV.
The present study was undertaken to verify that the ISAV genomic segment 5 encodes the 50 kDa glycoprotein, and to demonstrate that it is the viral F protein. We have shown experimentally that the encoded protein exhibits the general characteristics described for type I viral fusion proteins.
Page 5
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Materials and methods
Virus and cells
The ISAV isolates used in the experiments were Bremnes/98 (47) or Glesvaer/2/90 (15) as indicated. The virus isolates were propagated in Salmon Head Kidney (SHK-1) cells as previously described (14). Functional assays were performed using SHK-1, Atlantic Salmon
Kidney (ASK) cells (18), and Chinook Salmon Embryo (CHSE-214) cells (51). Infections were performed as described by Falk et al. (26).
Sf9 cells were grown in suspension culture, infected with baculovirus at 28°C and harvested 5 days post infection (p.i.) by centrifugation at 750 x g for 20 min at 4°C. The cell pellet was resuspended in 10 mM phosphate buffered saline (PBS) [pH 7.4] with 0.2% Triton X-100
(Amersham Biosciences), and used for immunization.
Purified ISAV preparations were prepared by sucrose gradient centrifugation using the
Bremnes/98 isolate, and infectivity titrations of ISAV and virus neutralization assays were performed by endpoint titration in 96-well culture plates, using an immunofluorescence assay, all as described previously (25, 26).
Cloning and sequencing
A unidirectional cDNA library from ASK cells infected with ISAV Bremnes/98 isolate was constructed in bacteriophage Lambda, as previously described (45). A clone, designated EB5, was identified by immunoscreening with a polyclonal anti-ISAV rabbit serum (ISAV-PAb) using the picoBlue immunoscreening kit (Stratagene). The EB5 cDNA insert was excised as described previously (45), and sequenced. Full-length cDNA sequence was obtained by 5’ RACE (5’
Page 6
Aspehaug et al: First Characterization of the ISAV Fusion Protein
RACE system version 2.0, Invitrogen). RACE products were cloned in the pCR2.1-TOPO vector using the TOPO TA cloning kit (Invitrogen) and sequenced.
To amplify the coding region of the EB5 cDNA insert, the primer set EB5-EcoRI: 5’-
GAGCTAACAGAGAGGAATTCATGGCTTTTCTAAC-3’ and EB5-XhoI: 5’-
CCAGCAGAAACTCGAGTTATCTCCTAATGC-3’ were used. The PCR product was subsequently cloned into pFastBac1 and pVAX1 vectors (Invitrogen), using the EcoRI and XhoI restriction enzymes (Promega). These vectors were named pFastBac1/EB5 and pVAX1/EB5, respectively.
For expression of the ISAV-HE in fish cells, the vector pVAX1/HE was constructed. ISAV
Bremnes/98 HE-gene (45) was amplified by PCR using primers HE-KpnI-f (5’-
GGGTACCGCAAAGATGGCACGATTC-3’) and HE-XhoI-r (5’-
CCGCTCGAGGTTGTCTTTCTTTCATAATC-3’), and cloned into the restriction sites KpnI and XhoI of the pVAX1 vector.
The pFastBac1/EB5, pVAX1/EB5 and pVAX1/HE were all used in transformations of E.coli
TOP10 cells (Invitrogen), purified using endofree plasmid Midi kit (Qiagen), and sequenced using the BigDye terminator sequencing kit (PE Biosystems) and an ABI 377 DNA analyzer (PE
Biosystems). Sequences were assembled and analyzed as previously described (45).
Computer-based Protein Sequence Analysis
Sequence database searches were performed using BLAST (1). Pair-wise sequence alignments were performed using ClustalX (80) and viewed using GeneDoc (60). Primary and secondary structure predictions were performed using the Expasy tools, including Compute pI/MW and
PeptideCutter (31). DISULFIND was used to predict disulfide bridges (85). Post-translational Page 7
Aspehaug et al: First Characterization of the ISAV Fusion Protein
modifications were predicted using SignalP (5), NetOglyc 2.0 (33), and Motif Scan (61), while topology predictions were done by TopPred2 (84), SPLIT (41), and TMPred (38). Learncoil-
VMF, a program specialized in the prediction of viral coiled-coil membrane fusion domains (74), was used to search for sequences with the probability of forming -helical coiled-coils using a probability of 0.5 as the cut-off value. The program COILS, which estimate the probability that a sequence will adopt a coiled-coil conformation, was also used (54). Structure homology searches were done by FUGUE (73) and PDB-BLAST (2). Tertiary structure predictions based on structural homology were done by TITO/MODELLER 4.0 (27, 55, 71), using a PDB structure from Visna virus Env coiled-coil (1jek) to perform 3D-modeling. Genbank sequence accession numbers reported in this study are CAD99169 (protein sequence) and AX752070 (nucleotide sequence) for segment 5 of the Norwegian ISAV isolate Bremnes/98.
Expression of EB5 cDNA in Sf9 cells
Purified pFastBac1/EB5 was transformed into E.coli TOP10 cells (Invitrogen), and the isolated plasmid used to transform E.coli DH10Bac competent cells (Invitrogen). Recombinant bacmid was obtained from the transformed DH10Bac cells and used to recover recombinant baculovirus
(BacEB5) after transfection of Sf9 cells according to the method described in the Bac-to-bac kit
(Invitrogen). BacEB5 was used to express the EB5 protein in Sf9 cells according to the recommendations of the manufacturer. The expression level and specificity of the recombinant
EB5 protein expressed in Sf9 cells was verified using the ISAV-PAb (see below) in immunoblot and immune staining of EB5 expressing cells (results not shown).
Antisera
An antisera against two synthetic peptides derived from the EB5 sequence were prepared by
Eurogentec using the peptides [HWTTSRSRLEDSTWQGG]-NH2 and
[HFTTERIKTGKVDLDSC]-NH2 (indicated in Fig. 1.a.) coupled to keyhole limpet Page 8
Aspehaug et al: First Characterization of the ISAV Fusion Protein
haemocyanin. The conjugated peptides were pooled and injected into a rabbit according to
Eurogentec's procedures, resulting in the antiserum termed anti-pepEB5.
A synthetic peptide [GAASAEDVKEKLNGIIDQINKVNLLLEGEIEAVRRIAYMN]-NH2 corresponding to the predicted EB5 coiled-coil sequence (see results section) was synthesized by
Sigma-Genosys Ltd, purified to >95% purity by HPLC, and coupled to keyhole limpet haemocyanin. The conjugated peptide was injected into a rabbit according to Sigma-Genosys
Ltd’s procedures, resulting in the antiserum named anti-pepcoilEB5.
An antiserum against the baculovirus expressed EB5 protein (anti-EB5Bac) was prepared by immunizing a rabbit four times with four weeks intervals, using approximately 150 µg protein from a crude lysate of Sf9 cells infected with BacEB5.
A polyclonal antiserum prepared against whole ISAV, ISAV-PAb (45), a monoclonal antiserum directed against the ISAV NP, anti-NP MAb (Aquaculture Diagnostics Limited), and a monoclonal antiserum directed against the ISAV HE, anti-HE MAb (3H6F8) (25), were also used in this study.
Transfections
Transfections performed for immunofluorescence analysis were done on CHSE-214 cells grown on coverslips in 24-well plates using the FuGENE 6 Transfection reagent (Roche Diagnostics) according to the manufacturer’s recommendations.
For fusion assays, single and combined transfections of SHK-1 cells were performed with the plasmid pVAX1/EB5 and/or pVAX1/HE using the Amaxa Nucleofector™ Technology (Amaxa Page 9
Aspehaug et al: First Characterization of the ISAV Fusion Protein
GmbH). A procedure optimized according to the manufacturer’s protocol for the fish cell line
TO, by E. García-Rosado and coworkers (personal communication) was used. The pVAX1/EB5 and pVAX1/HE plasmids were used in 1:2, 1:1, and 2:1 ratio, transfecting 5x 106 cells using a total of 9 g DNA in transfections using both plasmids, and 7.5 g DNA in single transfections.
The transfected cells were transferred into two parallel wells in a 6-well plate and incubated as recommended for SHK-1.
