Trauma, Creativity, and Unconscious Confessions: the Lost Childhood History Behind L
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
The Wonderful Wizards Behind the Oz Wizard
Syracuse University SURFACE The Courier Libraries 1997 The Wonderful Wizards Behind the Oz Wizard Susan Wolstenholme Follow this and additional works at: https://surface.syr.edu/libassoc Part of the Arts and Humanities Commons Recommended Citation Wolstenholme, Susan. "The Wonderful Wizards behind the Oz Wizard," The Courier 1997: 89-104. This Article is brought to you for free and open access by the Libraries at SURFACE. It has been accepted for inclusion in The Courier by an authorized administrator of SURFACE. For more information, please contact [email protected]. SYRACUSE UNIVERSITY LIBRARY ASSOCIATES COURIER VOLUME XXXII· 1997 SYRACUSE UNIVERSITY LIBRARY ASSOCIATES COURIER VOLUME XXXII 1997 Ivan Mestrovic in Syracuse, 1947-1955 By David Tatham, Professor ofFine Arts 5 Syracuse University In 1947 Chancellor William P. Tolley brought the great Croatian sculptor to Syracuse University as artist-in-residence and professor ofsculpture. Tatham discusses the his torical antecedents and the significance, for Mdtrovic and the University, ofthat eight-and-a-half-year association. Declaration ofIndependence: Mary Colum as Autobiographer By Sanford Sternlicht, Professor ofEnglish 25 Syracuse University Sternlicht describes the struggles ofMary Colum, as a woman and a writer, to achieve equality in the male-dominated literary worlds ofIreland and America. A CharlesJackson Diptych ByJohn W Crowley, Professor ofEnglish 35 Syracuse University In writings about homosexuality and alcoholism, CharlesJackson, author ofThe Lost TtVeekend, seems to have drawn on an experience he had as a freshman at Syracuse University. Mter discussingJackson's troubled life, Crowley introduces Marty Mann, founder ofthe National Council on Alcoholism. Among her papers Crowley found a CharlesJackson teleplay, about an alcoholic woman, that is here published for the first time. -
Your Guide to the Classic Literature Collection
Your Guide to the Classic Literature Collection. Electronic texts for use with Kurzweil 1000 and Kurzweil 3000. Revised March 27, 2017. Your Guide to the Classic Literature Collection – March 22, 2017. © Kurzweil Education, a Cambium Learning Company. All rights reserved. Kurzweil 1000 and Kurzweil 3000 are trademarks of Kurzweil Education, a Cambium Learning Technologies Company. All other trademarks used herein are the properties of their respective owners and are used for identification purposes only. Part Number: 125516. UPC: 634171255169. 11 12 13 14 15 BNG 14 13 12 11 10. Printed in the United States of America. 1 Introduction Introduction Kurzweil Education is pleased to release the Classic Literature Collection. The Classic Literature Collection is a portable library of approximately 1,800 electronic texts, selected from public domain material available from Web sites such as www.gutenberg.net. You can easily access the contents from any of Kurzweil Education products: Kurzweil 1000™, Kurzweil 3000™ for the Apple® Macintosh® and Kurzweil 3000 for Microsoft® Windows®. The collection is also available from the Universal Library for Web License users on K3000+firefly. Some examples of the contents are: • Literary classics by Jane Austen, Geoffrey Chaucer, Joseph Conrad, Charles Dickens, Fyodor Dostoyevsky, Hermann Hesse, Henry James, William Shakespeare, George Bernard Shaw, Leo Tolstoy and Oscar Wilde. • Children’s classics by L. Frank Baum, Brothers Grimm, Rudyard Kipling, Jack London, and Mark Twain. • Classic texts from Aristotle and Plato. • Scientific works such as Einstein’s “Relativity: The Special and General Theory.” • Reference materials, including world factbooks, famous speeches, history resources, and United States law. -
Children's Books & Illustrated Books
