sign in sign up
<<
Home , 2005 ICC Super Series, 2017 ICC Awards, 2020 t20 Blast, Adam Zampa, Aiden Blizzard, Alan Kippax

2017/18 NSW ANNUAL REPORT WE’RE IN SAFE HANDS! At Transport for NSW, we’re 100% commited to improving road safety, and in with Cricket NSW, we’re making a real difference. Our ‘PLAN B’ drink driving message engages the cricket community and encourages everybody to make better transport choices. We’d like to say thanks for another great season and we look forward to continuing our partnership. Contents

2 Members of the Association 56 Sixers General Manager’s Report 3 Staff 57 General 4 From the Chairman Manager’s Report 6 From the Chief Executive 58 KFC BBL|07 Statistics 8 Strategy for NSW/ACT Cricket 59 Rebel WBBL|03 Statistics 9 elected to Cricket 61 Futures League NSW board 62 U/19 Male National 10 Cricket NSW 16th Annual Awards Championships Night 63 U/18 Female National 11 Hall of Fame Championships 12 Tribute to 64 U/17 Male National 13 Life Membership – Championships 65 U/15 Female National 14 Australian Representatives – Championships MEDALLIST Men’s 66 National Indigenous 16 Australian Representatives – Championships Women’s 67 McDonald’s NSW Premier 17 NSW Blues Report Cricket – Men’s 18 JLT Sheffi eld Shield 71 McDonald’s NSW Premier 23 JLT Sheffi eld Shield statistics Cricket – Women’s 24 NSW First Class Records 73 McDonald’s Sydney Shires 30 JLT One-Day Cup 75 Cricket Performance 33 JLT One-Day Cup Statistics 76 Cricket NSW Pathway 34 NSW One-Day Records 77 Coach Education and Development 36 Farewells 78 The Basil Sellers Scholarship 39 Lendlease Breakers Coach’s Program Report 79 NSW Districts Cricket MEDALLIST DANIEL HUGHES 40 Women’s National Cricket Association League 2017/18 Cricket NSW Annual 81 Sydney Cricket Association 43 Women’s National Cricket Report and Yearbook League Final 83 Game Development Editor: Malcolm Conn 85 Plan B Regional Bash 44 Farewells Sub-Editor: David Gavin 45 WNCL Season Statistics 86 Commercial Consultant: Tom Iceton 46 NSW WNCL Records 87 Match Operations and Contributors: Tom Frederico, Experience Team Cricket NSW Staff 49 Sydney Sixers – KFC BBL|07 89 Communications Statistics: Adam Morehouse, 50 Sydney Sixers – Rebel WBBL|03 Dr Colin Clowes, Bob Brenner 90 Business Advisory Services 51 Sydney Thunder – KFC BBL|07 Design and Printing: Proactive Graphics 92 Government and Infrastructure Photography: Getty Images, Delly Carr/Sports 52 Sydney Thunder – Shoot, Ian Bird, Steve Christo, Jay McAllister, 93 NSW Country Cricket Rebel WBBL|03 Greg Porteous, Cricket NSW, Matt Dunbar Association 53 Sydney Thunder – Rebel and Jason Corroto WBBL|03 Semi-fi nal 98 NSW Schools Cricket Association Front cover: Lendlease Breakers Alex Blackwell is chaired off by Ellyse Perry 54 Sydney Sixers – 100 NSW Cricket Umpires’ and after her last match for NSW, and Scorers’ Association Rebel WBBL|03 Semi-fi nal victory in the WNCL fi nal. 55 Sydney Sixers – 103 Association Notes Back Cover: The Lendlease Breakers claimed Rebel WBBL|03 Final 108 Financials a 19th WNCL title in 22 years and the Sydney Sixers won successive WBBL titles. Cricket NSW Annual Report and Yearbook 2017/18 Members M Hughes NSW CricketUmpires’ andScorers’Association Incorporated R Myatt,TPsarakis,GRowlands T Clayton,DCox,GCreighton,PDilley, IHogg,PMarjoribanks, NSW CountryCricketAssociation Incorporated M Rosen,Swan,vanVugt, JWarn, PWright. Hon. KGreene,TIcetonOAM,MLangford,GMonaghan,RTimbs, S Foster, BFreedmanOAM,PGoldsmith, NGovers,DGraham, D Bowcock,JBiviano,Bryant,AConnolly, RCook,IFinlay, Sydney CricketAssociationIncorporated Delegates Lyall Gorman(Appointed) Alex Blackwell(elected4.6.18),MarshallRosen,RichardTimbs, John Knox(Appointed),DannyBhandari(resigned22.1.18), Retire 2019 (Appointed) John Warn, Hon KevinGreene,IanHogg,HonPatriciaForsythe Retire 2018 NSW CricketBoardDirectors Mr AlanDavidsonAMMBE,TheHonourableJohnHowardOMAC Governor ofNewSouthWales, His ExcellencyGeneralTheHon.DavidHurleyACDSC(Ret’d) Joint Patrons Patrons BOTTOM (L-R)IANHOGG,ALEXBLACKWELL,RICHARDTIMBSANDMARSHALLROSEN THE 2017/18CRICKETNSWBOARD.TOP(L-R)JOHNKNOX(CHAIRMAN),HONPATRICIA FORSYTHE,LYALL GORMAN,HONKEVINGREENE,JOHNWARN

of

the

Association WM Weir AM(2003);MRWhitney (2002);RWrightOAM(2001) KD Walters MBE(1979);MEWaugh AM(2003); SRWaugh AO (2003); MA Taylor AO(2002);GThomas (2011);RFTozer (1996);ATurner (1997); Smith (2010);LCSthalekar(2017);HB Taber (1979);JMATait (1999); MJ SilverOAM(2009);RBSimpson AO (1970);MSlater(2016);SB WJ SaundersOAM(1977);BASellers AM(2009);CSheehan(2015); (2008); PIPhilpottOAM(2004);SJRixon (1996);MHRosen(2014); HA MitchellOAM(2003);JTO’Dwyer OAM(2006);MBPawley GD McGrathAM(2008);JTMcMahon OAM(2005);PMeyers K Marshall(2010):GRJMatthews(2002);RBMcCoskerOAM(1990); (1998); LALarsen(2003);GFLawsonOAM(2002);NGMarks(2000); WJ Jocelyn(2003);SMKatich(2015);LMKeightley(2007);NSLaming Hughes (2015);THJIcetonOAM(2005);VJackson(2003); RN HarveyMBE(1963);RAHore(2005);REHorsellOAM(2002);BP (1988); DRGilbert(2014);HJGriffi th(2003);GKHarinathOAM(2010): RA FrenchOAM(1996);BJGainsford(2003);LRGardner (2003); JDyson(2002);PA Emery(2002);BFFreedmanOAM(2000); AB CromptonOAM(1983);AKDavidsonAMMBE(1963);MDavies OAM (1995);CClowes(2007);DHCole(2011);MCornish(2003); DJ BroadOAM(1992);RFBurgess(1975);BJClarkAM(2007);FJ BC BoothMBE(1971);RBrenner(2007);CPBrierleyOAM(2003); G Atwell(2003);JBenaud(2004);MJBennett(2005);MGBevan Life Members C French ACT CricketAssociationIncorporated R Hore(disbandedJune2017) NSW Women’s CricketCommittee G Kightley(disbandedJune2017) NSW Schools’CricketAssociationIncorporated E Myatt NSW DistrictsCricketAssociationIncorporated . Cricket NSW Staff Chief Executive Offi cer Andrew Jones Senior Manager, Cricket Pathway James Henry Community Engagement Manager Julie Stafford Coaching and Talent Manager Metro Multicultural Participation Specialist Business Advisory Services Gavan Twining Herman Lotey Chief Financial Offi cer and Company Secretary Female Talent Manager Stephen Jenkin Female Participation Specialist Michael Dalton Coaching and Talent Manager – Country General Manager, People and Culture Mark Cameron Competitions Support Offi cer Luke Miner Marina Markovic Coaching and Talent Specialist – / Participation and Insights Analyst People and Culture Advisor Caitlin Murphy Western Greg McLay Samuel Kettler Organisational Development Manager Coaching and Talent Specialist – Newcastle/ Conference Administrator Sharyn Beck Vanessa Wende Central Coast Brett Rankin Conference Administrator Cynthia Davies Finance Manager Hari Shan Coaching and Talent Specialist – ACT, Southern Conference Administrator Janet Grieve Payroll Accountant Alister Galletly and Illawarra Steve Davies Junior Formats Support Neil McDonald Accounts Offi cer Emma Newman Coaching and Talent Specialist – Northern NSW Facilities & Administration Manager Troy McKiernan Development Managers Melissa Scott Coaching and Talent Specialist – Outer West Sydney Harbour Samad Shaikh Team Assistant Casey Cottrell-Dormer Sydney Northern Beaches Fiona Penny Security Manager, Security and Operations, Coaching and Talent Specialist – Inner West Sydney North Shore Cassie Langford Metro Dean Burke Technology (CA) Andrew Brown Sydney South Gerard Price Coaching and Talent Specialist – North East Security Analyst, Technology (CA) Akrit Chand Sydney Inner West Matthew Mifsud Alex Kemp State Infrastructure Manager Dee Brock Sydney Central GWS Samantha Devlin Coaching and Talent Specialist – South East Infrastructure and Project Specialist Sydney North West Nicholas Toscan Teale Blessington Assistant and Pathway Coach Beau Casson Sydney Outer West Jake Balnave Public Policy and Government Relations Sydney South West Stephen Brown Manager Justin De Domenico Assistant and Pathway Coach Anthony Clark Executive Offi cer (NSWCUSA), State Illawarra Paul Brockley Public Policy and Government Relations Lachlan Stueart Manager (CA) Sam Watson Manager Darren Goodger Umpires Administration Manager Troy Penman Bankstown Daniel Solway Match Operations and Experience Umpires Administration Offi cer Nic Bills Central Coast Michael Peacock Hunter Gary Fisher Head of Match Operations, Experience and Umpire Educator/Female Umpire Engagement Infrastructure Kirin Lindop Claire Polosak Northern Inland Kathy Barber Cricket Operations Offi cer Clare Crewdson High Performance Coordinator (Senior Teams) Mid North Coast Martin Garoni Far North Coast Jared Seiffert Events and Operations Offi cer Satyen Ashar Andrew Gilchrist Murrumbidgee Luke Olsen Events Offi cer Rohanna Burrow Competitions and Country Programs Manager Bruce Whitehouse Murray Robbie Mackinlay Events Offi cer Jenny Symons NSW Premier Cricket Manager Roy Formica Central West Matthew Tabbernor Events Offi cer Emma MacMillan Coach Administrator (CA) Chris Steffan Far West Matthew Ellis NSW State Events Manager (CA) Lauren Boyle ACT North and Districts Michael Minns Events Coordinator (CA) Hayley Blight Commercial ACT South and South Coast Kris Britt Cricket Performance General Manager Travis Glen Partnerships Manager Andrew Kelly Sydney Sixers General Manager David Moore Partnerships Coordinator Stephanie Clarke General Manager Jodie Hawkins NSW Blues Head Coach “What’s Your Plan B?” SCG Indoor Centre Marketing & Communications Manager Fast Coach Manager Jim Robson Owen Henwood Lendlease Breakers Head Coach Membership, Ticketing and Hospitality Communications Manager Sean Watterson Lendlease Breakers Assistant Coach Senior Manager, External Communications Fan, Activation & Community Manager Dominic Thornely Malcolm Conn Liz McPherson SSSM Manager & Physical Performance Coach Digital & Media Coordinator Tom Frederico Digital & Social Media Manager Gerard Laws Tom Reddin Communications Assistant David Gavin Membership, Ticketing and Hospitality Senior Physical Performance Coach Coordinator Blake Moffat Ross Herridge Game Development Physical Performance Coach Sean Hardy General Manager Ivan Spyrdz Sydney Thunder Senior Physiotherapist Danny Redrup Development Leader – Sixers Metro Region General Manager Lee Germon Senior Physiotherapist Nicola Mepstead Ben Levett Media and Marketing Communications Physiotherapist Kieran Thoms Development Leader – Thunder Metro Region Manager Chris Botherway Physiotherapist Elyse Potter Craig McLean Membership, Ticketing and Hospitality Player Development Manager Justine Whipper Development Leader – Northern NSW Manager Daniel Stenglin Player Development Manager – Female David Szumowski Fan and Community Engagement Anika Lalic Development Leader – ACT/Southern NSW Specialist Jonathan Lees State Medical Offi cer Dr John Orchard Partnerships Manager Vicky Tyas Performance Dietician Erin Michael Participation Manager Corrina Baldock Partnerships and Membership Coordinator Sports Psychologist Gerard Faure Brac Manager, Association and Club Development Patrick Hogan State Talent Manager David Freedman Brett Holliday Thunder WBBL Media Manager Sarah Browne Cricket NSW Annual Report and Yearbook 2017/18 be satisfi edwithajobverywelldone. demanding jobandabusyfamilylife. Hecan thousands ofhourshistimeontop ofa Our directorsarevolunteersandJohn gave NSW Cricketstakeholders. by integrity, hardworkandrespectforall Chairman. Hisleadershipwascharacterised John wasquitesimplyanoutstanding service toNSWandAustralianCricket. predecessor, JohnWarn, forhistremendous I wouldparticularlyliketothankmy importantly, tremendousgrowthinourgame. of greatchallengeandchangebut,more building cricketinthisstate.Itisatime expertise committedbysomanytocontinue refl ectedontheconsiderabletime,effortand elected ChairmanandinthatperiodIhave It islittlemorethanamonthsinceIwas NSW asthepowerhouseofAustraliancricket. have donesuchawonderfuljobmaintaining it isappropriatethatIthankallaroundmewho In myfi rstreportasChairmanofCricketNSW, CRICKET NSWCHAIRMANJOHNKNOX From