Fusion assay
A syncytium fusion assay was established using SHK-1 cells infected with the ISAV
Glesvaer/2/90 isolate. The cells were treated with 0, 2.5, 5, 10, 20, 40, and 60 µg/ml trypsin
(Sigma) in Leibovitz L-15 (L-15; Gibco BRL) medium for 15 minutes at room temperature (RT), followed by incubation at pH 3.5-8.5 for 15 minutes at RT. After initial experiments, the syncytium assay was standardized to using 20 µg/ml trypsin in L-15 and pH 4.5. Trypsin was inactivated by 10% fetal calf serum in L-15, and between incubations the cells were washed in
L-15. Finally, the cells were incubated in L-15 at RT for 2 h and kept at 4°C overnight prior to fixation by incubation in 80% acetone for 20 min and immune staining as described below.
Immunofluorescence
Cells attached to cover slips were fixed with cold 3.7% formaldehyde in PBS for 10 min on ice, rinsed in PBS, and permeabilized with 0.2% Triton-X 100 (Amersham Biosciences) in PBS for
30 min at RT, followed by blocking in 5% non-fat dry milk (Sigma) in PBS for 30 min. The cells were incubated with primary antibodies diluted in 2.5% non-fat dry milk in PBS for 1 h and washed in PBS. Bound antibodies were detected using Alexa dye 488-labeled anti-rabbit IgG
(Molecular probes) and/or Alexa dye 594-labeled anti-mouse IgG (Molecular probes). For staining in fusion assays, cell nuclei were stained by incubation with 10 g/ml propidium iodide
Page 10
Aspehaug et al: First Characterization of the ISAV Fusion Protein
(Sigma) in PBS for 1 min prior to the last wash in the staining procedure. After washing, the cells were mounted with SlowFade Antifade (Molecular Probes) or Vectashield antifade medium containing DAPI (Vector Laboratories) and examined in a confocal microscope (Leica, TCS SP2
AOBS) or a standard inverted microscope (Olympus, IX81). Polyclonal antisera (including secondary antisera) were adsorbed by incubation on monolayers of formaldehyde fixed and permeabilized ASK cells prior to use in immunofluorescence.
SDS-PAGE and Western blot (WB) analysis
Samples were treated with dissociation buffer (50 mM Tris-HCl [pH 6.8], 1% SDS, 50 mM dithiothreitol, 8 mM EDTA, 0.01% bromophenol blue) and heated for 5 min at 95°C. In non- reduced samples, dithiothreitol was omitted and samples were incubated for 30 min at RT.
Proteins were separated by SDS-PAGE with the discontinuous system devised by Laemmli (48) using 0.5 mm-thick precast 12.5%, or 8-18% gradient, polyacrylamide gels (ExcelGel SDS;
Amersham Biosciences), and transferred to a PVDF membrane (Hybond™-P: Amersham
Biosciences) as previously described (45). The membrane was treated with blocking solution
(PBS, 0.1% Tween-20, 5% non-fat dry milk) overnight at 4°C followed by 1 h incubation at RT with the primary rabbit immune serum. The membrane was then washed 3 times in blocking solution and incubated with goat anti-rabbit horseradish peroxidase (HRP) conjugate (AMDEX:
Amersham Biosciences) for 1 h at RT. Bound HRP-conjugate was detected using ECL Plus™
(Amersham Biosciences) and exposure on Hyperfilm™ ECL™ (Amersham Biosciences). The blots were scanned in a desktop scanner (CanoScan 3000F, Canon) and analyzed using Quantity
One 1D-gel analysis software (Version 4.5.2. BioRad).
A 2D-electrophoresis was performed by using non-reducing SDS-PAGE in the first dimension.
A lane excised from the polyacrylamide gel was immersed in dissociation buffer and heated for 5
Page 11
Aspehaug et al: First Characterization of the ISAV Fusion Protein
min at 95°C before it was run in the second dimension on reducing SDS-PAGE and blotted as described.
Trypsin digestion assay and Gp50 homotrimer formation/stabilization
Samples were incubated with trypsin (Sigma) to a final concentration of 20 g/ml in PBS for 10 min at 37°C. The digestion was stopped by addition of trypsin inhibitor from bovine pancreas
(type I-P; Sigma) to a final concentration of 20 g/ml. After digestion, the pH of the samples was adjusted by diluting the samples 1:1 in 0.2 M citrate buffer (pH in the range 4.5 - 7.3 ± 0.1), or the samples were exposed to 60°C or 4.5 M urea (final concentration), incubated 1 h at RT and analyzed under non-reducing conditions on SDS-PAGE and WB as described above.
Chemical Cross-Linking
Chemical cross-linking of purified virus was attempted by incubation with ethylene glycol bis(sulfosuccinimidyl succinate) (EGS) (Sigma) for 1 h either on ice or at RT, at concentrations of 0.1, 0.5, 2.0, and 5.0 mM EGS. Crosslinked products were analyzed under reducing conditions on SDS-PAGE and WB as described above.
Page 12
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Results
EB5 sequence shares a high identity with previously published segment 5 sequences
Immunoscreening of the bacteriophage Lambda cDNA library identified an ISAV clone designated EB5 (1468 nucleotides). The EB5 cDNA insert contained one ORF of 1332 nucleotides, theoretically encoding a protein of 444 amino acids with an estimated MW of ~48.6 kDa and a pI of 7.76. The EB5 nucleotide sequence shared 99%, 98%, and 81% identity with the previously published Scottish, Norwegian, and Canadian segment 5 sequences, respectively (9).
At the amino acid level, EB5 shared 93% identity with the Scottish isolate, and 78% and 91% identity with the Canadian and a Norwegian isolate, respectively (Fig. 1.) (9). No significant similarity to any other sequences was found.
TMPred predicted residues M1-C17, F274-Y292, and V417-W439 to be potential transmembrane regions (Fig. 1.), and these were confirmed by TopPred2 and SPLIT. Residues V417-W439 were predicted as the primary transmembrane region, whereas residues M1-C17 were predicted to be a signal sequence by SignalP. Two N-glycosylation and two O-glycosylation sites were predicted by Motif Scan and NetOglyc 2.0, respectively. A total of 46 potential trypsin cleavage sites were identified by PeptideCutter and 20 cysteine residues putatively involved in disulfide bonds were predicted using DISULFIND (all indicated in Fig. 1).
The segment 5 protein contains a putative coiled-coil motif
Learncoil-VMF predicted a coiled-coil domain typical of viral membrane fusion proteins at residues G301-N340 in the segment 5 protein sequence with an average probability of 87% (Fig.
1). This region was also predicted as forming a coiled-coil with the program COILS with an average probability higher than 80% (window of 28 residues). Also, FUGUE predicted a structural homology between residues V297-K367 in the segment 5 protein sequence and the PDB Page 13
Aspehaug et al: First Characterization of the ISAV Fusion Protein
structure 1jek corresponding to the Visna virus Env transmembrane core structure, with the highest Z-score (4.15) with a 95% confidence. This structure is composed of two coiled-coil motifs in the Env polyprotein of Visna virus, located between residues S694-E731 and Q776-A807 of this protein. The structural homology to these Visna virus motifs was localized to V297-R334 and
R335-K367 in the segment 5 protein sequence, spanning through the putative coiled-coil (Fig. 1).
Other PDB structures giving high scores were leucine zipper domains, which also form coiled- coil structures enabling oligomerization, and coiled-coil domains of the HIV and SIV Gp41 protein (data not shown).
Using the structural homology found with the PDB structure 1jek, the computation of a 3D model for the putative coiled-coil motif present in the segment 5 protein sequence was performed using MODELLER 4.0. This software, which performs homology modeling of protein structures by satisfaction of spatial restraints, predicted the structurally homologous regions of the ISAV predicted coiled-coil motif to adopt an α-helix conformation. Such a helix is typically formed by a coiled-coil domain enabling oligomerization and assembly of the fusion protein in a trimer-of-hairpin structure.
Using PDB-BLAST, a significant structural and sequence homology was also found between residues A379-M427 in the influenza A HA2 (accession # AF194991), corresponding to the coiled- coil region (8), and residues G301-N340 in the ISAV segment 5, predicted as the coiled-coil (Fig.
2).
The segment 5 protein contains a putative FP
Multiple sequence alignments of the ISAV segment 5 protein sequence and viral FPs from several paramyxoviruses, orthomyxoviruses, and retroviruses suggested a putative ISAV FP
(pFP) at residues C277-Y292 (Table 1). Residue G279 in the pFP was conserved amongst all the Page 14
Aspehaug et al: First Characterization of the ISAV Fusion Protein
included viruses, whereas F280 was common to ISAV, pneumoviruses, retroviruses, and orthomyxoviruses, and G285 was conserved in ISAV, pneumoviruses, and retroviruses (Table 1).