CHILDREN’S BOOKS & ILLUSTRATED BOOKS ALEPH-BET BOOKS, INC. 85 OLD MILL RIVER RD. POUND RIDGE, NY 10576 (914) 764 - 7410 CATALOGUE 89 ALEPH - BET BOOKS - TERMS OF SALE Helen and Marc Younger 85 Old Mill River Rd. Pound Ridge, NY 10576 phone 914-764-7410 fax 914-764-1356 www.alephbet.com Email - [email protected] POSTAGE: UNITED STATES. 1st book $8.00, $2.00 for each additional book. OVERSEAS shipped by air at cost. PAYMENTS: Due with order. Libraries and those known to us will be billed. PHONE orders 9am to 10pm e.s.t. Phone Machine orders are secure. CREDIT CARDS: VISA, Mastercard, American Express. Please provide billing address. RETURNS - Returnable for any reason within 1 week of receipt for refund less shipping costs provided prior notice is received and items are shipped fastest method insured VISITS welcome by appointment. We are 1 hour north of New York City near New Canaan, CT. Our full stock of 8000 collectible and rare books is on view and available. Not all of our stock is on our web site COVER ILLUSTRATION - #557 - Tasha Tudor Original Art from Wind in the Willows #190 - Gordon Craig Association Copy with Letter #383 - John R. Neill Art from Tik-Tok of Oz #423 - Original Art from The Little Engine That Could #54 - Man Ray ABC - Signed Limited Edition Pg 3 Helen & Marc Younger [email protected] MET LIFE HEALTH ABC COMPLETE WITH INSERT 1. ABC. (ADVERTISING) IN STYLE OF JANET LAURA SCOTT / ABC. NY: Metropolitan Life Ins. CLOTH ABC Co. ca 1920. 8vo, (5 1/4 x 7 3/4”) pictorial wraps, light soil, VG. -
Table of Contents
Table of Contents ACKNOWLEDGEMENTS vii PREFACE xiii SYNOPSIS xvii GLOSSARY xix A WORD ABOUT SYNTAX IN THIS VOLUME xxiii ABBREVIATIONS xxv BIBLIOGRAPHIA BAUMIANA 1 BOOKS OF NON-FICTION AND FANTASY 3 The Book of the Hamburgs 3 Mother Goose in Prose 5 By the Candelabra’s Glare 13 Father Goose: His Book 19 The Songs of Father Goose 27 The Army Alphabet 31 The Navy Alphabet 33 A New Wonderland 35 The Art of Decorating Dry Goods Windows and Interiors 38 American Fairy Tales 45 Dot and Tot of Merryland 48 The Master Key 54 The Life and Adventures of Santa Claus 59 The Enchanted Island of Yew 67 The Magical Monarch of Mo 73 The Woggle-Bug Book 82 Queen Zixi of Ix 85 John Dough and the Cherub 90 Father Goose’s Year Book 96 Baum’s American Fairy Tales 98 L. Frank Baum’s Juvenile Speaker 101 The Daring Twins 103 The Sea Fairies 107 Phoebe Daring 113 Sky Island 116 Baum’s Own Book for Children 121 The Snuggle Tales and The Oz-Man Tales 124 Little Bun Rabbit 125 Once Upon a Time 128 The Yellow Hen 131 The Magic Cloak 134 Jack Pumpkinhead 137 The Gingerbread Man 139 x BIBLIOGRAPHIA PSEUDONYMIANA 141 PSEUDONYMOUS BOOKS OF FICTION AND FANTASY 143 SCHUYLER STAUNTON 147 The Fate of a Crown 147 Daughters of Destiny 154 LAURA BANCROFT 158 The Twinkle Tales Series 158 Mr. Woodchuck 158 Bandit Jim Crow 162 Prairie-Dog Town 165 Prince Mud-Turtle 169 Sugar-Loaf Mountain 173 Twinkle’s Enchantment 176 The Twinkle Tales – Continued 179 Policeman Bluejay 179 Babes in Birdland 181 Twinkle and Chubbins 185 SUZANNE METCALF 188 Annabel 188 EDITH VAN DYNE 193 The Aunt Jane’s Nieces Series 193 Binding and Dust Jacket Formats 193 Aunt Jane’s Nieces 200 Aunt Jane’s Nieces Abroad 209 Aunt Jane’s Nieces at Millville 217 Aunt Jane’s Nieces at Work 224 Aunt Jane’s Nieces in Society 230 Aunt Jane’s Nieces and Uncle John 236 Aunt Jane’s Nieces on Vacation 241 Aunt Jane’s Nieces on the Ranch 246 Aunt Jane’s Nieces Out West 250 Aunt Jane’s Nieces in the Red Cross 254 The Flying Girl Series 258 The Flying Girl 258 The Flying Girl and Her Chum 262 The Bluebird Books, a.k.a. -
Cartoon Illustration William Wallace Denslow
Cartoon Illustration William Wallace Denslow Education Summary Students will learn the steps of illustration, including sketching a character, involving movement into their drawing, and adding color. They will learn about William Wallace Denslow who was an American illustrator and caricaturist who was most remembered for his work in collabora- tion with author L. Frank Baum, especially his illustrations for The Wonderful Wizard of OZ. Activity Summary Students will receive one piece of paper and a pencil. They will then choose a number from a hat. Beginning with 1 they will create plot twist in the story of The Wonderful Wizard of Oz (ex: There is an earthquake rather than a tornado; Dorothy meats a robot rather than a tin man). They will then illustrate the scene. After tracing their sure lines with pen, they will add color to their illustrations. aced over their sure lines with pen. Objective After completing the lesson, students will have the ability to: • Define illustration. • Illustrate a character from their imagination using the steps they learned. Materials • Pens • Pencils • Large Drawing Paper (or any paper) • Color pencils • Construction paper Step by Step 1) begin sketching you scene. Your scene can be from a favorite movie, tv show, book, or one that you create with your imagination. 