the

Chairman Thishasdelivered$20millioninadditional • Overthepastfi veyears,therehasalso • In2017/18,forthefi rsttimeover400,000 • Atthepathwaylevel,wehavedoubled • TheWBBLwaslaunchedandimmediately • Thewomen’s gameprogressedsignificantly • NSWregularlyprovidedoverhalfof • Ourprofessionalteamswoneveryavailable • success inallareasofouroperations: Cricket NSWthroughfi veyearsofexceptional directors, members,playersandstafftodrive John andAndrewworkedinpartnershipwithall captain andAndrewJonesasCEO. Blues coach,MikeHusseyasSydneyThunder day one,bringinginTrevor BaylissasNSW very signifi cantrenewalandgrowthfrom a timeofturmoilinNSWcricket.Hepushed John tookoverasChairmaninFebruary2013, in cricketfacilitiesacrosstheState. we havealsodeliveredanextra$72 million Cricket. Inpartnershipwithgovernment, performance pathway, including Premier facilities, communitycricketandthe high investment inNSWcricket,mostofit a doublingincrowdsandviewership. the SydneySixersandThunder, and been a15-foldincreaseinsponsorshipfor cricket. particularly inschoolprogramsandgirls’ growth hasoccurredacrosstheState, people playedthegameinNSW. This their fourseasons. won 85%ofthecompetitionsplayedin instead ofone.Thesetwoteamshave NSW MetroandACT/NSWCountry, by enteringtwoteamsinallcompetitions, opportunities foremergingNSWplayers and onebytheThunder. by CricketNSWteams,twotheSixers And thethreetitlestodatehavebeenwon thousands ofyounggirlstoplaythegame. league. Itisnowencouragingtensof became ’s top-ratingwomen’s sport. moment forcricketandAustralian Breakers in2016.Thiswasalandmark of women’s cricketviatheLendleaseNSW and weproudlyledtheprofessionalisation the world. the top-rankedmaleandfemaleplayersin attack in2017/18andcurrentlyeightof the entiremen’s Ashes-winningbowling Australia’s internationalteams,including trophies. NootherStateachievedthis. four WNCLtitlesandWBBL/WT20 Bash League,twodomesticone-daycups, title includingaSheffi eldShield,theBig return. We areallhuman. times andwelcomesthembackwhen they supports SteveandDavidthroughthese tough it isimportantthattheNSWcricketfamily and showntrueremorsefortheirmistakes, However, havingbeendealtharsh penalties represent allofusontheworldstage. but playsitintherightspirit.Ourplayers team notonlyplaysgood,competitivecricket passionate fansexpectthattheirnational by CricketAustralia.Australia’s millionsof Cricket NSWsupportsthestrongstancetaken Cricket AustraliaBoardfor12months. Warner, subsequentlysuspendedbythe captain SteveSmithandvice-captainDavid NSW withtwoofourfi nestplayers,national This wasparticularlyupsettingforCricket by theballtamperingincidentinSouthAfrica. Australia andacrosstheworldwasshocked During theseason,cricketthroughout and warmlywelcomehertotheBoard. and IalsocongratulateAlexonherelevation choosing suchahighlycredentialledcandidate Our membersaretobecongratulatedfor domestic titlesand5World Cups. captain andthewinnerofnofewerthan17 female player, astoriedNSWandAustralian Alex ofcourseisAustralia’s mostcapped NSW brandin2003. NSWCA andNSWWCAundertheCricket was aseparateentityuntilintegrationofthe that theNSWWomen’s CricketAssociation to beelecteddirectlybyourmembers,noting Hon PatriciaForsythe,Alexisthefi rstfemale Director RinaHoreandcurrentThe on ourBoardasAppointedDirectors,former While CricketNSWhashadtwowomenserve organisation. NSW Boardinthe159-yearhistoryof became thefi rstwomanelectedtotheCricket NSW andAustraliangreatAlexBlackwell It isfi ttingthatonthesamenightJohnretired, Signifi cantgovernancereformshave • signifi cantcontributionatBoardlevel. and otherfriendsofcrickettomakea placed toattracthighly-skilledpastplayers qualifi ed;henceCricketNSWisnowwell anyone forelectiontheybelievetobe delegates. Nowmemberscannominate a poolof34club,zoneandassociation Elected Directorscouldonlybedrawnfrom choose theirrepresentatives.Previously, compromising ourmembers’rightsto quality anddiversityofourBoardwithout allowed CricketNSWtoincreasethe Despite the headlines generated by the This will involve the construction of major In total, the newly created Match Operations incident, and the challenging facilities at Sydney Olympic Park and in the and Events Team (MOET) staged 112 matches, MOU negotiation between eastern suburbs, hopefully at Moore Park. including trial and tour fi xtures, across 18 and the Australian Cricketers’ Association With the upgrading of our Blacktown facility, different grounds, while supporting Cricket that preceded it, the game continues to grow including more turf nets and increased access Australia with all International content in New in popularity. to the main stadium, a greater footprint for South Wales. Our game has never been played by more cricket will be created right across Sydney. I would like to thank all our major venues, people – men and women, girls and boys This will also enhance the development of councils and each Premier Cricket and Shires of all ages – and has never been watched NSW male and female players at youth and Club that assisted in a hosting capacity this by more fans either at the ground or on elite level. This will ensure strong NSW Blues season: television. and Breakers teams that continue our central • Albury City Council Indeed, a matter of weeks after the South role of producing the bulk of Australia’s – and • Blacktown Venue Management and African tour, Cricket Australia signed a record many of the globe’s – best cricketers. Blacktown City Council $1.2 billion television rights deal which will Our State has produced the most successful • Campbelltown City Council lead to more cricket, both men’s and women’s, domestic men’s and women’s teams in the • City of Canterbury Bankstown and being shown live on TV. history of the game worldwide and we intend Bankstown Cricket Club This also allows cricket to invest in all parts of to continue that trend. • Coffs Harbour City Council the game, especially grass roots. However, investment in NSW cricket goes This will particularly benefi t cricket in NSW. well beyond Sydney. • The ACT Government and Cricket ACT () We have made the case that CA has under- Having grown up in Hill Top in southern NSW invested in NSW relative to smaller States and now living in Sydney, I understand the • Georges River Council for many years. At last, we are receiving a signifi cance of cricket throughout the State. • Inner West Council favourable hearing. As we continue to make clear by our actions • North Sydney Council We have already received enough additional as well as words, we are Cricket NSW, not • Penrith City Council funds from CA to employ an extra 12 Cricket Sydney. • Royal Agricultural Society Community Cricket Managers throughout Working in partnership with State and Local (Spotless Stadium) NSW, increasing by a third the number directly Governments, millions of dollars of investment serving schools, associations and clubs. is in the pipeline for regional centres of • Sydney Church of Grammar There will be many more next year, when the excellence. Starting with major new indoor School (Shore) media rights revenue begins to fl ow in earnest. facilities at Orange and Albury-Wodonga, • Sydney Cricket and Sports Ground Trust We are conscious that junior and senior club we aim to have a network of these facilities • Sydney Cricket Club and City of participation is growing in many areas but State-wide within three to fi ve years. Bay Council challenged in others, including some regional We are also in the fi nal stages of health checks • Sydney University areas, and we are also rolling out a strategy of Premier and Country Cricket. With nearly • The Scots College to provide direct administrative support to three million people living in regional NSW and associations across NSW. fi ve million in Sydney we are acutely aware of • City Council Cricket NSW also continues to navigate – the need to invest in growth across NSW. • Wollongong City Council and drive – the fundamental shift in cricket at Premier Cricket continues to be vital of In closing, I would again like to thank John State level resulting from the overwhelming itself and as a critical step in the pathway Warn for the outstanding work he did as success of the Big Bash and Women’s Big to professional cricket. Players who perform Chairman during the past fi ve years. Bash Leagues. strongly and consistently at Premier I would also like to thank CEO Andrew Jones, One area particularly impacted is facilities. Cricket level continue to be rewarded, with the Cricket NSW executive and our staff and We now have six professional teams instead Parramatta’s drought-breaking premiership players who do such an impressive job driving of one or two and we need places to train and captain Nick Bertus the latest to earn a and supporting cricket right across the state. NSW Blues contract. play year-round, including new headquarters Lastly and most importantly, I would like to for the Sydney Sixers and Sydney Thunder We are excited by Cricket Australia launching thank the many thousands of volunteers who W/BBL clubs. a new national competition next are the foundation of our great cricketing This has become urgent with the imminent season to feature 10 teams across Australia, state. demolition of our administrative and training including the best two Premier Cricket T20 teams in NSW. This is a great opportunity for It is these men and women who are the facility at the SCG owing to the redevelopment lifeblood of the sport where it matters most. of the Sydney Football Stadium. more of our players to showcase their game on a national stage. If it were not for them we would not have the Hence Cricket NSW has been working on NSW has more venues capable of hosting pleasure of watching some of the greatest “two clubs, two hubs” solution for the past players in the game representing NSW and couple of years. elite cricket than any other state. This involves an enormous logistical challenge for local Australia. government and our highly committed JOHN KNOX NSW staff and volunteers. CHAIRMAN, CRICKET NSW Cricket NSWCricket Annual NSW Report Annual and Yearbook Report and 2017/18 Yearbook 2016/17 success. coach BenSawyer fortheSixers’continued Congratulations gotocaptainEllyse Perryand an allSydneyplay-off. Thunder claimingtheinauguralWBBL titlein competition, withcrosstownrivalsthe Sydney fi nalinthethreeyearsofrapidlyrising successive WBBLtitle.ItwastheSixers’ third The SydneySixersclaimedasecond continued toexcelonandoffthefi eld. Through allthis,theNSWwomen’s teams Cricket beginsinlateSeptember. back ontothecricketfi eldwhenNSWPremier We lookforwardtowelcomingthemboth diffi culttime. supports SteveandDavidthroughthis It isimportantthattheNSWcricketfamily public faithinthemselvesandthegame. punishment andareworkinghardtorestore regret theincident.Theyhaveacceptedtheir conferences thatSteveandDavidtruly That said,itwasobviousfromtheirpress stance onachallengingissue. should becommendedforitsprincipled public’s disappointment.CricketAustralia David wereheavybutproportionatetothe The 12-monthbanshandedtoSteveand punished forballtampering. Smith andhisdeputyDavidWarner severely saw NSWandAustraliancaptainSteve the shockofCapeTown, whichsubsequently JLT One-DayCuporJLT Sheffi eldShieldand Blues failingtomakethefi nalofeitherthe There wasthedisappointmentof of NSWfemalecricketers. shock therewasoneconstant,thedominance In aseasonofsuccess,disappointmentand CRICKET NSWCEOANDREWJONES From

the

Chief After winningsuccessive JLT One-DayCup the Blueslastseason wasdisappointing. cannot bedeniedbut theperformanceof The qualityofcricketersNSWproduces claiming thetitleinWBBL|02. WBBL fi nalsandretiredwiththeSixers on thematches.Sheplayedinfi rsttwo of theWBBL,whenshewasn’t commentating for theSydneySixersininaugural seasons However Lisacameoutofretirementtoplay last season. in 2012/13whatwethoughtwasher Lisa alsowonthestate-basedWT20title including fi veascaptain. 14 WNCLtitlesin16yearswiththeBreakers, every seasonsheplayedforNSW. Shewon Lisa waspartofatitle-winningteamalmost awarded LifeMembershipofCricketNSW. and Australiancricket,LisaSthalekar, onbeing We alsocongratulateanothericonofNSW governance reformsatCricketNSW. Her electionshowsthevalueofrecent Director. brilliant leaderandwillbeanoutstanding probably themostsuccessful,Alexisa Australia’s mostcappedfemaleplayerand 159 years. woman electedtotheCricketNSWBoardin international cricketthenbecamethefi rst announced herretirementfromstateand It hasbeenabigseasonforAlex,who their continuedsuccess. Blackwell andcoachJoanneBroadbentfor Congratulations toBreakerscaptainAlex extraordinary record. Women’s NationalCricket League.Itisan their 19thtitleinthe22-yearhistoryof team inwomen’s domesticsport,theywon Breakers becamethefi rstfullyprofessional A seasonaftertheLendleaseNSW within 5to10years. in AustraliabehindtheBBL,NRLandAFL League willbethebiggestsportsleague We believetheWomen’s BigBash this willdrivecontinuedgrowthinourgame. almost doubledto23.We areveryconfi dent as partofthenewbroadcastdealhasalso The numberofWBBLmatchesbeingshown this willhappenfrom2019. December eachyear. We aredelightedthat to haveitsownwindow, fromOctoberto Cricket NSWhaspushedhardfortheWBBL on theroad. their Perthsemi-fi nalafteratoughfortnight home andawayroundsbutranoutofgasin Sydney Thunderplacedsecondafterthe the Women’s Ashes. scoring anunbeatenTest doublecenturyin named ICCWorld PlayeroftheYear and Double congratulationstoEllyseonbeing