The highest level of conservation was found between the Canadian ISAV pFP (9) and the FP from Bovine Respiratory Syncytial Virus (BRSV), and between the Norwegian pFP and the
Human Respiratory Syncytial Virus subgroup A (HRSV) FP. These revealed a 43.8 % identity (7 out of 16 residues in the pFP are identical) (Table 1). It was noteworthy that identical amino acids corresponded to residues conserved in several pneumoviruses (11). The potential transmembrane region predicted at residues F274-Y292 overlaps the pFP.
Antibodies towards recombinant segment 5 protein and synthetic peptides react with Gp50
The antisera anti-pepEB5, anti-pepcoilEB5, and anti-EB5bac all reacted specifically with a protein of 50 kDa (Gp50) in WB analysis of purified ISAV run at reducing conditions in SDS-
PAGE (Fig. 3a, lane 1, 3, and 5). The anti-pepEB5 and anti-EB5bac also reacted with two weaker bands of approximately 30 and 100 kDa. The two latter antibodies also reacted with infected cells, giving identical immune staining (described below).
Trypsin and low pH is required for cell-cell fusion of ISAV infected fish cells and red blood cells
The syncytium fusion assay demonstrated that trypsin treatment combined with subsequent lowering of the pH to 5.5 or below is a prerequisite for fusion between ISAV-infected SHK-1 cells (Fig. 4a). No fusion was seen when omitting either the trypsin treatment or the acidification
(Fig. 4c). Increasing the concentration of trypsin resulted in both an increase in the total number of cells involved in syncytium formation, and an increase in the number of cells involved in each syncytium (seen as number of nuclei). The optimal conditions for fusion were at the highest concentration of trypsin possible without causing detachment of a large proportion of the cells
Page 15
Aspehaug et al: First Characterization of the ISAV Fusion Protein
(20 µg/ml) combined with pH 4.5. This resulted in syncytia containing up to 40 nuclei in some repetitions (results not shown).
These optimal conditions for fusion were confirmed using a lipid mixing assay based on the fusion between ISAV infected cells and Octadecyl rhodamine B (R18) (Molecular Probes) membrane-labeled Atlantic salmon erythrocytes (4), which resulted in transfer of R18 from the erythrocyte membrane to the cell membrane after induction of fusion (Fig 4e).
Cell-cell fusion in transfected cells
The optimal conditions for the syncytium fusion assay (20 g/ml trypsin and pH 4.5) were used for testing the fusion activity in SHK-1 cells after transfection with pVAX1/EB5 and/or pVAX1/HE. Fused cells resulting in syncytia with up to 9 nuclei were observed in wells transfected with both constructs (Fig. 4b). Syncytium formations were most abundant in wells transfected with pVAX1/EB5 and pVAX1/HE in 2:1 ratio. No syncytia were observed in wells transfected with only one of the constructs, thus this experiment did not produce enough evidence to conclude that the segment 5 protein alone is responsible for the fusion activity. This was probably due to the generally low transfection efficacy which is a very common problem with fish cell systems. Transfected cells incubated with 20 g/ml trypsin, followed by incubation at pH 7.4 served as negative controls (Fig. 4d), and no signs of syncytium formation was observed in these cells expressing either protein, separately or combined.
Gp50 is a late protein locating to the ER, golgi and the cell membrane
ISAV-infected and mock-infected ASK cells fixed every fourth hour from 4 to 24 h p.i., at 36 and 48 h p.i. were analyzed by immunofluorescence using the anti-EB5bac rabbit immune serum in combination with the anti-HE MAb or the anti-NP MAb. No staining was observed in ISAV- infected cells until 8 h p.i. when the NP was detected in the nucleus, representing an early Page 16
Aspehaug et al: First Characterization of the ISAV Fusion Protein
protein as previously described (3). At 20 h p.i. the NP was detected in the nucleus and cytoplasm and the HE was detected in the endoplasmatic reticulum (ER) or golgi, representing a late protein, also as previously described (3). At 24 h p.i. the anti-EB5bac revealed a distinct staining in the ER or golgi of infected cells (Fig. 5a), and at 36 and 48 h p.i., the anti-EB5bac staining was also located to the cell membrane of infected cells (Fig. 5b). The immune staining using anti-EB5bac differed from what has been observed for the HE by appearing a little later, and by appearing in the membrane of vacuole-like structures of different sizes in infected cells
(Fig 5b.). Only limited co-localization was observed between the HE and the segment 5 protein
(Fig. 5c.) Mock-infected cells did not show any staining at any time.
Following transfection of CHSE-214 cells with pVAX1/EB5 using FuGENE 6, approximately 3-
5% of the cells expressed the segment 5 protein 5 days post transfection (p.t.). Transfected cells were immune stained with the anti-EB5bac, and cells expressing the protein revealed a similar immune staining as infected cells (Fig. 5d).
Gp50 can be cleaved by trypsin into two disulphide linked fragments
As described, the new antibodies presented in this study are specific for Gp50, and in addition anti-pepEB5 and anti-EB5bac recognize two bands of 30 and 100 kDa in WB analysis of purified ISAV run in reducing conditions on SDS-PAGE. Trypsin treatment of purified virus resulted in a reduction in the amount of Gp50 detected by all antibodies, while the intensity of the 30 kDa protein band increased when using anti-pepEB5 and anti-EB5bac (Fig 3a, lane 2 and
4). Concurrently, a band of approximately 20 kDa was detected by anti-pepcoilEB5 only (Fig.
3a, lane 6). Lowering the pH in the samples did not affect the results in reducing SDS-PAGE
(results not shown). When the trypsin treated and untreated virus were run at non-reducing conditions in SDS-PAGE all antibodies detected only the 50 and 100 kDa proteins indicating that the 30 and 20 kDa fragments are the cleavage products of Gp50, and that these are bound Page 17
Aspehaug et al: First Characterization of the ISAV Fusion Protein
together by disulphide bridges (results shown for anti-pepEB5) (Fig. 3b, lane 1 and 2). A slight change in mobility of the 100 kDa band was observed in samples treated with trypsin, possibly representing a configuration change due to the trypsin cleavage.
Trimers of Gp50 are detected after trypsin cleavage and exposure to low pH, 60°C or urea
No difference was observed when trypsin treated, purified virus was incubated at pH 4.5 compared to pH 7.3 when analyzed by WB run in reducing conditions on SDS-PAGE (results not shown). On non-reducing SDS-PAGE however, a strong band of 150 kDa suggestive of a trimer, was observed in the pH 4.5 treated virus in addition to the 50 and 100 kDa proteins (Fig.
3b, lane 3). The 150 kDa band was not detected in trypsin untreated virus after incubating in pH
4.5 (Fig. 3b, lane 4). The anti-pepcoilEB5 had a slightly reduced affinity to the 150 kDa band as compared to anti-pepEB5 (results not shown).
Trimer formation was also observed in trypsin cleaved virus treated with 60°C or urea (Fig. 3b, lanes 6 and 8), indicating that the cleaved form of this protein is in a metastable configuration, and that treatment with either low pH, 60°C or urea induces a conformational change. Virus that had not been treated with trypsin was not susceptible to these conformational changes (Fig. 3b, lanes 5 and 7).
Chemical Cross-Linking using various concentrations of EGS incubated on ice or at RT did not result in any increased polymerization, and was not considered as successful. However, 2D- electrophoresis using non-reducing SDS-PAGE in the first dimension and reducing SDS-PAGE in the second verified that the non-reduced 50, 100 and 150 kDa proteins contain the reduced 50 and 30 kDa proteins (Fig. 6a). The 150 kDa protein consisted mainly of cleaved fragments, indicating that a proteolytic cleavage of Gp50 is a prerequisite for trimerization.
Page 18
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Trimerization of the Gp50 protein treated with trypsin began at pH 5.4 - 5.6 (Fig. 6b), indicating that fusion is initiated in multi-vesicular carrier bodies in the cell where the pH is about 5.5.
Exposing the PVDF membrane for an extended time to the Hyperfilm™ ECL™, revealed two additional bands at pH values between pH 4.0 and 7.3, of approximately 75 and 125 kDa (Fig.
6b). These bands probably represent intermediates of the monomer, dimmer, and trimer variants of this protein.