2) While sketching try to incorporate some movement (for example draw someone walking or a card driving by) 3) Once you are happy with your sketch begin coloring it in with your color pencils. 4) Try to incorporate shading and watch how the amount of pressure you apply on your pencil can really change the look of the drawing 5) Once you are happy with you work enjoy your masterpiece! . -
To the Baum Bugle Supplement for Volumes 46-49 (2002-2005)
Index to the Baum Bugle Supplement for Volumes 46-49 (2002-2005) Adams, Ryan Author "Return to The Marvelous Land of Oz Producer In Search of Dorothy (review): One Hundred Years Later": "Answering Bell" (Music Video): 2005:49:1:32-33 2004:48:3:26-36 2002:46:1:3 Apocrypha Baum, Dr. Henry "Harry" Clay (brother Adventures in Oz (2006) (see Oz apocrypha): 2003:47:1:8-21 of LFB) Collection of Shanower's five graphic Apollo Victoria Theater Photograph: 2002:46:1:6 Oz novels.: 2005:49:2:5 Production of Wicked (September Baum, Lyman Frank Albanian Editions of Oz Books (see 2006): 2005:49:3:4 Astrological chart: 2002:46:2:15 Foreign Editions of Oz Books) "Are You a Good Ruler or a Bad Author Albright, Jane Ruler?": 2004:48:1:24-28 Aunt Jane's Nieces (IWOC Edition "Three Faces of Oz: Interviews" Arlen, Harold 2003) (review): 2003:47:3:27-30 (Robert Sabuda, "Prince of Pop- National Public Radio centennial Carodej Ze Zeme Oz (The ups"): 2002:46:1:18-24 program. Wonderful Wizard of Oz - Czech) Tribute to Fred M. Meyer: "Come Rain or Come Shine" (review): 2005:49:2:32-33 2004:48:3:16 Musical Celebration of Harold Carodejna Zeme Oz (The All Things Oz: 2002:46:2:4 Arlen: 2005:49:1:5 Marvelous Land of Oz - Czech) All Things Oz: The Wonder, Wit, and Arne Nixon Center for Study of (review): 2005:49:2:32-33 Wisdom of The Wizard of Oz Children's Literature (Fresno, CA): Charobnak Iz Oza (The Wizard of (review): 2004:48:1:29-30 2002:46:3:3 Oz - Serbian) (review): Allen, Zachary Ashanti 2005:49:2:33 Convention Report: Chesterton Actress The Complete Life and -
The Man Behind the Curtain: L
Article: The Wizard of Oz Dr. Jay Seller The Man Behind the Curtain: L. Frank Baum and The Wizard of Oz by Linda McGovern L. Frank Baum in 1881 Chances are you have seen the 1939 MGM movie, The Wizard of Oz, at one point or another in your lifetime. But the chances maybe even greater that you do not associate it with L. Frank Baum, the author of the book on which the film was based. In fact, most people have probably never heard of him at all unless they have read his work or were born around the time when he was popular. Whether it is shown on television annually or rented at the local video store, The Wizard of Oz has become a staple of American popular culture. Young or old, we know where the famous, unforgettable lines originate; we know the characters by heart: Dorothy, Toto, the Tin Man, the Scarecrow and the Cowardly Lion, as well as the munchkins. Oz is as familiar as our own backyards. Although the movie and the book differ in minor ways, the premise is similar and so are most of the characters. The only significant difference that might matter to a child and possibly to an adult, is that in the movie, Dorothy’s journey to Oz is only a dream, purely imaginary, in other words, not real. In the book, however, there is no such rationale. Instead it invites the child to use his or her imagination as a creative, transforming force and to accept the journey, and Oz as a real place full of hope over the rainbow, where the child could escape ordinary life. -
A Research Guide for L. Frank Baum