Executive New Zealandheld inearlyFebruary. fi nal of theUnder19World CuptoIndiain seven NSWplayers inthesquadthatlost and fastbowlerRyanHadleywereamong Jack Edwards,theyoungerbrotherof Mickey, Wicketkeeper BaxterHolt,battingallrounder rookie contracts. Liam Hatcherhaveallbeenupgraded from bowler MickeyEdwardsandfellowquick leg-spinner DanFallins,toweringfast his well-performedteammateParamUppal, Australian Under19captainJasonSangha, young playerstotheBlues’seniorsquad. Cricket NSWtopromoteanexcitinggroupof These departuresfromtheplayinglistallowed recontracted. reserve wicketkeeperJayLentonwerenot for andNicMaddinson Test cricketwhileGurinderSandhuleft New Zealandtopursuehisdreamplay Will Somervillealsoreturnedtohisnative service onandoffthefi eld. We thankthemboth fortheiroutstanding report andplacethemineliteNSWcompany. Australia. Theirrecordsareelsewhereinthis the seasonafterstellarcareersforNSWand Bollinger andEdCowan,whoretiredduring We saidfarewell thisyeartostalwartsDoug in thecomingseasons. confi denthewillachievesustainedsuccess while patiencemayberequired,weare partnership withourseniorplayersand, generation oftopclassNSWtalentin Phil’s briefistobringthroughthenext staff andprograms. and therewasarestructureofthecoaching He wasreplacedbyassistantPhilJaques to hiscreditinthreeseasons. and bestwisheswithtwoMatadorCuptitles Johnston leftasheadcoachwithourthanks on andoffthefi eld.FormerBlueTrent It wasobviousthatchangeswererequired table atChristmastonearthebottom. another match,slippingfromthetopof for AustraliandutiestheBluesfailedtowin However oncetheinternationalplayersleft 47% ofAustralia’s runs. of SmithandWarner plusourbowlersscored every wicketbaronerunoutandthetwinbats Hazlewood, Starc,CumminsandLyon took series whentheNSWbowlingattackof This wasreinforcedinthesubsequentAshes how goodourinternationalplayersare. Western AustraliaatHurstvilleshowedjust ’s twohat-tricksagainst dominated, winningtheirfi rstthreematches. of theJLT Sheffi eldShieldseasontheBlues With afullsquadavailableforthebeginning inconsistent performances. titles theyfailedtomakethefi nalthrough -hungry young opener Ryan Hackney and During the season, Cricket NSW also Congratulations to Men’s First Grade Premiers, raw left-arm fast bowler Chad Sammut, who embarked on a pilot program to assist Belvidere Cup winners Parramatta, First Grade has drawn comparisons to a young Doug volunteers and alleviate their burden by Limited-Overs Cup winners Sydney University Bollinger, were added to the rookie list while professionalising cricket administration at and Kingsgrove Sports T20 Cup winners Sydney. batsman Jordan Gauci has been retained. Association level in NSW. A Conference Thank you again to Harry and Rohini Solomons Our youth teams improved their already Administration Pilot was set up, with and Kingsgrove Sports for your support of the impressive record at National Championships, professional staff engaged to support the St Premier Cricket T20 competition. George, Newcastle and Clarence River Junior winning every national pathway competition In Women’s Premier Cricket congratulations Cricket Associations. via either NSW Metro or ACT/NSW Country. to Universities for claiming the Ruth Preddy Again, seven of the fi fteen selected players This has created strong interest from other Trophy as First Grade Premiers and Bankstown for the U/19 , held in New metropolitan and country associations, with Sports for claiming the First and Second Grade Zealand, were NSW pathway players with Jason CNSW-subsidised conference administrators Combined T20 Competition. allowing hardworking volunteers to devote Sangha from ACT/NSW Country as captain. We want NSW to produce the best players, more time to their clubs. Also, seven of the fi fteen players selected coaches and umpires and NSW offi cials for the Australian U/19 tour of South Africa We aim to have professional administrators continue to be represented strongly across were from the NSW Women’s pathway. The supporting every junior and most senior cricket international and national panels. competitions in NSW within 3 years, with captain of that team was This is no coincidence. Darren Goodger is the all junior competitions aligned to Sixers and from Riverina. best umpiring coach in Australia and has also Thunder brands. Our men’s and women’s Indigenous teams also turned 100 percent coverage of Premier and won their respective National Championship Funding inequities are also being addressed Shires cricket from a stretch target to a routine titles. by Cricket Australia, allowing Cricket NSW achievement. He is a vital part of Cricket NSW. to employ more Community Cricket staff in Congratulations to all the coaches and Thank you to the Cricket NSW Board members the fi eld. It has been obvious for years that support staff who played such an important for your support and particularly recently grass roots funding should broadly refl ect the role in achieving these results. We have a retired chairman John Warn, who made such population numbers across each state, and it tremendous group of people working in our an enormous contribution during his fi ve and now will. This has been a personal crusade pathway led by General Manager of Cricket a half years at the helm. It was a privilege to since 2004 and we are fi nally seeing results! Performance David Moore. work so closely with John in that period. Commercially we continue to grow and Cricket participation across the state continues As the Chairman’s report sets out, John’s reinvest the proceeds in NSW cricket. to rise thanks to the great work of our diligent energy and direction have helped transform and hardworking Game Development staff, A big thank you to the NSW Government for Cricket NSW into one of the leading sports led by outstanding General Manager Ivan its continued support of cricket across the organisations in the country. state, particularly through the ongoing major Spyrdz, with the department aptly returning Thanks and congratulations also to new sponsorship of Transport for NSW with the to its former name Community Cricket for the Chairman John Knox, who in his capacity Plan B Drink Driving message and the Plan coming season. as one of Australia’s leading investment B Regional Bash. It has been a partnership We continued to focus on school sampling bankers gave his time pro bono to conduct which has benefi ted cricket for 15 years. and growing girls cricket, plus working with the landmark media rights auction for Cricket multicultural, indigenous and all abilities We would also like to thank Lendlease, who Australia. The fi nal deal was comfortably a communities to ensure cricket is a Sport for supported the Breakers for a decade before record, and the game will benefi t from John’s All. Results were excellent, with a record year declaring their after this season. We efforts for years to come. are particularly grateful for their support in for NSW/ACT of 414,265 participants. There were bigger headlines at times, making the Breakers the fi rst fully professional The Game Development team also drove the but the media rights deal was the most women’s domestic team in Australian sport, introduction of Junior Formats, a modifi ed version important story of the year. It refl ected years which was the catalyst for a revolution in of the game for juniors with shorter pitches and of strategic planning and execution across Australian Cricket and beyond. boundaries and fewer players on each team. Australian Cricket, especially the launch and McDonald’s continues to make a strong The implementation across NSW and ACT growth of the BBL/WBBL. Cricket NSW can be contribution to Premier and community cricket was a great success, with 85% of NSW/ACT very proud of the part it has played in while Mazda and iiNet maintained their Junior Associations adopting and running a that process. outstanding support for the Sydney Thunder Junior Formats competition in 2017/18. NSW/ Sincere thanks to the dedicated staff at and Sydney Sixers respectively. ACT clearly led the nation, providing half of Cricket NSW who have helped lead another the total number of Junior Associations who Thank you to all our sponsors, who continue year of rapid change as we continue to grow adopted Junior Formats during the season. to make such a strong contribution to cricket to meet the needs of an ever more popular in NSW. Surveys conducted with administrators, coaches game. Fundamentally, NSW and Australian and parents were overwhelmingly positive. With support from Cricket Australia, Cricket cricket is in very good shape. Games are shorter, balls faced and NSW also distributed more than $1.8 million Lastly, I want to acknowledge the many per player are higher, there are more runs and in grants. Much of this went to support the thousands of volunteers who are the lifeblood per team, and the quality of play is NSW Premier Cricket Men’s and Women’s of the game. Cricket has never been played much improved with far more balls in play. competitions, Shires and the NSW Districts by more people in Australia or watched by so Cricket Association. Credit to Ivan and his team, plus Cricket many either at the grounds or on television. Australia Executive General Manager of Cricket NSW also continues to invest heavily Volunteers are the foundation of this success. in country cricket, with more than $4 million Community Cricket (and Cricket NSW Hall of ANDREW JONES distributed across the state. Famer) Belinda Clark, for leading this change. CHIEF EXECUTIVE OFFICER, CRICKET NSW Cricket NSW Annual Report and Yearbook 2017/18 Alex Blackwell elected to the Cricket Board

ALEX BLACKWELL SPEAKING AT THE ANNUAL CRICKET NSW AWARDS NIGHT EARLIER THIS YEAR FOLLOWING HER RETIREMENT FROM NSW AND AUSTRALIAN CRICKET

Former Australian and Lendlease Breakers The contribution of Mrs Forsythe to the was keen to ensure the expansion of the game, captain Alex Blackwell became the fi rst community is equally signifi cant. particularly women’s cricket, continues. woman in the 159-year history of New South Mrs Forsythe was appointed to the board in Cricket NSW Chief Executive Andrew Jones Wales cricket to be elected to the board at the September 2010 and is the current Executive thanked the members for choosing such a Ordinary General Meeting on 4 June. Director of the Sydney Business Chamber. highly credentialled candidate as Ms Blackwell At the fi nal meeting under the stewardship Mrs Forsythe also served the state as a and said she will be an outstanding director. of Chairman John Warn, Ms Blackwell was member of the NSW Legislative Council for Following the integration of the male and formally endorsed as a director by the Cricket 15 years from 1991 to 2006. female associations in 2004, elected directors NSW members. At a time of exponential growth for the female could only be drawn from a pool of 34 club, While two women have previously served on game and cricket in general, the election of zone and association delegates, all but one of the Cricket NSW Board as appointed directors, Ms Blackwell to the board becomes all the whom were male. former Director Rina Hore and current Director more signifi cant. In 2016, the NSWCA constitution was Hon Patricia Forsythe, Ms Blackwell is the fi rst Throughout a domestic and international amended to allow the election of non- woman to be elected directly by the members. career that spanned 16 years, Ms Blackwell delegates to the board. Ms Hore was the fi rst woman appointed to the became Australia’s most capped female Mr Jones said this reform put Cricket NSW in Cricket NSW board in 2004 and served as a player and, notwithstanding her magnifi cent a good position to attract well-qualifi ed past director for six years. She was also elected a performances with bat in hand, her leadership players and highly-skilled friends of cricket life member in 2006. both on and off the fi eld was pivotal to much that can make a signifi cant contribution at Since 2006, Ms Hore has served as Executive of the Breakers record-breaking success during board level. Director of the Bradman Foundation and that period, including 14 WNCL titles. Ms Blackwell retired as a NSW and Australian is currently Company Secretary for the Ms Blackwell said she was delighted to be player at the end of last season but is organisation. given the opportunity of continuing to make a contracted to continue playing for Sydney major contribution to cricket off the fi eld and Thunder during 2018/19. Cricket NSW Annual Report and Yearbook 2017/18 leading run-scorerwith372runsat74.40. she alsoendedtheWNCLcampaign asthe It wasahighlyproductiveseasonfor Perryas best outoftheallrounder. runs at46.00withthecaptaincybringing scorer forthetournament.Shescored552 Perry fi nishedWBBL|03 as theleadingrun- to asecondsuccessivetitle. Big BashLeagueaftershecaptainedtheside for theSydneySixersinRebelWomen’s She wasvotedthePlayerofTournament Cricket Council. within thelast12monthsbyInternational International batterandallrounderintheworld Perry wasratedthebestfemaleOne-Day highest honourinAustralianfemalecricket). Medal andtheBelindaClarkAward (the completed thedoubleofBelindaClark For thesecondtimeinhercareer, Perry Medal asthebestmaleplayerinstate. while Hughesacceptedhisfi rstSteveWaugh three yearsforthebestfemaleplayerinNSW, Perry wonhersecondBelindaClarkMedalin the HyattRegencySydneyinApril. Annual CricketNSWAwards dinnerheldat Hughes werethemajorwinnersat16th Perry andversatileBluesbatsmanDaniel Star LendleaseBreakersallrounderEllyse DANIEL HUGHESISCONGRATULATED BYSTEVEWAUGH Cricket

NSW

16th strong inallformats.Haynesscored 363 the 2017/18Women’s Ashesserieswas The actingAustraliancaptainthroughout their 19thWNCLtitle. in aseasonwheretheNSWwomenclaimed the PlayerofTournament fortheBreakers Rachael HaynesshadedPerrytobenamed at anaveragebetterthan41. Hughes amassed661runsforthecampaign cemented inhiscustomaryspotofopener. He spentthelatterhalfofShieldseason Queensland, beforeheranoutofpartners. score oftheseason,98notoutagainst position ofNo.6,wherehemadehishighest Hughes startedthecampaigninunfamiliar consistent seasonintheJLT Sheffi eldShield. The 29year-old fromCowraalsohadanother 64.33. a yearearlierwherehescored386runsat It wasvirtuallyidenticaltohisperformance and ahighestscoreof122. His 379runsat63.16includedtwocenturies the topoforderinJLT One-DayCup. The elegantlefthanderscoredheavilyat 2017/18. another excellentone-daytournamentin previous seasonintheshorterformatwith Hughes carriedonhisgoodformfromthe

Annual

Awards – Thunder WBBL|03PlayeroftheTournament – Sixers WBBL|03PlayeroftheTournament – Thunder BBL|07PlayeroftheTournament – Sixers BBL|07PlayeroftheTournament – of theTournament Women’s NationalCricketLeaguePlayer – JLT One-DayCupPlayeroftheTournament – Tournament JLT Sheffi eldShieldPlayerofthe – Steve Waugh Medallist – Belinda ClarkMedallist Award winners Sydney SixersPlayeroftheTournament. English importSamBillingswasnamed the for histeam. the MikeHusseyMedalasbestplayer Sydney ThundercaptainShaneWatson won Daniel Hughes. opening partnershipswithfellowopener 398 runsat66.33andsharedthreecentury for NSWintheJLT One-DayCup.Hemade Maddinson wastopoftherun-scorerslist third consecutiveseason. the Bluestopthreeleadingrun-scorersfor His dynamicstrokeplaysawhimfi nishamong limited-overs competition. ball cricketersinAustraliathroughoutthe why heisoneofthemostdangerouswhite One-Day PlayeroftheTournament andshowed Nic MaddinsonwasnamedtheJLT Cup season. Hecollected34wicketsat25.38. the Tournament followinganotherexcellent claimed theJLT Sheffi eldShieldPlayerof Veteran BluesseamerTrent Copeland Sydney Thunder. also PlayeroftheTournament forthe highest scoreof103notout.Shewas runs at90.75intheWNCL,includinga Ellyse Perry Rachael Haynes Daniel Hughes Ellyse Perry

Night Cricket NSW Hall of Fame

2018 Inductee

Bert Oldfi eld MBE NSW 1920/21 – 1936/37 Australia 1920/21 – 1936/37 Bert Oldfi eld, one of Australia’s greatest Oldfi eld recorded a remarkable career for He made his Test debut at the hallowed wicketkeepers, is best remembered for New South Wales and Australia, considering in December 1920, suffering a fearful blow to the head during what he endured serving his country. and was part of an emphatic 377-run win for the height of the dramatic series in He was lucky to survive the First World War Australia the old enemy, England. 1932/33. after being buried under debris for several Oldfi eld played his last Test match in 1937 at Struck by a short ball from relentless fast hours following a heavy bombardment of the MCG and fi nished his career just as it had bowler , grainy but graphic Polygon Wood in during 1917. begun, with a thumping victory over England footage shows Oldfi eld slumping to the pitch. Wisden Cricketers’ Almanack described by an innings and 200 runs. Police feared the capacity crowd at Oldfi eld as small and wiry, with a quiet sense In 245 fi rst class matches, he took 399 catches Oval would riot as the hostility towards the of humour and a genius for making friends. and effected 263 stumpings. dangerous tactics of England captain Douglas “He had wonderfully quick refl exes and a Oldfi eld was also a useful lower-order Jardine created rising anger and ultimately mind like a compass needle. He was neat, batsman. He accumulated 1,427 Test match a diplomatic incident between Australia and effi cient and unobtrusive in his movements,” runs at an average of 22.65 and scored six England. Wisden recorded. fi rst class centuries including a highest score With swelling over his right temple and eye, “You never knew he was there until he of 137. Oldfi eld was later diagnosed with a fractured had you out,” one of Australia’s fi nest He played in 51 Sheffi eld Shield matches for skull but remarkably it kept him out of just the batsmen, , observed. NSW and is the sixth all-time leading NSW one Test match. Oldfi eld 52 of the 130 batsmen wicketkeeper for most dismissals in the The violence of Bodyline was a complete he dismissed in 54 Tests, a surviving history of the competition. contrast to Oldfi eld’s nature. He was a gentle international record for stumpings and Oldfi eld fi nished his career with 179 Sheffi eld and understated man, who served in both their proportion to catches. Shield dismissals, including 109 catches and World Wars. 70 stumpings.