Trypsin treated ISAV is almost completely inactivated by exposure to low pH
Incubating ISAV with 0, 20 or 40 µg/mL trypsin followed by exposure to pH 7.3 or 5.0 prior to infecting cells had little effect on the virus titer recovered (Table 2). Lowering the pH to 4.0 however, reduced the titer by more that one log. Combining the pH 4.0 with a treatment of 40
µg/mL trypsin almost completely inactivated the virus, reducing the virus titer by about three additional log units (Table 2).
Page 19
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Discussion
Previous studies have localized the ISAV receptor-binding and -destroying activities (24, 45,
67), representing important foundations for ISAV pathogenicity studies. In this study we present the characterization of the ISAV 50 kDa glycoprotein (Gp50) (24) as the membrane fusion protein (F), adding essential information to further understand the mechanisms of ISAV pathogenicity. Cloned sequences showed identity to previously published ISAV genomic segment 5 sequences, and expression and WB analysis verified that this genome segment encodes Gp50 as previously reported (9).
Type I fusion proteins require a proteolytic cleavage to induce fusion competence (12), and the beneficial effect of trypsin on the replication of ISAV implies the classification of its fusion protein (26, 43). In the present study the requirement for proteolytic activation was linked to the fusion activity. Cell-cell fusion assays of infected cells demonstrated the requirement for trypsin and low pH to induce fusion, and cell-cell fusion was observed in cells co-transfected with the
HE and F. Previous studies have suggested the ISAV HE as an unlikely target of this proteolytic activation as indicated by the lack of disulfide binding of its cleaved products (24, 45).
Computational analysis of the protein sequence revealed a potential coiled-coil at residues G301-
N340 with an average probability of 87% and structural homologies to the coiled-coils of
Influenza A HA2 and Visna virus Env. Coiled-coils have been reported from a number of viral membrane fusion proteins, and the presence of coiled-coil motifs based on heptad repeats are amongst the general characteristics of type I fusion proteins (recently reviewed by 6, 22, 58, 64,
74). A structural homology to the Visna virus Env coiled-coil enabled the construction of a 3D- model of the putative ISAV F coiled-coil, and suggests common mechanisms for the viral fusion in these viruses. It also supports the hypothesis that Gp50 is the viral fusion protein, and that it
Page 20
Aspehaug et al: First Characterization of the ISAV Fusion Protein
can form trimers as suggested in this study. The putative ISAV F coiled-coil represents a possible target for antiviral peptides which potentially inhibit viral fusion by hindering the formation of the fusogenic structure, as described for retroviruses (20, 52).
Sequence alignments of the ISAV F protein sequence with several known viral FP sequences identified an ISAV pFP at residues C277-Y292. One of the most important characteristics of membrane fusion proteins is the presence of a FP, generally a stretch of hydrophobic residues capable of interacting with and destabilizing a lipid bilayer (63). These hydrophobic domains are the most highly conserved regions of type I fusion-mediating glycoproteins (70), and have been found to be homologous amongst several enveloped viruses (28). FPs are rich in glycine and alanine residues, and their sequences are usually conserved within but not between virus families
(63). The ISAV pFP share 43.8 % identity with the FPs of pneumoviruses, and conserved amino acids reflect the conservation amongst several pneumoviruses (11), providing a strong indication that this represents the ISAV FP. Additionally, residues F274-Y292 corresponding to the pFP gave high scores in transmembrane predictions, reflecting the hydrophobicity of this peptide.
Two additional regions, M1-C17 and V417-W439 also gave high scores in transmembrane predictions. The first corresponded to a signal sequence predicted by SignalP which has also been identified by N-terminal sequencing (9). The second was predicted as the primary transmembrane region of F.
The expected size of F as determined from the segment 5 protein sequence is 48.7 kDa, while a slightly larger size is observed in SDS-PAGE probably owing to the glycosylated nature of this protein (24). The ISAV Gp50 was shown to be synthesized as a precursor termed F0, cleavable by trypsin to the disulfide linked fragments termed F1 and F2 of 30 and 20 kDa respectively.
Eight cysteine residues were predicted to be available for disulfide linkages. Two peptide anti- Page 21
Aspehaug et al: First Characterization of the ISAV Fusion Protein
sera defined F1 and F2 as the N-terminal and C-terminal cleavage products of Gp50 respectively and two theoretical trypsin cleavage sites (after residue K276 or after residue R266) match with the size estimates of F1 and F2 in WB. However, type I fusion proteins generally have their FP localized to the N-terminal of F2, generated by the cleavage event (12), thus we consider the trypsin cleavage site located next to the pFP as the best candidate for being the proteolytic cleavage site (after residue K276). According to the protein sequence, this trypsin cleavage site should produce cleaved fragments F1 and F2 of 28.2 and 18.5 kDa respectively. Glycosylation sites are predicted on both fragments, thus the putative proteolytic cleavage site is in accordance with the results obtained in WB. Although a predicted cleavage site after residue R267 also matches the results obtained in WB, it would imply a longer FP than expected as well as altered hydrophobic properties of the FP. Additionally, no homology to other FPs was found for this region.
The pre-fusion polymerization status of the ISAV F0 was not established, although monomers and dimers were observed in WB. However, incubating trypsin treated purified virus with low pH induced a conformational change in the protein, revealing a band suggestive of a trimer in
WB, indicating a trimerization as part of the fusion process, or more likely, a stabilization of the trimer. This conformational change was coincident with induction of membrane-fusion activity, providing strong evidence that it represents the formation of the fusogenic structure. Both cell- cell fusion and the conformational change required pretreatment with trypsin, and was initiated at pH 5.4-5.6. Additionally, an SDS-PAGE run in two dimensions combining non-reducing and reducing conditions and blotted verified that the 100 and 150 kDa proteins suggestive of dimers and trimers can be reduced into 50 and 30 kDa proteins, corresponding to the F0 and F1 (F2 was not detected by the antibody used). The trimer consisted mainly of cleaved F, probably reflecting the requirement of proteolytic cleavage for trimerization. Additionally, the computationally predicted 3D-structure of the putative ISAV coiled-coil motif supports the formation of a F Page 22
Aspehaug et al: First Characterization of the ISAV Fusion Protein
trimer. The same conformational change could also be induced by high temperature and by urea, suggesting that the cleaved form of the protein is in a metastable state, in accordance with the characteristics of type I viral membrane F proteins (12). This also supports that the conformational change represents the formation of the fusogenic structure. Acidification of proteolytically activated virions prior to incubation on cell monolayers lead to a drastic reduction in virus titer, probably reflecting the non-reversible nature of the conformational change upon acidification, known to inactivate type I fusion proteins (12). Some inactivation was also observed from the acidification process alone, possibly representing a fraction of the virus population already cleaved by available proteases.
A multiple sequence alignment of the ISAV pFP with FPs from several paramyxoviruses, orthomyxoviruses, and retroviruses revealed one residue that was conserved amongst all (G279), and two that were conserved amongst several (F280 and G285), corresponding to residues G3, F4, and G9 in the ISAV pFP, respectively. Additionally, a glycine corresponding to residue G7
(representing G283 in the protein) in the pFP was conserved amongst the RSV and ISAV.
Interestingly, a study of the conserved residues of the paramyxovirus FPs revealed that mutations of G3 and G7 destabilize the native fusion protein, contributing to increased membrane fusion
(39). The invariant amino acids in the FPs were suggested to preserve a balance between high fusion activity and successful viral replication, as high fusion activity is deleterious to cell viability. Additionally, in some paramyxoviruses these mutations influence the regulatory activity of hemagglutinin-neuraminidase (HN) on the fusion activity (70). Studies on the conserved glycine residues of the FP in HIV-1 have revealed that G10, corresponding to G3 in the
ISAV pFP, seemingly the most highly conserved residue in PFs in general, is critical for both cell-cell and virus-cell fusion, while the less conserved glycine residues are less critical (17).