The Wizard Behind Oz and Other Stories: A Research Guide for L. Frank Baum By: Karla Lyles October 2006 2 Introduction: In 1900 Lyman Frank Baum published The Wonderful Wizard of Oz, a phenomenal literary success that inspired posthumous writings to continue the Oz series into more than 40 books (including the originals). Although Baum published several additional series of books (most pseudonymously written) and other individual writings, he is best known for The Wonderful Wizard of Oz. A considerable number of books, articles, dissertations, and electronic resources containing information about the Oz masterpiece are available, supplying a wealth of information for the curious Baum fan or avid Baum researcher. To locate information about Baum and his writings I consulted several search engines, including ABELL, British Library Catalogue, Copac, DLB, MLAIB, Wilson, and WorldCat, as well as referred to footnotes in printed materials I obtained. I have provided references to the databases I located each of the materials in within the brackets at the end of the citation entries, allowing the reader to consult those databases if he/she so chooses to pursue further research. For those individuals who may be unfamiliar with the acronyms of some of the databases, ABELL is the Annual Bibliography of English Language and Literature, DLB is the Dictionary of Literary Biography, and MLAIB is the MLA International Bibliography. I also relied substantially on the services of Interlibrary Loan to secure materials that are not available in Evans Library at Texas A & M University, and I recommend the use of Interlibrary Loan in conducting research to allow for the acquisition of materials that would otherwise remain unobtainable. -
Inside the Unconscious Mind 1
Running head: INSIDE THE UNCONSCIOUS MIND 1 Inside the Unconscious Mind of an Author Marissa Tafolla Professor Cindy Chavez Writing 10 May 3, 2013 INSIDE THE UNCONSCIOUS MIND 2 Abstract According to Psychology in Modules by David G. Meyers, “the unconscious process consists of all mental processes that one is not aware of”, in other words all the things that are not actively being paid attention to for example filtered sensory information, automatic behavior, non- activated declarative memories and motivations. Freud Sigmund referred to it as unacceptable thoughts, wishes, feelings, and memories. Therefore, writing can be an existential, unconscious confession of our selves. The Wonderful Wizard of Oz, by L. Frank Baum, proved that by incorporating his childhood feelings in the story. As L. Frank Baum was a child he was mistreated by both of his highly strict parents. They pulled him away from his creativity and instead pushed him to become a successful entrepreneur, which was not what Baum desired. The Wonderful Wizard of Oz was written by L. Frank Baum with the unconscious goal to rediscover his childhood history. He was never able to enjoy his childhood the way a child should, he was manipulated by his parents and was violently mistreated. He grew up with moral discipline enforced by his parents. He believed that no parent should ever be disrespected by their children. The Wonderful Wizard of Oz is written to indirectly explain what he may have suffered as a child. The unconscious process works in a way in which you are not aware of what you are doing or why you are doing it, when Baum got older and was “free” he was able to do whatever his creative mind desired. -
From Projections of the Past to Fantasies of the Future: Kansas and the Great Plains in Recent Film
From Projections of the Past to Fantasies of the Future: Kansas and the Great Plains in Recent Film HGLWHGDQGLQWURGXFHGE\7KRPDV3UDVFK n Steven Spielberg’s /LQFROQ WKHPRVWZLGHO\DFFODLPHGVHHQDQGDZDUGZLQQLQJKLVWRULFDOÀOPRIWKHODVW IHZ\HDUVLWLVD.DQVDQZKRVSHDNVWKHÀUVWZRUGV3ULYDWH+DUROG*UHHQRIWKH6HFRQG.DQVDV&RORUHG,QIDQWU\ 6WULNLQJO\IHZUHYLHZHUVRIWKHÀOPKDYHFRPPHQWHGRQWKHIDFWWKDWLQWKHÀOP·VRSHQLQJPRPHQWV*UHHQWHOOV the president about a retributive war crime. In Tony Kushner’s screenplay, the soldier explains: “Some of us was in Ithe Second Kansas Colored. We fought the rebs at Jenkins’ Ferry last April, just after they’d killed every Negro soldier they captured at Poison Springs. So at Jenkins’ Ferry, we decided we warn’t taking no reb prisoners. And we didn’t leave a one of ‘em alive.” His summary of the Second Colored’s role at Jenkins’ Ferry corresponds closely to historical accounts (see, for example, Mark K. Christ, ´$OO&XWWR3LHFHVDQG*RQHWR+HOOµ7KH&LYLO:DU5DFH5HODWLRQVDQGWKH%DWWOH RI3RLVRQ6SULQJ [Little Rock, Ark: August House, 2003], ² 6LQFHPRVWRIWKH6HFRQG&RORUHG·VÀJKWLQJRFFXUUHG in Arkansas, however, it is unclear how Private Green found his way to parade grounds adjacent to Washington Navy Yard, where /LQFROQ arranges his meeting with the president. Abraham Lincoln seems more appreciative than appalled by Green’s report, and the scene moves on to another African American soldier, Ira Clark from Massachusetts, who complains to Lincoln about black soldiers’ lower wages DQGWKHODFNRIEODFNRIÀFHUV*UHHQVHHPVXQFRPIRUWDEOHZLWK&ODUN·VFRPSODLQLQJWRWKHSUHVLGHQWKLPVHOIEXWLWLV -
Fine Books in All Fields the Winky King Collection of Oz & L. Frank
Sale 426 Thursday, April 15, 2010 1:00 PM Fine Books in All Fields The Winky King Collection of Oz & L. Frank Baum Illustrated & Children’s Books – Fine Press Books Auction Preview Tuesday, April 13 - 9:00 AM to 5:00 PM Wednesday, April 14 - 9:00 AM to 5:00 PM Thursday, April 15 - 9:00 AM to 11:00 AM Or by appointment 133 Kearny Street 4th Floor:San Francisco, CA 94108 phone: 415.989.2665 toll free: 1.866.999.7224 fax: 415.989.1664 [email protected]:www.pbagalleries.com REAL-TIME BIDDINGAVAILABLE PBA Galleries features Real-Time Bidding for its live auctions. This feature allows Internet Users to bid on items instantaneously, as though they were in the room with the auctioneer. If it is an auction day, you may view the Real-Time Bidder at http://www.pbagalleries.com/realtimebidder/ . Instructions for its use can be found by following the link at the top of the Real-Time Bidder page. Please note: you will need to be logged in and have a credit card registered with PBA Galleries to access the Real-Time Bidder area. In addition, we continue to provide provisions for Absentee Bidding by email, fax, regular mail, and telephone prior to the auction, as well as live phone bidding during the auction. Please contact PBA Galleries for more information. IMAGES AT WWW.PBAGALLERIES.COM All the items in this catalogue are pictured in the online version of the catalogue at www.pbagalleries. com. Go to Live Auctions, click Browse Catalogues, then click on the link to the Sale. -
The Wizard Behind the Plate: L. Frank Baum, the Hub City Nine, and Baseball on the Prairie
Copyright © 2000 by the South Dakota State Historical Society. All Rights Reserved. The Wizard behind the Plate: L. Frank Baum, the Hub City Nine, and Baseball on the Prairie Michael Patrick Hearn On the morning of 14 May 1889, a group of ambitious young businessmen met at the Hagerty and Paulliamus real estate office to look into the possibility of establishing a local professional baseball team in Aberdeen, Brown County, Dakota Territory, Times were good, and these local heavy hitters were seeking another means of boosting their community. "Nothing creates enthusiasm like base ball/' admitted the Aberdeen Daily News the next day, "and nothing will draw a crowd so continuously as the national game closely contested and honorably played. The enthusiasts from all over the country come in to see the sport, every man of whom contributes his mite towards the car- rying on of nearly all kinds of business. It makes lively times, it advertises the town, it brings people to the city and in many ways stimulates and fosters business."' Minneapolis, Saint Paul, Des Moines, Milwaukee, Omaha, and Sioux City already had In addition lo many lonR hours spent itt the Alexander Mitcht-ll I.ihr;ir>-, Alierüeen, S.Dak.. the New York Public Libran, and (he Library of Congress, 1 am grateful to the late Matilda Jewell Gage; Riitiert A. Bauin, Jr.; Michael Ges.sel; Nanty Ty.stad Koupal and Laura Ries, South Dakota State Historical SfKieCy. Pierre; Sue Gates and Micheie Porter, Dacotah Prairie Maseuin. Aherdeen; and Saily Roe.sch Wajîner, Matilda Joslyn Gage Foundation, Fayetleville, N.Y., for providing most ofthe material for this article.