2008 2012 OBE Denise Annetts Sir Donald Bradman AC Alan Davidson AM MBE MBE 2013 Charlie Macartney Amy Hudson MBE Norm O’Neill OAM Bill O’Reilly 2014 AO MBE Charles Turner Geoff Lawson OAM Stephen Waugh AO Margaret Peden 2009 2015 Mollie Dive Belinda Clark AM AO 2010 2016 Stan McCabe Belinda Haggett AM 2011 2017 Hazel Pritchard Rick McCosker Glenn McGrath AM Cricket NSW Annual Report and Yearbook 2017/18 BOB HOLLAND Tribute he debutedinJanuary1979. Newcastle GradeCricketcompetition, when be selectedtoplayforNSWdirectlyfromthe The amicabletweakerwasthelastplayerto and LenPascoe. former AustralianfastbowlersJeffThomson he playedalongsideteenagetearaways competition withtheBankstownclub,where He spentjustoneseasonintheSydneyGrade for SouthernLakes. Holland remainsthe5thhighestrun-scorer ability, withaTest averageofjust3.18, For amanwhowasnotknownforhisbatting average of17.8. for SouthernLakestook799wicketsatan in 1961and317FirstGradematches He madehisFirstGradedebutfortheclub Southern LakesDistrictCricketClub. Morisset, Newcastle,whereheplayedforthe Holland wasborninSydney, butgrewupin NSW until32,butthatisonlyhalfthestory. debut forAustraliaat38,anddidnotplay This wonderfulleg-spinnermadehisTest cricket. of thebeststoriesinannalsAustralian The journeyofBob“Dutchy”Hollandisone

to

Bob

Holland matches forNSW. over 300wicketsincluding228scalps in68 Throughout hisfi rstclass career, Hollandtook One-Day Internationals. attheSCGin1986.Healsoplayedtwo two-year period,untilhisfi nalmatchagainst Holland claimed34Test wicketsovera his Test career. both inaninningsandamatch–during Those fi guresremained his bestreturn– over theWest Indianpowerhouse. wickets andhelpAustraliatoararevictory 6-54 and4-90tofi nishthe matchwith10 ground attheSCG,Hollandfamouslyclaimed In thefi fthTest ofthatseries,onhishome debuted in1928. Ironmonger, whowereboth46whenthey debutants, spinnersDonBlackieandBert Australia hasproducedjusttwoolder November 1984. against theWest IndiesattheGabbain Then aweeklater, hemadehisTest debut West Indiantouring side. claimed sevenwicketsforNSWagainstthe the mostofatrademarkspinner’s pitchand 1984/85 season,whenattheSCG,hemade A pivotalmomentforHollandcameduringthe

OAM BOB HOLLAND cancer on17September2017age70. Holland tragicallypassedawayfrombrain said MrJones. because ofhisskillsbutalsopersistence,” “He wasaninspirationasaplayer, notonly delightful man. coach, administratorandmentorbutalsoa said MrHollandwasnotonlyafi neplayer, Cricket NSWchiefexecutiveAndrewJones a MedaloftheOrderAustralia(OAM). level, wasrecognisedwhenHollandreceived cricket, fromgrassrootsthroughtotheelite In January2017fi vedecadesofserviceto of theSouthernLakesclubfor16years. coaching coursesandservedasPresident He wasalsoamentorformanyLevel1 Grade clubs. Newcastle youthrepresentativesquadsand Hunter SportsHighSchool,aswellmultiple Academy, HunterAcademyofSportand contributions asacoachforToronto Workers in theNewcastleregionandmaderegular of theentry-levelprogramforjuniorcricketers He wasinstrumentalintheimplementation in retirement. Holland gavebacktothegameenormously In additiontothisastonishingcareer, Lisa Sthalekar awarded Cricket NSW Life Membership

Lisa Sthalekar was one of the most decorated cricketers to play for New South Wales and Australia. The great allrounder has the remarkable record of claiming more than 200 wickets and scoring almost 4,000 runs at both the international and domestic level. Her outstanding achievements were recognised when Sthalekar was awarded Life Membership of Cricket NSW at the 2017 annual general meeting. She became Life Member number 125. Through her extraordinary journey through life from an orphanage in Pune, India, travelling to the , then Kenya and fi nally to Australia with her adopted parents, Sthalekar recorded one of the best careers by an Australian female cricketer. Throughout this amazing career she won an incredible 14 Women’s National Cricket LISA STHALEKAR WAS AWARDED LIFE MEMBERSHIP OF CRICKET NSW League titles in 16 years with the NSW Lendlease Breakers, including fi ve as captain. Sthalekar has lived and breathed cricket for “Almost every season that Lisa played for Sthalekar was also an integral member of most of her life. Her love of the game began NSW either in under-aged competitions or two World Cup titles for her nation in 2005 when playing cricket with her father when with the Breakers, she was part of a and 2013. she was only fi ve years old, and from a young title-winning team,” Mr Warn said. age, Mr Sthalekar made sure that she was Her international career included two World Cricket NSW Chief Executive Andrew Jones coached correctly. T20 titles for Australia in 2010 and 2012. described Sthalekar as a cross-generational Sthalekar won a T20 championship with She also worked as head of the female star, that made the leap from largely the Breakers in 2012/13 and helped the pathway for Cricket NSW during a decade that amateur women’s cricket to the new Sydney Sixers to their fi rst WBBL title in saw her help develop many of the players who fully professional era. 2016/17 in her second season back after are now winning titles for Australia and the “Lisa is a serial winner, and it is that winning initial retirement. Breakers. They include the likes of world-class attitude, along with outstanding all-round allrounder Ellyse Perry. This is not to mention numerous under-aged skills, that have made her one of the most and Premier Cricket titles. Cricket NSW chairman John Warn said the infl uential players in the history of NSW record of Sthalekar as a cricketer is cricket,” said Mr Jones. She played 145 one-day fi xtures for the as remarkable as her life story. Breakers – the most by any NSW player – and another 45 T20 matches for her state. This complemented 187 matches across LISA STHALEKAR RECORD FOR AUSTRALIA, NSW BREAKERS AND SYDNEY SIXERS all formats for Australia and 25 matches for the Sixers. Runs Wickets In all for her state and country, Team Australia NSW Sixers Australia NSW Sixers Sthalekar scored a combined 8,005 runs at Test 416 23 an average of 29.32 and took 464 wickets One-Day 2728 3414 146 166 at an impressive 21.71. T20 769 587 91 60 50 19 She posted three centuries for her country at TOTAL 3913 4001 91 229 216 19 the Test and One-Day International level. Her highest score for Australia was 120 against England in the 2003 Women’s Ashes. 402 career matches played Sthalekar also scored two centuries for the Australia NSW Breakers Sydney Sixers Breakers during her career at domestic level. 8 Test matches 145 One-Day domestic 25 T20 matches Unfortunately, Sthalekar was unable to receive 125 One-Day Internationals matches in the WNCL in the WBBL her accolade in person due to commentary 54 T20 Internationals 45 T20 matches commitments, with the honour proudly accepted by her father Haren in her absence. Cricket NSW Annual Report and Yearbook 2017/18 CELEBRATES AWICKETWITH HISTEAMMATES Australian Statistics to30June,2018 CUMMINS, PatrickJames. LYON, NathanMichael. HENRIQUES, MoisesConstantino. HAZLEWOOD, JoshReginald. International T20 Domestic T20 NSW ListA Dom. limited-overs One DayInternationals Test Sheffield Shield NSW First-class First-class International T20 Domestic T20 NSW ListA Dom. limited-overs One DayInternationals Test Sheffield Shield NSW First-class First-class International T20 Domestic T20 NSW ListA Dom. limited-overs World Cup One DayInternationals Test Sheffield Shield NSW First-class First-class International T20 Domestic T20 NSW ListA Dom. limited-overs World Cup One DayInternationals Test Sheffield Shield NSW First-class First-class

Representatives Born: 20November, 1987,Young, NewSouthWales. Righthandbatsman;armoffspinbowler. Born: 8May, 1993,Westmead, NewSouthWales. Righthandbatsman;armfastmediumbowler. 3 7 815 52-1.15 4 56 8-50 35.68 444 - 55 12.71 - 2 75 1551 48 170 133 Born:8January1991,Tamworth, NewSouthWales. Lefthandbatsman;Rightarmfastmediumbowler. 21 71 .81 71.55-23 4-10 17.45 4-44 4-10 33.29 47 36.77 34 36.38 8-50 - 4-63 18 40 4-63 - 32.21 38.97 12 - - 33.85 306 12 91 5.88 67 3 - 14 9.86 - - - 16.66 11.30 37 - 9 - - 2-19 - 9 11.71 3-32 - 4-17 13.66 11 38.09 - - - 4-17 18.65 43.71 14* - 37.91 34 47 - 30 7 37* - 37.91 69 54 - 2 5-17 54 47 113 2 - 5 50 5-17 - 75 4 33.51 38 - 75 5-17 6 820 32.08 13 4 5 28 70 519 24.90 11 28 75 31.57 3-16 32 373 16 29 9.00 36.67 - - 8 27 12 106 36.67 - 7-36 23.59 33 91 2 11 - 7-36 15 - 27 6 51 2 22 29.80 78 28 31 6 29.80 - 77 36.29 34 56 35 6-52 6 - 36.30 23 164* 56 7 18 6-67 - 164* 33.91 1569 24.27 7 6-50 1 1907 - 12 7 1907 69 26.84 6-50 13 81 8 24.73 9 13 5.50 265 6-50 8 151 9 - 76 24.50 19 265 96 1 4.55 61 - - 3121 25.27 265 100 4.55 80 61 - 3-15 12 3194 - 68 10 271 11 - - 15 3934 - 68 4-16 11 10.50 20.52 4-26 - 11 11 97 - 4-26 6* 14 12.96 12 - 23 24.54 99 - 24.36 11.35 60 28 17* - 24.36 130 11.43 26 - 11 25 61 4-24 17* - - 25 12.75 81 6-79 - 50 - - - 28.45 11* 4 50 3 - - - 23.81 39 - 64 4 7 7 21 4.00 43* 5 66 4 - 7 - 43* 6-79 337 15 19.50 19.80 - 261 - 8 43* 17 15 19.80 25.09 263 - 6 37 - 22 7 - 37 676 10 7 - 103 8 48 12.00 - - - 13 41 30 32 20.27 - - 40 31 39 38 27 - 85 11 28 38 28 - 156 99 73 26.20 1 3 99 36 - 4 50 3 10 3 144 12 3 365 8 18 8 8 82* 21 4 14 14 629 20 22 39 12 14 36 25 n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS BB Runs Avge NO Wkts St Inn M Ct Avge 100s 50s HS BB Runs Avge NO Wkts Inn St M Ct Avge 100s 50s HS BB Runs Avge NO Wkts Inn St M Ct Avge 100s 50s HS Runs NO Inn M 6 1 34 20 1-48 82.00 2 4-30 - 33.62 1------0-- 8 1 4-35 25.14 - 23.42 7 - 1 - 2 - 81* - - 164 - - 1 - - 8 3-42 - 4 - 16.00 - 5 - 4-57 - - 4-57 30.30 - 30.30 2 23 - 23 7 - - - - 3 - 5 3 22.00 - 22.00 - 7* - - 7 - 42 42 1 88 88 1 3 3 2 7 7 6 6 Born: 1February1987,Funchal,Portugal.Righthandbatsman;armfastmediumbowler. 183196*2-3.03-439.50 4 - 3 31.80 - 2 62* 159 3 8 11 – Mens O’KEEFE, Stephen Norman John. Born: 9 December, 1984, Penang, Malaysia. Right hand batsman; Slow left arm orthodox bowler. M Inn NO Runs HS 50s 100s Avge Ct St Wkts Avge BB First-class 76 107 30 2128 99 9 - 27.63 31 - 265 24.55 8-77 NSW First-class 59 85 21 1710 99 8 - 26.72 25 - 188 24.94 8-77 Sheffield Shield 59 85 21 1710 99 8 - 26.72 25 - 188 24.94 8-77 Test 9 13 4 86 25 - - 9.55 - - 35 29.40 6-35 Dom. limited-overs 43 30 9 563 70* 1 - 26.81 19 - 25 58.00 3-65 NSW List A 43 30 9 563 70* 1 - 26.81 19 - 25 58.00 3-65 Domestic T20 44 32 10 355 50 1 - 19.09 12 - 26 35.19 3-20 International T20 7 5 0 32 22 - - 6.40 1 - 6 24.83 3-29