Page 23
Aspehaug et al: First Characterization of the ISAV Fusion Protein
The cleavability of the viral F proteins by intracellular proteases like furin present in the golgi network is a critical determinant of pathogenicity in orthomyxo- and paramyxoviruses (reviewed by 49, 50, 78). F proteins that have multiple basic residues at the cleavage site are cleavable by ubiquitous intracellular proteases, enabling a systemic spread of the virus, thereby increasing virulence. Viruses that have a single basic residue at the F protein cleavage site need an extracellular protease for proteolytic activation, and they only cause localized infections. In the present study, ISAV F protein sequences from two distantly related virulent strains causing major mortalities in Atlantic salmon were shown to contain single basic residues at their putative cleavage sites, indicating that the ISAV depend on an extracellular cleavage for fusion activation. This is supported by results in this study showing that purified virus run under reducing conditions in SDS-PAGE revealed mainly the uncleaved F protein. Also, the requirement for trypsin to induce syncytia in cells could be an indication that the F protein is not cleaved intracellularly prior to virus assembly/budding. However, ISAV does not depend on the addition of trypsin to replicate efficiently in cell cultures (16, 43), and it infects most organs in
Atlantic salmon (S. salar L.) (56, 66) causing major pathological and histopathological changes
(23, 81). Thus, in contrast to other orthomyxo- and paramyxoviruses, the efficient cleavage of the ISAV F protein is not restricted by the single basic residue at the cleavage site, indicating a disparate proteolytic cleavage mechanism. Additionally, the lack of variation in the protein sequence at the cleavage site of the distantly related ISAV isolates published suggests that the cleavage site structure is not as important in determining the pathogenicity of the ISAV as in other orthomyxoviruses and in paramyxoviruses (reviewed by 10, 78, 79).
The present study is the first description of an orthomyxovirus with its fusion activity localized on a separate protein. Influenza A and B viruses contain two glycoproteins, namely the HA which is responsible for virus-cell attachment and membrane fusion activity, and the neuraminidase (NA) holding the receptor-destroying activity. In influenza C, thogoto and dhori Page 24
Aspehaug et al: First Characterization of the ISAV Fusion Protein
viruses these activities are contained in a single surface glycoprotein (50). Paramyxoviruses have a HN and a separate F protein which is different from the orthomyxovirus fusion proteins because of its pH independence and because most members of this family require a second protein to induce fusion efficiently (49). Thus to our knowledge, the ISAV F protein represents the first pH dependent separate viral membrane F protein described. Whether the ISAV F protein requires the HE protein for fusion was not determined in the present study, although several studies confirm the importance of HN in influencing the fusion activity in paramyxoviruses (4,
37, 40, 49, 62). Also, as mentioned above, the FP residues G3 and G7, which have been found to influence the regulatory effect that the paramyxovirus HN has on the fusion activity, is conserved in the ISAV (70).
In conclusion, the ISAV segment 5 encodes a protein that shares several biochemical properties with viral type I membrane F-proteins. It is a glycoprotein (24) synthesized as a precursor termed
F0 that is proteolytically processed into two disulfide linked subunits F1 and F2. The F2 subunit contains a relatively hydrophobic N-terminal sequence that fulfills the criteria of a FP.
Furthermore, the conformational change in F was coincident with induction of membrane-fusion activity, strongly suggesting that it represents the formation of the fusogenic structure.
Page 25
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Acknowledgments
The authors thank Maike Joerink for her contribution during the cloning phase, Endy Spire at the
Molecular Imaging Center in Bergen for superb assistance on the confocal microscope, and
Audny Hellebø and Lindsey Moore for proofreading. This work was supported by grant no.
150091/120 and 134426/140 from the Norwegian Research Council, and by Intervet
International.
Page 26
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Table 1.
An overview and a multiple sequence alignment of the ISAV pFP (C277-Y292) with known
FPs of type I fusion proteins belonging to several viral families including paramyxoviruses
(HRSV, BRSV, SV5, Sendai, NDV, Measles, Mumps), retroviruses (HIV, SIV) and orthomyxoviruses (Influenza A and B). Fusion peptide length, sequences accession numbers and references where each FP has been described are indicated. This alignment was generated with ClustalX (80).
Virus Fusion peptide a Length (aa) Accession # References isolate
ISAV Norway ------CCGFTLGIGGAWFQAY------16 CAD99169 Current paper ISAV Canada ------CCGFTLGVGGAWFQAY------16 AF404343 (9) HRSV ------FLGFLLGVGSAIASGIAVS---- 19 P13843 (86) BRSV ------FLGFLLGIGSAIASGVAVS---- 19 AAB28458 (86) SV5 FAGVVIGLAALGVATAAQVTAAVAL------25 AF05275 (70) Sendai FFGAVIGTIALGVATSAQIT------20 P04856 (39) NDV FIGAIIGSVALGVATAAQITAASAL------25 M21881 (70) Measles FAGVVLAGAALGVATAAQITAGIAL------25 U03655 (70) Mumps FAGIAIGIAALGVATAAQVTAAVSL------25 AAS93903 (39) HIV-1 NL4-3 --AVGIGALFLGFLGAAGSTMGAAS------23 VCLJBR (17) HIV-2 Rod ---GVFVLGFLGFLATAGSAMGAAS------22 ENV_HV2RO (17) SIV tyo-1 ---VPFVLGFLGFLGAAGTAMGAAA------22 ENV_SIVAT (17) SIV K6W ---GVFVLGFLGFLATAGSAMGAAS------22 ENV_SIVMK (17) InfA HA ----GLFGAIAGFIENGWEGMIDGWYGF---- 24 HEMA_INAAI (17) InfB HA ----GFFGAIAGFLEGGWEGMIDGWHGY---- 24 HEMA_INBBO (17)
a Black shading: residues 100% conserved; dark gray shading: residues at least 50% conserved; light gray shading: residues at least 20% conserved.
Page 27
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Table 2.
ISAV titer after combined exposure to different concentrations of trypsin and various pHs prior to infecting cells. Trypsin and low pH had an additive effect on the inactivation of the ISAV.
Virus titer (TCID50/mL) after exposure to the pH indicated concentrations of trypsin and pHs: 0g/mL 20g/mL 40g/mL 5 5 5 pH 7.5 6.9 x 10 6.9 x 10 3.1 x 10 5 5 5 pH 5.0 6.9 x 10 3.1 x 10 6.9 x 10 4 4 1 pH 4.0 1.3 x 10 2.8 x 10 2.0 x 10
Page 28
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Figure legends
Fig. 1.
Pair-wise sequence alignment of the genomic segment 5 encoded proteins of the Norwegian
ISAV isolate Bremnes/98 (Norway) (accession # CAD99169) and the Canadian isolate ME/01
(Canada) (accession # AAN57720) (9). Predicted transmembrane α-helix regions are framed
(residues M1-C17 (putative signal peptide); residues I275-Y292 (internal transmembrane region); residues V417-W439 (putative C-terminal anchor)). Potentially O-glycosylated threonins T52 and
T62, and N-glycosylation sites are underlined with plain and dashed lines, respectively, and are shown in bold. The putative fusion peptide region C277-Y292 is shown in italics. The putative coiled-coil domain (residues G301-N340) is underlined. Potential trypsin cleavage sites are shown with grey shading, while the ones at positions R267 and K276, considered the most likely proteolytic cleavage sites, are shaded in black. Cysteine residues putatively supporting disulfide bridges are shown in bold. The regions corresponding to the synthetic peptides used in immunizations to make the anti-pepEB5 antibody are shown with dashed frames.
Fig. 2.
Alignment of amino acid residues from the Influenza A HA2 sequence (accession # AF194991) predicted to have structural and sequence homology to residues G283-Q341 of the ISAV
Bremnes/98 genomic segment 5 sequence, representing the putative coiled-coil predicted by learncoil-VMF. Conserved residues are shown in black shading.
Fig. 3.
WB analyses showing the specificity of antibodies towards the Gp50, and the effect of trypsin and a kinetically destabilizing stimulus. a) Trypsin treated and untreated purified ISAV run at
Page 29
Aspehaug et al: First Characterization of the ISAV Fusion Protein
reducing conditions in SDS-PAGE. Antibodies are indicated at the bottom and molecular sizes are indicated on the right. All antibodies were specific for the 50 kDa protein band corresponding to Gp50 in purified virus untreated with trypsin. In addition, two weaker bands of
30 and 100 kDa were detected by the anti-EB5bac and anti-pepEB5. After trypsin treatment of the virus the 30 kDa band is much stronger using anti-EB5bac and anti-pepEB5, while the anti- pepcoilEB5 detected a 20 kDa band in addition to Gp50. b) When run at non-reducing conditions in SDS-PAGE the antibodies detected only the 50 and 100 kDa proteins in both trypsin treated and untreated virus (lanes 1 and 2). Purified virus treated with trypsin and pH 4.5 revealed an additional band of 150 kDa suggestive of a trimer (lane 3). The trimer was also detected in trypsinated virus treated with 4.5M urea or incubated at 60°C (lanes 6 and 8), indicating that the trypsinated Gp50 is in a metastable state. The trimer was not detected in untrypsinated virus
(lanes 1, 4, 5 and 7). The antibodies used in (a) gave comparable results in this experiment, and only the results for anti-pepEB5 are presented.
