Aviva Systems Biology GAPDH antibody - N-terminal region (ARP40175_P050) Product Number ARP40175_P050 Product Page http://www.avivasysbio.com/gapdh-antibody-n-terminal-region-arp40175-p050.html Product Name GAPDH antibody - N-terminal region (ARP40175_P050) Size 100 ul Gene Symbol GAPDH Alias Symbols G3PD, GAPD, MGC88685 Protein Size (# AA) 335 amino acids Molecular Weight 36kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 2597 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Glyceraldehyde-3-phosphate dehydrogenase Name Description This is a rabbit polyclonal antibody against GAPDH. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW Target Reference Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977 Description of GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the Target reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. Protein Interactions FUS; HUWE1; UBC; SUMO2; SUMO3; STAU1; MDM2; GAPDH; ASB15; ASB16; RPA3; RPA2; RPA1; EED; SNCA; rev; HSPA9; HSPA1L; GAS7; TUBA1A; TUFM; RAP1GDS1; PPP5C; PPIB; YWHAG; TUBB; TUBA1C; PRPF40A; UBQLN1; DCPS; MAT2B; ACOT7; METAP2; FERMT2; GBP1; EEF1A1; TYMP; DFFA Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Lead Time Domestic: within 1-2 days delivery International: 1-2 days *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-GAPDH (ARP40175_P050) antibody is Catalog # AAP40175 (Previous Catalog # AAPP22021) Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GAPDH Complete Anti-GAPDH (ARP40175_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GAPDH. Swissprot Id Q2TSD0 Protein Name Glyceraldehyde-3-phosphate dehydrogenase RuleBase RU003389 Publications Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). WB, IP, ICC/IF, Sheep, Human, Guinea pig, Dog, Horse, Rabbit, Rat, Goat, Mouse, Bovine 23931754 Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). WB, Sheep, Human, Guinea pig, Dog, Horse, Rabbit, Rat, Goat, Mouse, Bovine 24793116 Sample Type GAPDH is strongly supported by BioGPS gene expression data to be expressed in HeLa Confirmation Protein Accession NP_002037 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GAPDH. Nucleotide NM_002046 Accession # Replacement Item This antibody may replace item sc-113612, HPA040067 Conjugation ARP40175_P050-FITC Conjugated Options ARP40175_P050-HRP Conjugated ARP40175_P050-Biotin Conjugated CB Replacement sc-113612; sc-113887; sc-137179; sc-166545; sc-166574; sc-20356; sc-20357; sc-20358; sc-25778; sc-31915; sc-32233; sc-365062; sc-47724; sc-48166; sc-48167; sc-51907; sc-59540; sc-66163; sc-69778; sc-81545; HPA040067 Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep Application WB, IHC Predicted Cow: 93%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Homology Based Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100% on Immunogen Sequence
Image 1: Human brain WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human brain
Image 2: Mouse NIH-3T3 Lanes: 1. 50 ug NIH3T3 cytosolic extract 2. 50 ug NIH3T3 cytosolic extract 3. 50 ug NIH3T3 cytosolic extract 4. 50 ug NIH3T3 cytosolic extract Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-Rabbit HRP Secondary Antibody Dilution: 1:30000 Gene Name: GAPDH Submitted by: Dr. Arimdam Basu, Dept. of Animal Biology, University of Pennsylvania 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2 Image 3: Human HeLa Host: Rabbit Target Name: GAPDH Sample Type: Hela Whole Cell lysates Antibody Dilution: 1.0ug/ml GAPDH is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
Image 4: 293T Host: Rabbit Target Name: GAPDH Sample Type: 293T Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1ug/ml Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane/lane Gel Concentration: 0.12 Image 5: Human Raji WB Suggested Anti-GAPDH antibody Titration: 1 ug/mL Sample Type: Human Raji
Image 6: Human liver tissue Rabbit Anti-GAPDH Antibody Catalog Number: ARP40175_P050 Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 3