SMITH, Steven Peter Devereux. Born: 2 June, 1989, Kogarah, New South Wales. Right hand batsman; Right arm bowler. M Inn NO Runs HS 50s 100s Avge Ct St Wkts Avge BB First-class 118 208 26 10424 239 44 37 57.27 174 - 67 52.86 7-64 NSW First-class 39 69 7 3264 177 15 10 52.65 59 - 43 50.07 7-64 Sheffield Shield 38 67 6 3159 177 14 10 51.79 57 - 40 50.08 7-64 Test 64 117 16 6199 239 24 23 61.37 96 - 17 54.88 3-18 One Day Internationals 108 94 12 3431 164 19 8 41.84 62 - 27 34.48 3-16 World Cup 14 10 2 455 105 4 1 56.88 5 - 1 158.00 1-44 Dom. limited-overs 43 41 10 1726 143* 13 2 55.68 26 - 16 44.44 3-43 NSW List A 43 41 10 1726 143* 13 2 55.68 26 - 16 44.44 3-43 Domestic T20 34 32 7 672 65 4 - 26.88 17 - 22 14.05 4-13 International T20 30 25 5 431 90 2 - 21.55 18 - 17 22.17 3-20

STARC, Mitchell Aaron. Born: 13 January, 1990, Baulkham Hills, New South Wales. Left hand batsman; Left arm fast medium bowler. M Inn NO Runs HS 50s 100s Avge Ct St Wkts Avge BB First-class 80 104 26 1744 99 10 - 22.35 36 - 313 26.36 8-73 NSW First-class 24 25 10 326 54* 1 - 21.73 14 - 84 25.11 8-73 Sheffield Shield 24 25 10 326 54* 1 - 21.73 14 - 84 25.11 8-73 Test 43 66 12 1171 99 9 - 21.68 19 - 182 28.17 6-50 One Day Internationals 72 35 16 262 52* 1 - 13.78 19 - 141 20.95 6-28 World Cup 8 3 1 0 0* - - 0.00 5 - 22 10.18 6-28 Dom. limited-overs 19 8 3 112 34* - - 22.40 4 - 58 18.83 6-25 NSW List A 19 8 3 112 34* - - 22.40 4 - 58 18.83 6-25 Domestic T20 15 6 4 15 8* - - 7.50 2 - 24 17.62 3-17 International T20 22 6 2 12 4 - - 3.00 6 - 30 18.86 3-11

WARNER, David Andrew. Born: 27 October, 1986, Paddington, New South Wales. Left hand batsman; Right arm leg spin bowler. M Inn NO Runs HS 50s 100s Avge Ct St Wkts Avge BB First-class 102 184 7 8608 253 37 28 48.63 68 - 6 75.83 2-45 NSW First-class 19 33 2 1331 148 5 4 42.94 7 - 1 125.00 1-0 Sheffield Shield 19 33 2 1331 148 5 4 42.94 7 - 1 125.00 1-0 Test 74 137 5 6363 253 29 21 48.20 54 - 4 67.25 2-45 One Day Internationals 106 104 4 4343 179 15 14 43.43 49 - 0 - - World Cup 8 8 1 345 178 - 1 49.29 5 - - - - Dom. limited-overs 35 35 2 1416 197 4 4 42.91 11 - 3 39.33 1-11 NSW List A 35 35 2 1416 197 4 4 42.91 11 - 3 39.33 1-11 Domestic T20 26 26 4 847 102* 6 1 38.50 11 - - - - International T20 70 70 3 1792 90* 13 - 26.74 41 - - - -

NATHAN LYON SURROUNDED BY HIS TEAM MATES AFTER TAKING A Cricket NSW Annual Report and Yearbook 2017/18 Australian Statistics to30June,2018 International T20 Domestic T20 WNCL World Cup One DayInternationals International T20 Domestic T20 WNCL One DayInternationals International T20 Domestic T20 WNCL World Cup One DayInternationals Test CAREY, NicolaJane. BLACKWELL, AlexandraJoy. ALEY, SarahElizabeth. International T20 Domestic T20 WNCL World Cup One DayInternationals Test PERRY, EllyseAlexandra. HEALY, Alyssa Jean. HAYNES, RachaelLouise. International T20 Domestic T20 WNCL World Cup One DayInternationals Test International T20 Domestic T20 WNCL World Cup One DayInternationals Test

Representatives Born: 24March,1990,GoldCoast,Queensland.Righthandbatter;Wicket-keeper. Born: 10September, 1993,Camperdown,NewSouthWales. Lefthandbatter;Rightarmmediumpacebowler. Born: 3June,1984,Caringbah,NewSouthWales. Righthandbatter;armmediumpacebowler. Born: 3November, 1990,Wahroonga, NewSouthWales. Righthandbatter;armfastmedium bowler. Born: 26December1986,Carlton,NewSouthWales. Lefthandbatter;armmediumpacebowler. 0 01 3 1--93 9-181.34-8 4-35 14.83 26.08 118 87 - - 19 45 9.31 14.67 - - - 1 41 69 335 631 14 13 50 56 107 109 1 0 039 9 4-4.25 - - 1-14 2-8 - 124.50 10.50 2 2 6 - 50 - 61 46.82 55 46.94 - 36.00 11 14 3 30 99* 157 25 3090 114 4788 40 27 3492 106 129 27 112 139 124 144 0 72 839*9-3.72 72.93-12 25.99 67 - 27 34.77 - 9 91* 1843 24 77 101 Born: 31August,1983,Wagga Wagga, NewSouthWales. Righthandbatter;armmediumpacebowler. 1 61 707*6-2.54 01.53-16 19.55 20 - 40 21.25 - 6 78* 1700 16 96 114 1 1 60161 57 06 - - - 67 60 25.78 1 18 106 2630 9 111 116 74 1555 38 3-6 20 4-12 3-26 22.06 19.22 65 36 - - 23 - 25 13.82 22.54 - - - - 1-8 1 0 3 8.00 - 53 65 - 1 525 0 631 - 34 11 - 21.19 4 10 49 - 6 34.00 32 87 - 1 46 22.20 61 - 3 90 1314 4 19 74 544 81 444 6 95 2 22 29 22 12 05 8855*3-2.33-8 04 4-12 20.40 3-19 5-11 84 25.08 5-19 - 19.34 26 104 25.62 - 3 - 130 25.73 3 - 22 - 56.67 30 45.85 - 3 3 51.83 55* 5 - 8 875 71 127* 25 18 95* 1559 510 52 13 2540 7 90 47 26 16 68 75 18 97 n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS Runs NO Inn M n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS BB Runs Avge NO Wkts Inn St M Ct Avge 100s 50s HS Runs NO Inn M n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS Runs NO Inn M 52 2376 24 8-41.03-19 18.50 3-20 4 3-10 20.04 - 13.42 23 7 18 - - 22.46 26 - 9 39.93 1 32.21 6 65 - 21 156 337 8 89* 3515 12 7 1031 27 4 35 95 98 36 42 06 2929 74 23 ------31 - 22 - 25 17.44 17 65 - 42 34.81 2 22.43 3 90 1 13 159 942 4 133 2228 12 7 830 66 80 71 10 83 47 58 n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS Runs NO Inn M n ORn S5s10 veC tWt veBB Avge Wkts St Ct Avge 100s 50s HS Runs NO Inn M .0--0-- - 2-29 0 2-29 14.50 - 14.50 2 2 - - - 1.00 1 1 - - - - - 1 - - 1 - 15* 15* 0 15 15 1 1 1 2 1 1 1 1 31 65 30 1-34 53.00 1 - 3 16.50 - - 17 33 0 11111*-----0-- 2 3 144223 17 01.36-32 17.33 30 - 5 61.71 1 1 213* 432 4 11 7 0 33-3.55-360 2-12 1-0 6.00 3 27.00 2 - - 5 - 37.75 - 29.28 - 3 83 1 98 302 205 1 0 9 7 9 4 86*1-3.753------3 - 5 7 32.67 - 32.50 - 1 - 63* 45 98 130 2 - 5 4 8 3 – Womens NSW Blues Report

Phil Jaques ( Coach), Beau Casson (Assistant/Pathway Coach), Anthony Clark (Assistant/Pathway Coach), Dan Redrup (Physiotherapist), Michael Main (Strength and Conditioner), Dr John Orchard (Doctor), Justine Whipper (Player Development Manager), Gerard Faure-Brac (Psychologist), Erin Michael (Nutrition), Mohsin Sheik (Analyst), Blake Hudson (Match Coder), Joshua Dipple (Match Coder) and Aiden White (Match Coder). We would also like to thank David Freedman (State Talent Manager) for his role in the selection of the contracted players and the teams for each tournament.

MICKEY EDWARDS AND HIS BLUES TEAM MATES CELEBRATE A WICKET 2017/18 NSW Blues Squad (clubs/region or junior The 2017/18 season could be viewed as the Sheffi eld Shield winners, Queensland. The a season of missed opportunities and second is that we only had one bowler in the association in brackets) disappointment. The Blues fi nished fourth in top 20 wicket-takers in the competition. Cricket Australia Contract the JLT One-Day Cup after being champions In the JLT One-Day Cup, Nic Maddinson (Penrith/Penrith DCA), the previous two seasons. The campaign scored 398 runs at 66.33 which earned him Josh Hazlewood (St George/Central Northern), ended with the controversial abandonment the NSW One-Day Player of the Tournament (Northern District/Western), of the match played at award. Daniel Hughes scoring 379 runs at (Sutherland/Sutherland Shire while having under extreme pressure. 63.16 with the bat was also noteworthy. With JCA), Mitchell Starc (Western Suburbs/ The Blues JLT Sheffi eld Shield team fi nished the ball, captured 12 wickets at Northern District CA), a disappointing fi fth after being undefeated an average of 24.75 while Nathan Lyon took 9 (Randwick Petersham/South Eastern JCA) following three rounds and leading the wickets at 27.22. competition at Christmas. Daniel Hughes was awarded the Steve Waugh Cricket NSW Contract These performances led to a review of the Medal through very good performances in Sean Abbott (Parramatta/Parramatta DCA, coaching and playing structure and changes both the JLT One-Day Cup and the Sheffi eld (Fairfi eld-Liverpool/Parramatta during the off-season including the departure Shield. Combined with his Sheffi eld Shield DCA), (Eastern Suburbs/North of Head Coach, Trent Johnston, and changes performances, he had another excellent one- Shore DCA), Trent Copeland (St George/ in the Blues contract list. day tournament batting at the top of the order, Western), Ed Cowan (Sydney University/South The 2017/18 season saw the return to the which included two centuries and a top score Eastern JCA), (Sutherland/ NSW contract list of , following his of 122. Sutherland Shire JCA), Ryan Gibson (Penrith/ disappointing demotion from the Australian In the second half of the season, both Ed Penrith DCA), Daniel Hughes (Mosman/ team. It also saw the inclusions, for the fi rst Cowan and Doug Bollinger announced their Western), Moises Henriques (St George/ time, of young pace bowler Henry Thornton, retirement and we celebrated their careers Georges River-St George DCA), being promoted from the rookie contract at the NSW Awards Night. Ed played 18 Test (Sydney University/North Coastal), list, and Charlie Stobo, from Gordon, being matches for Australia and scored over 1000 (Manly-Warringah/Central Coast), rewarded with his fi rst full contract following runs. He played 143 First Class matches and Nic Maddinson (Eastern Suburbs/Southern), a number of great seasons for his Club in the scored over 10, 000 runs. (Hawkesbury/Parramatta DCA), NSW Premier competition. Doug played 12 Tests, 39 One Day Peter Nevill (Eastern Suburbs/), In the Sheffi eld Shield season, there were Internationals and 9 T20 internationals for his Stephen O’Keefe (Manly-Warringah/ Hawkesbury DCA), a number of notable performances. Daniel country and in a 15-year career he fi nished (St George/Georges River-St George DCA), Hughes’ display of 661 runs at 41.31 and Kurtis with 411 fi rst class wickets. His career tally (Fairfi eld-Liverpool/ Patterson’s 672 runs at 37.33 were a highlight included 290 scalps for NSW, which makes Blacktown DCA), Charlie Stobo (Gordon/ with the bat. With the ball, Trent Copeland’s 34 him ninth on the list of leading wicket-takers Gordon DCA), Henry Thornton (Eastern wickets at 25.38 earned him the NSW Player for the state in fi rst class cricket and the Suburbs/South Eastern JCA), Will Somerville of the Tournament in the Sheffi eld Shield at the third most successful NSW fast bowler of all (Eastern Suburbs/South Eastern JCA) NSW Cricket Awards Night. Mitchell Starc’s 17 time behind legends Geoff Lawson and Mike wickets in two matches at an average of 12.7 Whitney. Cricket NSW Rookie Contract was all the more remarkable in that he captured CNSW players and staff thank both Ed and Mickey Edwards (Manly-Warringah/Manly- two hat-tricks in the one match versus Western Doug for their contribution to the Blues and Warringah DCA), Daniel Fallins (Sutherland/ Australia at . the passion they showed while representing Sutherland Shire JCA), Jordan Gauci The tale of the Sheffi eld Shield season was their State. (Hawkesbury/Blacktown DCA), twofold. One was the inability for our side Cricket NSW would like to acknowledge the (Fairfi eld-Liverpool/Fairfi eld- to convert starts into large scores, with only efforts of the Coaching and Support staff for Liverpool DCA), (Randwick two centuries scored in the season. This is in this season. This includes Trent Johnston Petersham/Newcastle), Param Uppul (Fairfi eld- comparison to the nine centuries scored by (Head Coach), Geoff Lawson (Bowling Coach), Liverpool/Blacktown DCA) Cricket NSW Annual Report and Yearbook 2017/18 got the visitors home. got thevisitorshome. wickets onitswaytovictory, anothercomposedknock fromWarner (32) The Bluesthenrequiredamere57runsforthewinand,despitelosingfour 10/69 tobebowledoutfor206. rampant Starcwreakedhavocinthenext23overs,asSouthAustralialost However, thedepartureofWeatherald ledtoadramaticcollapse.A added 137runs. of theirfirst wicket.JakeWeatherald (71)andJohnDalton(64)together The SouthAustralianopenersalmosterasedtheNSWleadbeforeloss in takingNSWtoanimposing150-runlead. guided theBluesoutoftroublefrom4/95atonepoint,withpairpivotal It wastheexperienceofWarner andclassofDanielHughes(57)that David Warner thenledthewayinreplywithanimportant83from139balls. was superbwiththepinkball,collecting6-24from13.3overs. NSW dismissedSouthAustraliaforjust92after34overs.Trent Copeland He finished theday-nightfi xture with10-119. Starc claimed8-73inthesecondinnings,bowlingfourofbatsmen. to anemphaticsix-wicketvictoryoverSouthAustralia. opening matchoftheJLT Sheffi eld ShieldcampaigntoguidetheBlues Mitchell Starcproducedanincredibledisplayoffastbowlinginthe 27-29 October2017–AdelaideOval Round 1: JLT xrs2b2 l w1b5 4wkts 57 3lb1w1nb 4 (94min,21.5overs) 7 4 242 didnotbat 0 6 Mennie 4.5-1-13-0. didnotbat Zampa 15-2-49-1;Head 4-2-3-1.SecondInnings:Sayers10-3-22-2;Worrall 7-1-19-2; 7 Fall:2263150 didnotbat Bowling: FirstInnings:Sayers27-3-82-4;Worrall 21.5-4-64-2; Mennie20-9-42-2; 9 didnotbat 0 9 Fall: 14194795132183206224235242 5 23 32 (360 min,87.5overs) Extras 2lb2w didnotbat NM Lyon bWorrall 20 TA Copeland notout lbwbSayers notout 3 notout PJ CumminsbSayers 14 57 11 cCareybWorrall MA StarcbSayers cCareybSayers 3 5 +PM NevilllbwbMennie 206 7 5 DP HughescFergusonbHead MC HenriqueslbwbZampa 1b2lb2w bWorrall KR PattersonbSayers 83 0 *SPD SmithlbwbSayers NJ MaddinsonbWorrall (327min,76.4overs) 6 DA Warner cCareybMennie 3 92 notout 2 New South Wales 2 4 0 Innings: Starc24.4-3-73-8;Cummins24-8-71-0;Copeland14-3-33-0;Lyon 14-2-26-2. bStarc Bowling: FirstInnings:Starc13-0-46-2;Cummins7-1-22-2;Copeland13.3-3-24-6.Second bStarc 10 Fall: 323547626366778492 64 2 36 (152 min,33.3overs) (6)cPattersonbStarc Extras 71 (7)cSmithbStarc 3 DJ Worrall notout 0 CJ SayerscHughesbStarc bStarc (8)lbwbStarc A ZampabCopeland 12 10 JM MenniecWarner bStarc bStarc +AT CareycMaddinsonbCopeland cNevillbStarc TLW 8 CooperbCopeland 15 JS LehmannlbwbCopeland lbwbLyon cSmithbLyon *TM HeadcCumminsbCopeland 0 30 CJ FergusoncMaddinsonbCopeland JB Weatherald cLyon bCummins JD DaltonbCummins Umpires: 1pt; NewSouthWales 7.42pts. Toss: New SouthWales wonby6wickets. At AdelaideOval,27-29October, 2017 SOUTH AUSTRALIA vNEWSOUTH WALES NewSouthWales. SouthAustralia SJNogajski&JDWard.