Fig. 4.
Fusion of infected and transfected cells after syncytium fusion assay. The cells are visualized by immune staining using the anti-HE MAb (green), and nuclei are red. The nuclei are approximately 20µm wide. a) Trypsin treated ISAV infected cells incubated at pH 4.5 showing fused cells with at least 4 and 9 nuclei. b) Trypsin treated pVAX1/HE and pVAX1/EB5 transfected cells incubated at pH 4.5 showing fused cells with at least 8 nuclei. c) Trypsin treated
ISAV infected cells incubated at neutral pH showing no fused cells. d) Trypsin treated pVAX1/HE and pVAX1/EB5 transfected cells incubated at neutral pH showing no fused cells. e)
Trypsin treated ISAV infected cells incubated at pH 4.5 fused with Atlantic salmon erythrocytes.
Red fluorescent R18 is transferred from erythrocytes to cell membrane.
Page 30
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 5.
Immunofluorescent staining of ISAV infected and transfected cells showing the appearance and localization of the F protein. In a) and b) the NP is visualized in red, the F-protein in green and the nuclei are blue. In c) and d) the HE is visualized in red, the F-protein in green and the nuclei are blue. The nuclei are approximately 20µm wide. a) The first detection of the F protein using the anti-EB5bac was at 24 h p.i., and the staining was localized to the ER or Golgi of infected cells. b) At 36 and 48 h p.i. the F-protein localized to the membrane of vesicle like structures in the cytoplasm, and to the plasma membrane (the picture is taken at 36 h p.i.). c) Infected cells immune stained using the MAb anti-HE and the anti-EB5bac demonstrates that the ISAV glycoproteins is not co-localized in infected cells until they are both present in the plasma membrane (see also fig 4). d) The F-protein had the same localization pattern in transfected cells as in infected cells, and was not affected by the HE.
Fig. 6. a) Trypsin treated purified ISAV incubated at pH 4.0 was analyzed by a 2D-electrophoresis run at non-reducing SDS-PAGE in the first dimension and reducing SDS-PAGE in the second dimension. The WB was immune stained with the anti-pepEB5 antisera, confirming that the 50,
100 and 150 kDa protein bands could be reduced to 30 and 50 kDa proteins. b) WB analysis of trypsin treated purified ISAV incubated at various pHs as indicated at the bottom. The trimerization of Gp50 is initiated at pH5.6 seen as a rather weak 150 kDa protein band, increasing in intensity at lower pHs.
Page 31
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 1.
Norway : MAFLTILVLF LLKEVLCEPC TCDNPTCLGL TIPRTGYVRS APGGVLLTET ITESPALAEW TTSRSRLEDS TWQGGEVKSG: 80 Canada : ...... F...... I.E...... I ...QA.F...... R.Q.T...... PK..ET L.LD..T.N.: 80
Norway : KVSQTLFEAI QGTQMENCAV KAVFDTSFVN LTRHDVVLGR VKVSPFGGEH DISKCGRKGL KVFICGGTTG YVTRGCPPEE: 160 Canada : ...... L..T... ..KQ.I...K I...E...DS ...... V...... : 160
Norway : CRGRKGRMMS LEPTADCGVE KGFTTERIKT GKVDLDSCCT QHGCTKGIRV EVPSPVLVSA KCNEISFRVV PFHSVPDRLG: 240 Canada : .K.K.....A ....T...... L..D.... .ML.IT...... S ..Q.VT...... K..: 240
Norway : FARTSSFTLR ANLANQHGWS KYSFNLRAFP GEEFIKCCGF TLGIGGAWFQ AYLNGEVQGD GAASAEDVKE KLNGIIDQIN: 320 Canada : ...... K ..FV.K...... N....G...... V...... M...... D...... : 320
Norway : KVNLLLEGEI EAVRRIAYMN QASSLQNQVE IGLIGEYLNI SSWLETKTLT KTEEGLMKDG WCRSSNHCWC PPGTVGIPTI: 400 Canada : ..DT...... T...... N. ..Q.NT...... KPTIV...: 400
Norway : GYVDNIKEVT GTSWWMVMIH YIIVGLIVVV LVVLGLKLWG CIRR: 444 Canada : ....S...... I. V..F...... L..: 444
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 2.
290 300 310 320 330 340 ISAV Seg5 : GIGGAWFQAYLNGEVQGDGAASAEDVKEKLNGIIDQINKVNLLLEGEIEAV------RRIAYMNQ InfA HA2 : GMVDGWYG-YHHSNEQGSGAADKESTQKAIDGITNKVNSIIDKMNTQFEAVGKEFNNLERRIENLNK Coiled coil domains
Page 33
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 3.
Page 34
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 4.
Page 35
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 5.
Page 36
Aspehaug et al: First Characterization of the ISAV Fusion Protein
Fig. 6.
Page 37
Aspehaug et al: First Characterization of the ISAV Fusion Protein
References
1. Altschul, S. F., W. Gish, W. Miller, E. W. Myers, and D. J. Lipman. 1990. Basic local
alignment search tool. J Mol Biol 215:403-10.
2. Altschul, S. F., T. L. Madden, A. A. Schaffer, J. Zhang, Z. Zhang, W. Miller, and D.
J. Lipman. 1997. Gapped BLAST and PSI-BLAST: a new generation of protein
database search programs. Nucleic Acids Res 25:3389-402.
3. Aspehaug, V., K. Falk, B. Krossoy, J. Thevarajan, L. Sanders, L. Moore, C.
Endresen, and E. Biering. 2004. Infectious salmon anemia virus (ISAV) genomic
segment 3 encodes the viral nucleoprotein (NP), an RNA-binding protein with two
monopartite nuclear localization signals (NLS). Virus Res 106:51-60.
4. Bagai, S., and R. A. Lamb. 1995. Quantitative measurement of paramyxovirus fusion:
differences in requirements of glycoproteins between simian virus 5 and human
parainfluenza virus 3 or Newcastle disease virus. J Virol 69:6712-9.
5. Bendtsen, J. D., H. Nielsen, G. von Heijne, and S. Brunak. 2004. Improved prediction
of signal peptides: SignalP 3.0. J Mol Biol 340:783-95.
6. Bentz, J., and A. Mittal. 2003. Architecture of the influenza hemagglutinin membrane
fusion site. Biochim Biophys Acta 1614:24-35.
7. Biering, E., K. Falk, E. Hoel, J. Thevarajan, M. Joerink, A. Nylund, C. Endresen,
and B. Krossøy. 2002. Segment 8 encodes a structural protein of infectious salmon
anaemia virus (ISAV); the co-linear transcript from Segment 7 probably encodes a non-
structural or minor structural protein. Dis Aquat Organ 49:117-22.
8. Bullough, P. A., F. M. Hughson, J. J. Skehel, and D. C. Wiley. 1994. Structure of
influenza haemagglutinin at the pH of membrane fusion. Nature 371:37-43.
9. Clouthier, S. C., T. Rector, N. E. Brown, and E. D. Anderson. 2002. Genomic
organization of infectious salmon anaemia virus. J Gen Virol 83:421-8.
Page 38
Aspehaug et al: First Characterization of the ISAV Fusion Protein
10. Collins, M. S., J. B. Bashiruddin, and D. J. Alexander. 1993. Deduced amino acid
sequences at the fusion protein cleavage site of Newcastle disease viruses showing
variation in antigenicity and pathogenicity. Arch Virol 128:363-70.
11. Collins, P. L., R. M. Chanock, and B. R. Murphy. 2001. Respiratory Syncytial Virus,
p. 1443-1485. In D. M. Knipe, P. M. Howley, and B. N. Fields (ed.), Fields Virology, 4th
ed. Lippincott Williams & Wilkins, Philadelphia.
12. Colman, P. M., and M. C. Lawrence. 2003. The structural biology of type I viral
membrane fusion. Nat Rev Mol Cell Biol 4:309-19.
13. Copeland, C. S., R. W. Doms, E. M. Bolzau, R. G. Webster, and A. Helenius. 1986.
Assembly of influenza hemagglutinin trimers and its role in intracellular transport. J Cell
Biol 103:1179-91.
14. Dannevig, B. H., B. E. Brudeseth, T. Gjoen, M. Rode, H. I. Wergeland, O. Evensen,
and C. M. Press. 1997. Characterisation of a long-term cell line (SHK-1) developed
from the head kidney of Atlantic salmon (Salmo salar L). 7:213-226.
15. Dannevig, B. H., K. Falk, and E. Namork. 1995. Isolation of the causal virus of
infectious salmon anemia (ISA) in a long-term cell-line from Atlantic salmon head
kidney. J Gen Virol 76:1353-1359.
16. Dannevig, B. H., K. Falk, and C. M. Press. 1995. Propagation of infectious salmon
anemia (ISA) virus in cell culture. Vet Res 26:438-442.
17. Delahunty, M. D., I. Rhee, E. O. Freed, and J. S. Bonifacino. 1996. Mutational
analysis of the fusion peptide of the human immunodeficiency virus type 1: identification
of critical glycine residues. Virology 218:94-102.
18. Devold, M., B. Krossoy, V. Aspehaug, and A. Nylund. 2000. Use of RT-PCR for
diagnosis of infectious salmon anaemia virus (ISAV) in carrier sea trout (Salmo trutta)
after experimental infection. Dis Aquat Organ 40:9-18.
Page 39
Aspehaug et al: First Characterization of the ISAV Fusion Protein
19. Dutch, R. E., T. S. Jardetzky, and R. A. Lamb. 2000. Virus membrane fusion proteins:
biological machines that undergo a metamorphosis. Biosci Rep 20:597-612.
20. Eckert, D. M., and P. S. Kim. 2001. Mechanisms of viral membrane fusion and its
inhibition. Annu Rev Biochem 70:777-810.
21. Eliassen, T. M., M. K. Froystad, B. H. Dannevig, M. Jankowska, A. Brech, K. Falk,
K. Romoren, and T. Gjoen. 2000. Initial events in infectious salmon anemia virus
infection: evidence for the requirement of a low-pH step. J Virol 74:218-227.
22. Epand, R. M. 2003. Fusion peptides and the mechanism of viral fusion. Biochim
Biophys Acta 1614:116-21.
23. Evensen, O., K. E. Thorud, and Y. A. Olsen. 1991. A morphological study of the gross
and light microscopic lesions of infectious anaemia in Atlantic salmon (Salmo salar). Res
Vet Sci 51:215-22.
24. Falk, K., V. Aspehaug, R. Vlasak, and C. Endresen. 2004. Identification and partial
characterisation of viral structural proteins of infectious salmon anaemia (ISA) virus. J
Virol 78:3063-71.
25. Falk, K., E. Namork, and B. H. Dannevig. 1998. Characterization and applications of a
monoclonal antibody against infectious salmon anaemia virus. Dis Aquat Org 34:77-85.
26. Falk, K., E. Namork, E. Rimstad, S. Mjaaland, and B. H. Dannevig. 1997.
Characterization of infectious salmon anemia virus, an orthomyxo-like virus isolated
from Atlantic salmon (Salmo salar L.). J Virol Dec:9016-9023.
27. Fiser, A., R. K. Do, and A. Sali. 2000. Modeling of loops in protein structures. Protein
Sci 9:1753-73.
28. Gallaher, W. R. 1987. Detection of a fusion peptide sequence in the transmembrane
protein of human immunodeficiency virus. Cell 50:327-8.
29. García-Rosado, E., S. Mjaaland, and E. Rimstad. (Submitted). Infectious salmon
anemia virus (ISAV) genomic segment 7 protein antagonizes type I interferon response. Page 40
Aspehaug et al: First Characterization of the ISAV Fusion Protein
30. Garry, C. E., and R. F. Garry. 2004. Proteomics computational analyses suggest that
the carboxyl terminal glycoproteins of Bunyaviruses are class II viral fusion proteins
(beta-penetrenes). Theor Biol Med Model 1:10.
31. Gasteiger, E., A. Gattiker, C. Hoogland, I. Ivanyi, R. D. Appel, and A. Bairoch.
2003. ExPASy: The proteomics server for in-depth protein knowledge and analysis.
Nucleic Acids Res 31:3784-8.
32. Glickman, R. L., R. J. Syddall, R. M. Iorio, J. P. Sheehan, and M. A. Bratt. 1988.
Quantitative basic residue requirements in the cleavage-activation site of the fusion
glycoprotein as a determinant of virulence for Newcastle disease virus. J Virol 62:354-6.
33. Hansen, J. E., O. Lund, N. Tolstrup, A. A. Gooley, K. L. Williams, and S. Brunak.
1998. NetOglyc: prediction of mucin type O-glycosylation sites based on sequence
context and surface accessibility. Glycoconj J 15:115-30.
34. Heinz, F. X., and S. L. Allison. 2003. Flavivirus structure and membrane fusion. Adv
Virus Res 59:63-97.
35. Heinz, F. X., K. Stiasny, and S. L. Allison. 2004. The entry machinery of flaviviruses.
Arch Virol Suppl:133-7.
36. Hellebø, A., U. Vilas, K. Falk, and R. Vlasak. 2004. Infectious salmon anemia virus
specifically binds to and hydrolyzes 4-O-acetylated sialic acids. J Virol 78:3055-62.
37. Heminway, B. R., Y. Yu, and M. S. Galinski. 1994. Paramyxovirus mediated cell
fusion requires co-expression of both the fusion and hemagglutinin-neuraminidase
glycoproteins. Virus Res 31:1-16.
38. Hofmann, K., and W. Stoffel. 1993. TMbase - A database of membrane spanning
proteins segments, vol. 374.
39. Horvath, C. M., and R. A. Lamb. 1992. Studies on the fusion peptide of a
paramyxovirus fusion glycoprotein: roles of conserved residues in cell fusion. J Virol
66:2443-55. Page 41
Aspehaug et al: First Characterization of the ISAV Fusion Protein
40. Hu, X. L., R. Ray, and R. W. Compans. 1992. Functional interactions between the
fusion protein and hemagglutinin-neuraminidase of human parainfluenza viruses. J Virol
66:1528-1534.
41. Juretic, D., B. Lee, N. Trinajstic, and R. W. Williams. 1993. Conformational
preference functions for predicting helices in membrane proteins. Biopolymers 33:255-
73.
42. Kibenge, F. S., O. N. Garate, G. Johnson, R. Arriagada, M. J. Kibenge, and D.
Wadowska. 2001. Isolation and identification of infectious salmon anaemia virus
(ISAV) from Coho salmon in Chile. Dis Aquat Organ 45:9-18.
43. Kibenge, F. S., J. R. Lyaku, D. Rainnie, and K. L. Hammell. 2000. Growth of
infectious salmon anaemia virus in CHSE-214 cells and evidence for phenotypic
differences between virus strains. J Gen Virol 81:143-150.
44. Kristiansen, M., M. K. Froystad, A. L. Rishovd, and T. Gjoen. 2002. Characterization
of the receptor-destroying enzyme activity from infectious salmon anaemia virus. J Gen
Virol 83:2693-7.
45. Krossøy, B., M. Devold, L. Sanders, P. M. Knappskog, V. Aspehaug, K. Falk, A.
Nylund, S. Koumans, C. Endresen, and E. Biering. 2001. Cloning and identification of
the infectious salmon anaemia virus haemagglutinin. J Gen Virol 82:1757-65.
46. Krossøy, B., I. Hordvik, F. Nilsen, A. Nylund, and C. Endresen. 1999. The putative
polymerase sequence of infectious salmon anemia virus suggests a new genus within the
Orthomyxoviridae. J Virol 73:2136-42.
47. Krossøy, B., F. Nilsen, K. Falk, C. Endresen, and A. Nylund. 2001. Phylogenetic
analysis of infectious salmon anaemia virus isolates from Norway, Canada and Scotland.
Dis Aquat Organ 44:1-6.
48. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of
bacteriophage T4. Nature 227:680-5. Page 42
Aspehaug et al: First Characterization of the ISAV Fusion Protein
49. Lamb, R. A., and D. Kolakofsky. 2001. Paramyxoviridae: The Viruses and Their
Replication, p. 1305-1340. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A.,
R. B., and S. E. Straus (ed.), Fields virology. Lippincott-Raven, Philadelphia, Pa.
50. Lamb, R. A., and R. M. Krug. 2001. Orthomyxoviridae: The Viruses and Their
Replication, p. 1487-1579. In D. M. Knipe, P. M. Howley, G. D. E., M. M. A., L. R. A.,
R. B., and S. E. Straus (ed.), Fields virology. Lippincott-Raven, Philadelphia, Pa.
51. Lannan, C. N., J. R. Winton, and J. L. Fryer. 1984. Fish cell lines: establishment and
characterization of nine cell lines from salmonids. In Vitro 20:671-6.