NSWBluesv. SouthAustralia Sheffi

eld Close ofplay: Player oftheMatch: Referee: Scorers: 4-145 (Ferguson0,Mennie0). (Hughes 30,Nevill5).Day2:SouthAustralia(2) Fall: 137139145155164176182200206 MHHarper&NARicketts. DJHarper.

Shield Day 1:NewSouthWales 5-153 MA Starc. who wascaughtbySmithatfi rstslip. completed withanexceptionaldeliverythatsquaredupJonoWells, the visitorslost10/44,headlinedbysecondhat-tricktoStarc(3-41), and Bancroft(86)posted179.However, inanunbelievablefi nalsession, In pursuitof395towin,Western AustralianopenersShaunMarsh(91) important 140-runthirdwicketpartnership. 127 from167deliveriesandcombinedwithKurtisPatterson(66)foran Smith wasagainoutstandinginthesecondinningswithamarvellous hat-tricks toStarc,takenintrademarkfashionwithatrioofyorkers. The visitorswerebowledoutfor176,highlightedbythefi rstofthetwo Lyon (1-39). Starc (4-56),JoshHazlewood(3-24),PatCummins(2-31)andNathan In response,Western AustraliafailedtonullifytheAustralianattackof The Bluesposted270battingfi rst,ledbytheimperiousSteveSmith(76). innings tohelpmakeittwofromfortheBlues. Starc collectedthefi nalthreewicketsineachoftheWestern Australian two hat-tricksinaSheffi eldShieldmatch. ,whenMitchellStarcbecamethefi rstmantotake History wascreatedduringthe171-runNewSouthWales victoryover 4-7 November2017–HurstvilleOval Round 2: NEW SOUTH WALES v WESTERN AUSTRALIA xrs1 l w1b92 l n 7 0 223 0 0 (329min,77.1overs) 2b4lb1nb 176 9 3 16 9 notout 5 Cummins 17-3-52-2; Henriques8-1-19-0. 0 Lyon 13-1-39-1.SecondInnings:Starc15.1-5-41-3; Hazlewood20-6-49-3;Lyon 17-5-56-2; Bowling: Starc20-6-56-4; Hazlewood13-3-24-3;Henriques4-0-20-0; Cummins 17-6-31-2; cNevillbStarc 6 bStarc 86 Fall: 897104134145 176 20 0 (286 min,67overs) cPattersonbLyon Extras 1b5lb2w1nb 9 cSmithbStarc 91 SP MackinbMAStarc 0 14 bHazlewood 1 DJM MoodylbwbMAStarc cNevillbHazlewood 2 lbwbLyon JP BehrendorffbStarc 0 52 JA RichardsoncHughesbCummins lbwbCummins DJM ShortcNevillbLyon 76 cNevillbHazlewood cPattersonbCummins JW Wells cNevillbStarc 0 2 AJ Turner cSmithbCummins *MR MarshbHazlewood 3lb4w2nb 300 HWR CartwrightlbwbHazlewood 14 6wktsdec 2 SE MarshcNevillbHazlewood +CT Bancroftnotout (279min,70overs) Western Australia 270 11 Richardson 20-0-77-2;Moody8-0-32-1;Mackin17-0-75-2;Short12-1-55-1. Moody 16-3-68-0;Cartwright7-1-20-1;Short5-0-19-0.SecondInnings:Behrendorff13-1-58-0; Fall:1442182267270281 didnotbat Bowling: FirstInnings:Behrendorff21-3-56-2;Richardson21.2-4-47-4;Mackin19-5-60-3; 1 didnotbat Fall: 635101105146166225254263270 27 45 2 (365 min,89.2overs) notout Extras 2w 22 NM Lyon cBancroftbRichardson 43 127 Behrendorff 66 JR HazlewoodcMRMarshb cBehrendorffbMackin notout cMoodybShort PJ Cumminsnotout 0 32 MA StarccWells bMackin 25 (1)cMackinbMoody 5 +PM NevillcBancroftbRichardson cBehrendorffbRichardson 16 cRichardsonbMackin DP HughescMoodybRichardson 36 76 MC HenriqueslbwbMackin KR PattersoncMackinbRichardson (2)cBancroftbRichardson *SPD SmithcWells bCartwright 5 NJ MaddinsonbMackin DA Warner cSEMarshbBehrendorff New South Wales Referee: Scorers: Umpires: 7.7pts; Western Australia1pt. Toss: New SouthWales wonby171runs. At HurstvilleOval,4-7November, 2017. Western Australia.NewSouthWales CLBennison&RLSanday. DTalalla. SAJ Craig&BNJOxenford NSWBluesv. Western Australia didnotbat 6 2-166 (Smith74,Patterson60). Wells 1).Day3:NewSouthWales (2) Western Australia4-102(Bancroft41, 7-254 (Nevill32,Cummins19).Day2: Close ofplay: Player oftheMatch: Fall: 179180185191203 207218222223 Day 1:NewSouthWales MA Starc. JLT Sheffi eld Shield Round 3: NSW Blues v. Queensland Round 4: NSW Blues v. Victoria 13-15 November 2017 – Allan Field 24-27 November 2017 – North Sydney Oval New South Wales continued its winning start to the season with proved the decision for Victoria to bat fi rst was correct a resounding six-wicket victory over Queensland inside three days. when he fi nished the fi rst day 213 not out and the visitors lost just three Veteran Doug Bollinger (3-38), with the experienced Trent Copeland wickets. (3-33) and Sean Abbott (1-42), united seamlessly with the off-spin of Victoria resumed at 3/365 and Maxwell continued his batting Nathan Lyon (3-59) to dismiss Queensland for 183 on the fi rst day. masterclass before he was eventually dismissed for an outstanding 278. In reply, it was Daniel Hughes in the relatively unfamiliar spot of In response to an enormous fi rst innings total of 9/562 declared, the No. 6, who starred for the visitors. Blues failed to pass the follow-on, bowled out for 243. Steve O’Keefe In his third consecutive match batting in the middle-order, Hughes remained 50 not out. played like someone who had been in that position his entire career, Victoria opted to bat again and declared late on day three at 3/148, before he ran out of partners and remained stranded on 98 not out. a massive 467 runs ahead. NSW took an 88-run lead into the second innings and Queensland was On the fi nal day, in partnership with Kurtis Patterson, nightwatchman immediately on the retreat when it lost former Australian opener Joe Sean Abbott was tenacious. He survived 175 deliveries before he Burns on the fi rst ball, lbw to Bollinger (3-66). departed for 47. The hosts were soon 2/5 when (1) also fell to Bollinger At the other end, Patterson persisted with the unusual strategy of and NSW was in pole position to take victory. refusing to run and exclusively occupying the one end. He made 61 In his fi rst match of the season, Abbott (4-65) led the way as the visitors from 135 balls which included 15 boundaries and just one single. dismissed Queensland for 215. As the day progressed, the plan to keep the left-handers at the southern The Blues reached the 128 required for victory within 31 overs with end of the ground reaped rewards. Queensland unable to dismiss Hughes (23 not out) during the match. Ed Cowan (40 not out) came in at No. 9, and together with Copeland David Warner (37) top-scored. (5 not out), negotiated a tense fi nal few overs to defy Victoria and hang on for the draw.