52. Louis, J. M., I. Nesheiwat, L. Chang, G. M. Clore, and C. A. Bewley. 2003. Covalent
trimers of the internal N-terminal trimeric coiled-coil of gp41 and antibodies directed
against them are potent inhibitors of HIV envelope-mediated cell fusion. J Biol Chem
278:20278-85.
53. Lovely, J. E., B. H. Dannevig, K. Falk, L. Hutchin, A. M. MacKinnon, K. J. Melville,
E. Rimstad, and S. G. Griffiths. 1999. First identification of infectious salmon anaemia
virus in North America with haemorrhagic kidney syndrome. Dis Aquat Organ 35:145-8.
54. Lupas, A., M. Van Dyke, and J. Stock. 1991. Predicting coiled coils from protein
sequences. Science 252:1162-4.
55. Marti-Renom, M. A., A. C. Stuart, A. Fiser, R. Sanchez, F. Melo, and A. Sali. 2000.
Comparative protein structure modeling of genes and genomes. Annu Rev Biophys
Biomol Struct 29:291-325.
56. Mikalsen, A. B., A. Teig, A. L. Helleman, S. Mjaaland, and E. Rimstad. 2001.
Detection of infectious salmon anaemia virus (ISAV) by RT-PCR after cohabitant
exposure in Atlantic salmon (Salmo salar). Dis Aquat Organ 47:175-81.
57. Mjaaland, S., E. Rimstad, K. Falk, and B. H. Dannevig. 1997. Genomic
characterization of the virus causing infectious salmon anemia in Atlantic salmon (Salmo
salar L.): an orthomyxo-like virus in a teleost. J Virol 71:7681-7686. Page 43
Aspehaug et al: First Characterization of the ISAV Fusion Protein
58. Morrison, T. G. 2003. Structure and function of a paramyxovirus fusion protein.
Biochim Biophys Acta 1614:73-84.
59. Mullins, J. E., D. Groman, and D. Wadowska. 1998. Infectious salmon anaemia in salt
water Atlantic salmon (Salmo salar L.) in New Brunswick, Canada. Bull Eur Assic Fish
Pathol 18:110-114.
60. Nicholas, K. B., N. H. B. Jr., and D. W. Deerfield. 1997. GeneDoc: Analysis and
Visualization of Genetic Variation. EMBNEW.NEWS 4.
61. Pagni, M., V. Ioannidis, L. Cerutti, M. Zahn-Zabal, C. V. Jongeneel, and L. Falquet.
2004. MyHits: a new interactive resource for protein annotation and domain
identification. Nucleic Acids Res 32:W332-5.
62. Paterson, R. G., M. A. Shaughnessy, and R. A. Lamb. 1989. Analysis of the
relationship between cleavability of a paramyxovirus fusion protein and length of the
connecting peptide. J Virol 63:1293-301.
63. Pecheur, E. I., J. Sainte-Marie, A. Bienven e, and D. Hoekstra. 1999. Peptides and
membrane fusion: towards an understanding of the molecular mechanism of protein-
induced fusion. J Membr Biol 167:1-17.
64. Peisajovich, S. G., and Y. Shai. 2003. Viral fusion proteins: multiple regions contribute
to membrane fusion. Biochim Biophys Acta 1614:122-9.
65. Perdue, M. L., and D. L. Suarez. 2000. Structural features of the avian influenza virus
hemagglutinin that influence virulence. Vet Microbiol 74:77-86.
66. Rimstad, E., K. Falk, A. B. Mikalsen, and A. Teig. 1999. Time course tissue
distribution of infectious salmon anaemia virus in experimentally infected Atlantic
salmon (Salmo salar). Dis Aquat Organ 36:107-112.
67. Rimstad, E., S. Mjaaland, M. Snow, A. B. Mikalsen, and C. O. Cunningham. 2001.
Characterization of the infectious salmon anemia virus genomic segment that encodes the
putative hemagglutinin. J Virol 75:5352-6. Page 44
Aspehaug et al: First Characterization of the ISAV Fusion Protein
68. Ritchie, R. J., J. Heppell, M. B. Cook, S. Jones, and S. G. Griffiths. 2001.
Identification and characterization of segments 3 and 4 of the ISAV genome. Virus
Genes 22:289-97.
69. Rodger, H. D., T. Turnbull, F. Muir, S. Millar, and R. H. Richards. 1998. Infectious
salmon anaemia (ISA) in the United Kingdom. Bulletin of the European Association of
Fish Pathology 18:115-116.
70. Russell, C. J., T. S. Jardetzky, and R. A. Lamb. 2004. Conserved glycine residues in
the fusion peptide of the paramyxovirus fusion protein regulate activation of the native
state. J Virol 78:13727-42.
71. Sali, A., and T. L. Blundell. 1993. Comparative protein modelling by satisfaction of
spatial restraints. J Mol Biol 234:779-815.
72. Schyth, B. D., N. J. Olesen, P. Østergård, and K. Falk. 2003. Presented at the Diseases
of Fish and Shellfish, 11 th International Conference of the EAFP, Malta.
73. Shi, J., T. L. Blundell, and K. Mizuguchi. 2001. FUGUE: sequence-structure homology
recognition using environment-specific substitution tables and structure-dependent gap
penalties. J Mol Biol 310:243-57.
74. Singh, M., B. Berger, and P. S. Kim. 1999. LearnCoil-VMF: computational evidence
for coiled-coil-like motifs in many viral membrane-fusion proteins. J Mol Biol 290:1031-
41.
75. Snow, M., and C. O. Cunningham. 2001. Characterisation of the putative nucleoprotein
gene of infectious salmon anaemia virus (ISAV). Virus Res 74:111-118.
76. Snow, M., R. Ritchie, O. Arnaud, S. Villoing, V. Aspehaug, and C. O. Cunningham.
2003. Isolation and characterisation of segment 1 of the infectious salmon anaemia virus
genome. Virus Res 92:99-105.
77. Stegmann, T. 2000. Membrane fusion mechanisms: the influenza hemagglutinin
paradigm and its implications for intracellular fusion. Traffic 1:598-604. Page 45
Aspehaug et al: First Characterization of the ISAV Fusion Protein
78. Steinhauer, D. A. 1999. Role of hemagglutinin cleavage for the pathogenicity of
influenza virus. Virology 258:1-20.
79. Tashiro, M., N. L. McQueen, and J. T. Seto. 1999. Determinants of organ tropism of
sendai virus. Front Biosci 4:D642-5.
80. Thompson, J. D., T. J. Gibson, F. Plewniak, F. Jeanmougin, and D. G. Higgins.
1997. The CLUSTAL_X windows interface: flexible strategies for multiple sequence
alignment aided by quality analysis tools. Nucleic Acids Res 25:4876-82.
81. Thorud, K., and H. O. Djupvik. 1988. Infectious salmon anaemia in Atlantic salmon
(Salmo salar L.). Bull Eur Assoc Fish Pathol 8:109-111.
82. Toyoda, T., T. Sakaguchi, K. Imai, N. M. Inocencio, B. Gotoh, M. Hamaguchi, and
Y. Nagai. 1987. Structural comparison of the cleavage-activation site of the fusion
glycoprotein between virulent and avirulent strains of Newcastle disease virus. Virology
158:242-7.
83. Vareckova, E., V. Mucha, S. A. Wharton, and F. Kostolansky. 2003. Inhibition of
fusion activity of influenza A haemagglutinin mediated by HA2-specific monoclonal
antibodies. Arch Virol 148:469-86.
84. von Heijne, G. 1992. Membrane protein structure prediction. Hydrophobicity analysis
and the positive-inside rule. J Mol Biol 225:487-94.
85. Vullo, A., and P. Frasconi. 2004. Disulfide connectivity prediction using recursive
neural networks and evolutionary information. Bioinformatics 20:653-9.
86. Zimmer, G., L. Budz, and G. Herrler. 2001. Proteolytic activation of respiratory
syncytial virus fusion protein. Cleavage at two furin consensus sequences. J Biol Chem
276:31642-50.
Page 46