QUEENSLAND v NEW SOUTH WALES NEW SOUTH WALES v VICTORIA At Field, Albion, 13-15 Scorers: D O’Neill & CP Howard. At North Sydney Oval, 24-27 November, Referee: RL Parry. November, 2017. New South Wales Referee: DJ Harper. 2017. Match Drawn. Player of the Match: GJ Maxwell. won by 6 wickets. Player of the Match: DP Hughes. Toss: Victoria. New South Wales 1.73pts; Close of play: Day 1: Victoria 3-365 (Maxwell Toss: Queensland. Queensland 1pt. Close of play: Day 1: New South Wales 3-83 Victoria 4pts. 213, White 24). Day 2: New South Wales New South Wales 7.71pts. (Patterson 4). Day 2: Queensland (2) 5-129 Umpires: SD Fry & GC Joshua. 5-125 (Cowan 13, Nevill 1). Day 3: New South Umpires: PJ Gillespie & SA Lightbody. (Labuschagne 56no, Peirson 0no). Scorers: D Mattison & IE Wright. Wales (2) 2-46 (Maddinson 17, Abbott 0). Queensland Victoria MT Renshaw c Nevill b Copeland 16 (2) c Nevill b Bollinger 1 TJ Dean c Nevill b Bollinger 36 lbw b Bollinger 0 JA Burns c Nevill b Bollinger 2 (1) lbw b Bollinger 0 MS Harris c Hughes b Bollinger 9 not out 62 *UT Khawaja not out 78 c Hughes b Lyon 52 GJ Maxwell b O'Keefe 278 c Henriques b Copeland 16 M Labuschagne c Nevill b Copeland 6 b Abbott 88 *AJ Finch c Nevill b Henriques 76 c Larkin b Copeland 43 SJ Truloff c Smith b Bollinger 13 c Smith b Henriques 10 CL White (Cowan-Copeland) 66 not out 19 JD Wildermuth c Henriques b Copeland 27 lbw b Abbott 7 MW Short c Maddinson b O'Keefe 22 did not bat +JJ Peirson c Nevill b Bollinger 1 c Nevill b Abbott 2 +SE Gotch c Cowan b O'Keefe 0 did not bat MG Neser c Smith b Abbott 0 c Nevill b Copeland 31 CP Tremain not out 45 did not bat MJ Swepson b Lyon 16 c Patterson b Abbott 5 PM Siddle c Nevill b Abbott 5 did not bat BJ Doggett c Henriques b Lyon 4 b Bollinger 2 JM Holland b Abbott 9 did not bat LW Feldman c Bollinger b Lyon 8 not out 1 SM Boland did not bat did not bat Extras 10b 1lb 1nb 12 9b 4lb 1w 2nb 16 Extras 5b 7lb 1w 3nb 16 2lb 6w 8 (282 min, 71.3 overs) 183 (297 min, 67 overs) 215 (593 min, 140.5 overs) 9 wkts dec 562 (97 min, 21 overs) 3 wkts dec 148 Fall: 11 21 51 68 118 122 123 152 164 183 Fall: 0 5 91 114 128 140 193 200 205 215 Fall: 17 162 310 478 478 480 531 550 562 Fall: 0 37 106 Bowling: First Innings: Bollinger 15-3-38-3; Copeland 23-8-33-3; Lyon 22.3-5-59-3; Abbott Bowling: First Innings: Bollinger 30-4-146-2; Copeland 34-8-116-0; O’Keefe 35-6-128-3; Abbott 11-1-42-1. Second Innings: Bollinger 22-4-66-3; Copeland 14-6-25-1; Abbott 19-3-65-4; Lyon 28.5-3-112-2; Henriques 13-1-48-1. Second Innings: Bollinger 6-0-38-1; Copeland 9-1-52-2; 7-0-29-1; Henriques 5-0-17-1. O’Keefe 2-0-25-0; Abbott 3-0 24-0; Henriques 1-0-7-0. New South Wales New South Wales DA Warner c Swepson b Wildermuth 26 c Doggett b Feldman 37 DP Hughes c Maxwell b Tremain 44 b Holland 21 NJ Maddinson c Peirson b Neser 8 c Truloff b Feldman 24 NJ Maddinson c Gotch b Tremain 31 c Dean b Boland 32 *SPD Smith c Truloff b Wildermuth 44 b Doggett 9 NCR Larkin c & b Holland 11 b Tremain 8 KR Patterson c Peirson b Neser 12 not out 16 KR Patterson c White b Holland 16 (5) c Boland b Tremain 61 MC Henriques c Peirson b Feldman 36 lbw b Feldman 5 *MC Henriques b Holland 5 (6) c Dean b Holland 0 DP Hughes not out 98 not out 23 EJM Cowan c Finch b Holland 32 (9) not out 40 +PM Nevill c Khawaja b Swepson 17 did not bat +PM Nevill run out (Siddle) 25 c Gotch b Boland 8 TA Copeland c Swepson b Doggett 8 did not bat SNJ O'Keefe not out 50 c Gotch b Maxwell 22 SA Abbott run out (Labuschagne-Peirson) 15 did not bat TA Copeland lbw b Holland 8 (10) not out 5 NM Lyon c & b Neser 1 did not bat SA Abbott c Dean b Boland 9 (4) lbw b Finch 47 DE Bollinger run out (Swepson-Neser) 0 did not bat DE Bollinger c Dean b Boland 0 did not bat Extras 1lb 5nb 6 6lb 10w 16 Extras 5b 5lb 2nb 12 8b 4lb 12 (293 min, 70.2 overs) 271 (139 min, 30.5 overs) 4 wkts 130 (370 min, 92.5 overs) 243 (438 min, 119.5 overs) 8 wkts 256 Fall: 21 68 83 111 150 183 205 248 263 271 Fall: 72 81 81 87 Fall: 75 80 101 110 115 162 184 218 243 243 Fall: 31 46 87 161 161 181 181 215 Bowling: First Innings: Neser 16.2-3-58-3; Feldman 14-2-56-1; Wildermuth 13-3-53-2; Bowling: First Innings: Siddle 19-7-47-0; Tremain 11-3-30-2; Holland 33-13-67-5; Boland Doggett 14-3-53-1; Swepson 13-1-50-1. Second Innings: Neser 9.5-2-35-0; Feldman 12-1- 16.5-5-52-2; Short 5-0-17-0; White 5-0-14-0; Dean 2-1-2-0; Maxwell 1-0-4-0. Second 45-3; Doggett 9-3-44-1. Innings: Siddle 15-6-45-0; Tremain 18-9-47-2; Boland 23.5-9-66-2; Holland 34-19-36-2; Maxwell 18-9-42-1; White 4-3-4-0; Finch 6-5-4-1; Short 1-1-0-0. Cricket NSW Annual Report and Yearbook 2017/18 10-wicket win. Silk neededjusttwodeliveriestoscorethefourrunsrequiredfora healthy fi gures. former SydneyUniversityquick,(3-32),alsoreturned (4-40)fi nishedthematchwithsevenwicketsand Maddinson (39)wasthenextbestscoreforBlues. Peter Nevill(70),theBlueswerebowledoutfor184within79overs. follow-on andNSWagainsuccumbed.Despitetheresolveofcaptain The hostsrelentlesslypushedhometheadvantagebyenforcing target. Itwasthesecondfi ftyinasmanymatchesforO’Keefe. loss ofwicketscostNSWdearlyasitfell34runsshortthefollow-on centuries toEdCowan(67)andSteveO’Keefe(52notout),buttheearly The middletolowerordershowedsomeresistance,highlightedbyhalf- for ducks. opening fouroverswhichincludedbothNicMaddinsonandNickLarkin In reply, theNSWtop-ordercollapsed.TheBlueslost3/4in Doug Bollinger(2-82)wasthebestofBluesattack. Jordan Silkscored104from248deliveriesagainsthisformerstate. best possibleopportunityofvictory. fi nishedthesecondday4/392anddeclaredovernighttogiveit After rainwashedouttheentirefi rstdayofthematchTasmania 3-6 December2017–BelleriveOval Round 5: JLT xrs2 n l w10 26 1 184 9lb1w 0 5 8 (333min,78.5overs) 208 4 0 notout lbwbRogers 70 Rogers 18.5-6-32-3;Webster 10-1-27-0; Silk1-0-4-1. 0 0 2; Webster 17-5-35-1. SecondInnings:Bird19-7-40-4;Bell14-4-42-0;Rainbird16-6-30-2; cBellbRainbird 9 Bowling: FirstInnings:Bird20-3-65-3;Bell17-6-36-3; Rainbird18-8-33-1;Rogers17.5-6-37- 0 13 Fall: 2451134161195208 c&bRogers 39 (369 min,89.5overs) 17 cDoranbRogers 52 cWebster bBird Extras 2b3nb 9 67 HNA ConwaybRogers c&bSilk DE BollingerbBell SA AbbottcSilkbBird 38 cDoranbBird cDoolanbRainbird lbwbBird TA cWebster CopelandcBaileybRogers bBird 0 22 SNJ O'Keefenotout 2 0 *+PM NevillcBaileybWebster EJM CowanbBird KR PattersoncBirdbRainbird 0wkts4 NCR LarkincDoolanbBell 12 didnotbat NJ MaddinsonlbwbBell DP HugheslbwbBird didnotbat (1min,0.2overs) didnotbat New South Wales 4wktsdec392 21-4-100-0; O’Keefe16-1-77-1.SecondInnings:Copeland0.2-0-4-0. didnotbat 4 Bowling: FirstInnings:Bollinger22-6-82-2;Copeland31-12-58-0;Conway22-4-68-1;Abbott 0 didnotbat Fall: 92216232373 (446 min,112overs) didnotbat Extras 7lb5nb didnotbat 16 didnotbat GT Belldidnotbat 72 75 SL Rainbirddidnotbat JM Birddidnotbat TS Rogersdidnotbat didnotbat notout BJ Webster didnotbat notout 71 104 BR McDermottnotout 42 +MS Wade notout JR DoranbO’Keefe *GJ BaileycNevillbBollinger AJ DoolancNevillbConway JC SilklbwbBollinger Tasmania Scorers: Umpires: New SouthWales 0.38pts. Toss: Tasmania wonby10wickets At BelleriveOval,,3-6December, 2017. TASMANIA vNEWSOUTH WALES NewSouthWales. Tasmania 7.9pts.

GWHamley&LHayes. Sheffi SA Lightbody&PWilson. NSWBluesv. Tasmania

eld

Shield (Maddinson 36,Patterson4). 16). Day3:NewSouthWales (2)2-50 Tasmania 4-392(Wade 72,McDermott Close ofplay: Player oftheMatch: Referee: Fall: 14626672101119120162184 SR Bernard. Day1:Noplay. Day2: JM Bird Blues batsmantopassfi fty. down 169towinwithfourwicketsinhand.Cowan(55)wastheonly Western Australiaclaimed7/98todismissNSWfor179andchased Western Australiawhograspedcontrolonthethirdandfi nalday. NSW fi nisheddaytwoat3/77withthematchinbalance,butitwas four catchesandonestumping. Blues captainPeterNevillwasexcellentbehindthestumps.Heclaimed dismissal ofCartwright. Mickey Edwardsondebutclaimedhismaidenfi rstclasswicketwiththe home sidebyjust11runs. Cartwright (78),NSWclaimedthelastsevenwicketsfor68totrail Despite arecoverybyWestern Australiaearlyondaytwo,ledbyHilton got theDukesballtalking. At stumpsondayone,thehostswere2/17,asTrent Copeland(3-42) just onerunshortofahalf-. Daniel Hughesplayedapatientknockatthetopoforderandfell looked asthoughNSWwouldbuildasignifi canttotal. tide midwaythroughdayone,claimingthefi rstfourscalps,justwhenit rounder andWestern AustraliancaptainMitchMarsh(4-50)turnedthe The Blueswerebowledoutfor204onthefi rstday. Australianall- 8-10 February2018–WACA Ground Round 6: WESTERN AUSTRALIA vNEWSOUTH WALES 21mn 0oes 1 6wkts172 20 0 10 15b2lb3w didnotbat 215 15 0 22 (8)notout 9.3-1-44-1; Lyon 5-0-15-1;Edwards4-0-26-1. Fall:255993120 136160 10-3-39-1; Lyon 20-5-59-3.SecondInnings: Stobo8-1-48-1;Sandhu8-1-22-2;Copeland 36 Bowling: FirstInnings:Copeland19-7-42-3;Sandhu 11-2-30-0;Stobo10-3-32-3;Edwards 39 Fall: 3598147163173174194215 14 (7)notout didnotba (281 min,70overs) 4 0 22 Extras 9b4lb2w (6)stNevillbLyon 13 SP Mackinnotout 32 (4)cCopelandbSandhu 6 (5)cCopelandbEdwards AA BevilaquabLyon 29 8 JA RichardsoncLarkinbStobo didnotbat +JP InglisstNevillbLyon 25 4 (3)cCopelandbSandhu AJ Turner cNevillbCopeland 1 lbwbCopeland 179 *MR MarshcEdwardsbStobo 78 cCowanbStobo 0 SE MarshcNevillbLyon 38 HWR CartwrightcNevillbEdwards 1 ML KellycNevillbCopeland WG BosistocStobobCopeland 8 (278min,62.2overs) 8 CT BancroftcCowanbStobo 16b2lb7w 204 lbwbMackin Western Australia 22 6 55-0; Kelly15-6-25-4;Mackin17.2-5-43-6;MRMarsh10-2-34-0;Bevilaqua2-0-4-0. 14 Marsh 16-3-50-4;Bevilaqua10-3-21-1;Bosisto4-1-11-1.SecondInnings:Richardson18-3- 4 Fall:45458189136162167175179 Bowling: FirstInnings:Richardson18.2-6-30-1;Kelly16-4-34-2;Mackin18-5-42-1;MR 55 Fall: 4089104105157174188193194204 cSEMarshbKelly cInglisbMackin 0 (360 min,82.2overs) notout 2 4 16 Extras 6b10lb4w2nb cBevilaquabMackin 11 MW EdwardscBancroftbRichardson 6 cBancroftbMKelly 19 NM Lyon notout 25 16 cBevilaquabKelly CH StobocInglisbBevilaqua GS SandhucCartwrightbBosisto 46 TA Copelandc&bKelly lbwbMackin cTurner bKelly *+PM NevillcInglisbMackin cRichardsonbMackin 5 24 EJM CowancBancroftbKelly cInglisbMackin 49 MC HenriquescMackinbMRMarsh 13 KR PattersoncKellybMRMarsh DP HughescTurner bMRMarsh NCR LarkincTurner bMRMarsh New South Wales Umpires: 7.15pts; NewSouthWales 1.04pts. Toss: 2018. Western Australiawonby4wickets At WACA Ground,,8-10February, NewSouthWales. Western Australia SA Lightbody&AKWilds. NSWBluesv. Western Australia Wales (2)3-77(Patterson12,Cowan11). (Bancroft 7,Cartwright8).Day2:NewSouth Close ofplay: Player oftheMatch: Referee: Scorers: RLParry LW Catchpole&SAWheeler. Day 1:Western Australia2-17 SP Mackin. Round 7: NSW Blues v. South Australia Round 8: NSW Blues v. Tasmania 16-19 February, 2018 – Sydney Cricket Ground. 24-27 February 2018 – Sydney Cricket Ground The Blues return to their spiritual home at the SCG was a very Moises Henriques returned to form with a commanding century. The signifi cant one for Ed Cowan, as he passed the magnifi cent milestone Blues all-rounder was back to his powerful best at the SCG and fi nished of 10,000 fi rst class runs late on day two. day one 116 not out at stumps. He went on to make a magnifi cent 131 Debutant leg-spinner Dan Fallins claimed his maiden Sheffi eld Shield not out from 183 balls. wicket on day two and fi nished with fi gures of 4-102 for the match. The innings included 14 boundaries and one six. It was his seventh fi rst Daniel Hughes (93) and Kurtis Patterson (89) were the shining lights class ton. for NSW on an otherwise diffi cult day one. The Blues were bowled NSW captain Peter Nevill declared at 8/449 just before lunch on day out for 256. two. Nick Larkin (85), Ed Cowan (68) and Kurtis Patterson (72) all made Despite the milestones, day two represented a missed opportunity half-centuries for the Blues. for the Blues. Trent Copeland (4-63) put NSW in a prime position and The progress of the match was frustrated by rain over the next two the visitors were at one stage 7/141. days. However, South Australia fought back courtesy of a vital 96-run eighth The highlights were few and far between for NSW. Tasmania defi ed the wicket partnership between centurion (105 not out) and No. interruptions to fi nish day three at 2/240, courtesy of a tenacious 179- 9 (50). run partnership between centurion (136) and Cooper guided South Australia to an unlikely 25-run lead on the fi rst (97) which ultimately ensured a draw was inevitable. innings and, for the third consecutive match, NSW faltered with the bat. The stand ended early on day four when a surprise switch to off-spin by Nick Winter (5-61) caused carnage with the swinging ball to fi nish the Gurinder Sandhu (2-121) dismissed Webster. match with 10-109. NSW lost its last seven wickets for 68 to be bowled Former Australian and Victorian wicketkeeper also out for 213. made 108 not out before Tasmania declared at 4/489 on the fi nal day to South Australia resumed day four at 3/146 and completed the job early draw the game. Steve O’Keefe (2-80) was the best of the Blues bowlers. on day four.

NEW SOUTH WALES v SOUTH AUSTRALIA NEW SOUTH WALES v TASMANIA At Sydney Cricket Ground, 16-19 February, Referee: SR Bernard. At Sydney Cricket Ground on 24-27 February, Referee: PL Marshall. 2018 South Australia won by 7 wickets. Player of the Match: NP Winter. 2018. Match Drawn. Player of the Match: BJ Webster. Toss: New South Wales. New South Wales Close of play: Day 1: New South Wales Toss: New South Wales. New South Wales Close of play: New South Wales 1.56pts; South Australia 7.81pts. 256 all out. Day 2: New South Wales (2) 3.25pts; Tasmania 2.3pts. 5-392 (Henriques 116, Nevill 5). Day 2: Umpires: GC Joshua & BM White. 1-61 (Hughes 32, Cowan 16). Day 3: South Umpires: SJ Nogajski & JD Ward. Tasmania 1-79 (Webster 31, Bailey 34). Scorers: TJ Lorraine & CG Wilcoxon. Australia (2) 3-146 (Ferguson 35, Mennie 2). Scorers: CL Bennison & TJ Lorraine Day 3: Tasmania 2-240 (Webster 102, Doran 86). New South Wales NCR Larkin c Nielsen b Worrall 19 lbw b Winter 3 New South Wales DP Hughes c Ferguson b Cooper 93 c Nielsen b Worrall 41 NCR Larkin c Webster b Rogers 85 EJM Cowan lbw b Winter 1 c Ross b Worrall 27 DP Hughes c Wade b Milenko 22 KR Patterson b Winter 89 c Cooper b Winter 41 EJM Cowan c Bailey b Freeman 68 MC Henriques lbw b Winter 1 c & b Worrall 26 KR Patterson b Rogers 72 *+PM Nevill c Nielsen b Worrall 1 c Nielsen b Winter 13 MC Henriques not out 131 WER Somerville c Ferguson b Mennie 0 b Winter 3 NJ Maddinson c Doolan b Rogers 9 TA Copeland b Winter 10 lbw b Andrews 23 *+PM Nevill b Rainbird 5 DG Fallins not out 6 b Winter 10 SNJ O'Keefe c Doran b Fekete 0 CH Stobo b Mennie 5 not out 1 TA Copeland c McDermott b Rogers 41 MW Edwards b Winter 1 c Dalton b Worrall 0 GS Sandhu did not bat Extras 5b 9lb 12w 4nb 30 7b 6lb 10w 2nb 25 HNA Conway did not bat (385 min, 90.4 overs) 256 (293 min, 68.4 overs) 213 Extras 4b 3lb 2w 7nb 16 Fall: 59 66 183 194 203 205 240 241 251 256 Fall: 11 87 90 145 159 168 179 202 207 213 (442 min, 106.5 overs) 8 wkts dec 449 Bowling: First Innings: Worrall 23-7-59-2; Mennie 22-3-74-2; Winter 25.4-9-48-5; Fall: 52 167 185 341 363 392 393 449 Cooper 5-3-12-1; Andrews 15-0-49-0. Second Innings: Worrall 20.4-4-55-4; Winter 24-5-61- Bowling: First Innings: Fekete 21-2-77-1; Rogers 20.5-3-88-4; Rainbird 24-3-118-1; 5; Mennie 13-2-44-0; Andrews 10-2-35-1; Cooper 1-0-5-0. Milenko 15-2-49-1; Freeman 22-1-92-1; Webster 4-0-18-0. South Australia Tasmania JD Dalton b Copeland 20 st Nevill b Fallins 29 BJ Webster c Copeland b Sandhu 136 JB Weatherald lbw b Stobo 37 c Stobo b Edwards 56 AJ Doolan c Larkin b Sandhu 9 *CJ Ferguson c Larkin b Copeland 1 not out 49 *GJ Bailey b O'Keefe 34 JS Lehmann c Hughes b Edwards 22 c Somerville b Stobo 10 JR Doran c Nevill b O'Keefe 97 TLW Cooper not out 105 did not bat +MS Wade not out 108 AI Ross c Stobo b Copeland 17 did not bat BR McDermott not out 75 +HJ Nielsen c Nevill b Copeland 1 did not bat SA Milenko did not bat JM Mennie c & b Fallins 5 (5) not out 26 TS Rogers did not bat TD Andrews b Fallins 50 did not bat SL Rainbird did not bat DJ Worrall st Nevill b Fallins 0 did not bat AL Fekete did not bat NP Winter c Nevill b Edwards 1 did not bat JA Freeman did not bat Extras 18lb 3w 1nb 22 11b 1lb 9w 1nb 22 Extras 14b 11lb 2w 3nb 30 (321 min, 74.1 overs) 281 208 min, 49.4 overs) 3 wkts 192 (610 min, 160.4 overs) 4 wkts 489 Fall: 42 46 78 88 128 130 141 237 237 281 Fall: 63 122 141 Fall: 18 80 259 337 Bowling: First Innings: Copeland 25-8-63-4; Stobo 17-1-74-1; Somerville 10-0-27-0; Edwards Bowling: First Innings: Copeland 32-4-85-0; Sandhu 40-7-121-2; Conway 26-4-81-0; O’Keefe 13.1-3-48-2; Fallins 9-1-51-3. Second Innings: Copeland 16-3-39-0; Stobo 8-1-39-1; Edwards 40-10-80-2; Cowan 14-0-62-0; Maddinson 6-1-35-0. 12-2-40-1; Fallins 7.4-1-51-1; Somerville 6-1-11-0. Cricket NSW Annual Report and Yearbook 2017/18 After thematchEdCowanannouncedhisretirementfromprofessionalcricket. excruciating 24runsshortofvictory. The Blueslost5/44,anditslastfourwicketsforjust11,tofallan his stumpsandKurtisPatterson(53)wasrunout. batsmen weredismissedinbizarrecircumstances.Hughes(59)trodon Unfortunately, itallfellapartforNSWondayfour. TheBlues’twokey strongly at2/150. an inningsduringthematchtosecurevictory, andfi nisheddaythree NSW neededtobecometheonlyteamscoremorethan300runsin complete hisfourth10-wickethaulinfi rstclasscricket. Trent Copeland(5-59)ledthecharge.O’Keefealsocollected2-75to openers. Travis Deanmade106inatotalof280. Once againVictoria anchoreditssecondinningsaroundoneof was topscorerinadisappointing171. The Blues’batsmenstruggledintheirfi rstinnings.KurtisPatterson(43) Harris made109forthehosts. career bestfi guresof8-77.Thehostswerebowledoutfor199.Marcus Steve O’Keefe,whobewilderedtheVictorian battingordertotake who becamethethirdplayertodebutforNSWduringseason. signifi canceforAustralianUnder19World Cupall-rounder, ParamUppal, The matchatthenewly-developedJunctionOvaltookonextra 3-6 March2018–JunctionOval Round 9: JLT xrs4 l b8b12 0 285 4b8lb 5 6 (415min,101.5overs) 171 3 notout 2; Maxwell10-1-32-0;Boland 24-6-34-0;FawadAhmed24.5-0-94-5; White 1-0-3-0. 49 0 Ahmed 13.1-4-32-3;Boland 10-4-18-2.SecondInnings:Siddle21-3-56-2; Tremain 21-3-54- Bowling: FirstInnings:Siddle 11-3-39-2;Tremain 10-3-37-2;Maxwell11-1-39-1;Fawad cGotchbFawadAhmed Fall: 829515485111 112 154171 (6)bTremain 59 (215 min,55.1overs) 29 4 24 Extras 4b2lb 53 HNA Conwaynotout 6 (5)lbwbSiddle 45 SNJ O'KeefecMaxwellbFawadAhmed 24 20 TA CopelandlbwbBoland 22 hitwicketbSiddle (10)bFawadAhmed *+PM NevillcDeanbFawadAhmed 30 0 P UppallbwbSiddle stGotchbFawadAhmed runout(Maxwell) cWhitebFawadAhmed MC HenriqueslbwbBoland 5 43 2 280 2 SA AbbottcHarrisbFawadAhmed KR PattersoncMaxwellbTremain EJM CowancWhitebMaxwell (9)bHenriques 16lb2w2nb 13 DP HughesbTremain (400min,103.1overs) 28 7 NCR LarkinlbwbSiddle 199 0 New South Wales 25 Abbott 20-3-59-2;Conway11-1-32-0;Henriques11-2-26-1;Uppal5-0-13-0. (12)notout 14-4-40-0; Abbott8-1-30-1.SecondInnings:O’Keefe32-4-75-2;Copeland24.1-9-59-5; 1 Bowling: FirstInnings:Copeland11-4-18-0;Conway10-2-28-1;O’Keefe32.4-7-77-8;Uppal 9 Fall: 37537175125161176184197199 4 (11)bO'Keefe 14 (266 min,75.4overs) (8)bO'Keefe 4 Extras 5b1lb1w 33 4 DT Christian (10)cO'KeefebCopeland bCopeland bCopeland 106 4 Fawad Ahmednotout 7 28 23 SM BolandcNevillbO'Keefe PM SiddlecUppalbO'Keefe lbwbCopeland CP Tremain cConwaybO'Keefe retiredhurt 0 +SE GotchcNevillbAbbott 2 lbwbAbbott cLarkinbAbbott cLarkinbCopeland CL WhitelbwbO'Keefe 8 6 109 *AJ FinchcHenriquesbO'Keefe WJ PucovskicAbbottbO'Keefe GJ MaxwellcPattersonbO'Keefe MS HarriscNevillbConway TJ DeancNevillbO'Keefe Victoria Scorers: Umpires: Wales 1pts Toss: Victoria wonby23runs At JunctionOval,StKilda,3-6March,2018. VICTORIA vNEWSOUTH WALES Victoria. Victoria 7pts;NewSouth

JA Howard&MKWalsh. GAAbood&SALightbody. Sheffi NSWBluesv. Victoria

eld

Shield ()cSdl rmi 23 26 (8)cSiddlebTremain 8 (7)stGotchbFawadAhmed 0 (Hughes 59,Patterson34). 0). Day3:NewSouthWales (2)2-150 5). Day2:Victoria (2)5-156(Dean64,Siddle South Wales 4-65(Patterson22,Henriques Close ofplay: Player oftheMatch: Referee: Fall: 8389157180199241 274280284285 Fall: 4589397156211252256278280 D Talalla. Close ofplay:Day1:New SNJ O’Keefe batsman tomakefi ftyinanotheragonisingloss. consistent wicketscruelledtheirhopes.Nevill(53)wastheonly Although theBluesgavetargetared-hotcrack,lossof Larkin wasadjudgedlbwsecondballoftheinningsandNSW1/0. In pursuitof280forthewin,chasestartedterriblyNSW. Nick the match. Copeland (4-94)againstarredwiththeballtofi nishwithninescalpsfor Charlie Hemphrey(101)added246tohelpQueensland9/438declared. The Bluesposted402andledby159,butMarnusLabuschagne(134) class scoreduringa132-runeighthwicketpartnershipwithhisskipper. Abbott defied hisstatusasatail-endbatsmanandpostedhighestfi rst keen tobuildonthatlead. However, captainPeterNevill(57)andseamerSeanAbbott(79)were the scoreto6/251withBluesholdingaslenderlead. from NicMaddinson,whoplundered87just63deliveries,moving NSW seizedthemomentumondaytwowithaswashbucklinginnings out for243. Copeland fi nishedtheinningswith5-74andQueenslandwasbowled which returned5-55. day one.Hebowled21oversunchangedduringthefi rsttwosessions On his32ndbirthday, Trent Copelandproducedanunbelievablespellon 14-17 March2018–NorthDaltonPark,Wollongong Round 10: NEW SOUTH WALES vQUEENSLAND N owyntot ntot 5 10 243 18 (208min,46.5overs) 20 3b3lb1w3nb 402 notout 26 53 lbwbSwepson 2 9-0-43-3; Doggett9.5-1-51-2; Wildermuth8-0-54-2;Steketee9-1-39-1; Swepson11-1-50-2. 3 12 Steketee 27.2-5-79-3;Swepson 18-3-97-3;Labuschagne5-0-17-0.Second Innings:Neser cPeirsonbSwepson 20 Bowling: FirstInnings:Neser 25-7-45-3;Doggett25-4-92-0;Wildermuth 17-5-50-1; 79 0 Fall 7174111191235 251 252384392402 cHemphreybWildermuth cBurnsbDoggett 29 27 34 (472 min,117.2overs) 1 57 cLabuschagnebNeser Extras 15b7lb1w3nb 15 23 HNA Conwaynotout cWildermuthbDoggett SNJ O'KeefebNeser 9 87 SA AbbottlbwbNeser lbwbNeser TA CopelandlbwbSwepson lbwbWildermuth bSteketee *+PM NevillbSteketee 34 27 17 bNeser 45 P UppallbwbSwepson 28 NJ MaddinsonbWildermuth (1)bCopeland MC HenriquescHemphreybNeser KR PattersoncBurnsbSwepson (489min, 8 10lb6w6nb5pen DP HughescPeirsonbSteketee 243 21 NCR LarkinbSteketee 45 New South Wales 28 Abbott 20.1-3-81-0;O’Keefe28-2-88-1;Uppal11-1-27-0;Henriques4-0-20-2. runout(Maddinson) 13 16-1-55-1; Henriques6-1-21-0.SecondInnings:Copeland39.3-9-94-4;Conway24-5-80-1; 0 didnotbat 4 Bowling: FirstInnings:Copeland29-3-74-5;Conway15-0-49-2;O’Keefe10.3-1-30-2;Abbott 15 0 Fall: 105087115117191238239243 134 (324 min,76.3overs) cCopelandbHenriques Extras 14lb4w3nb bHenriques 101 55 24 notout LD Pfeffer 16 0 BJ DoggettcLarkinbO'Keefe bO'Keefe bCopeland MJ Swepsonnotout 11 1 MT SteketeecCopelandbO'Keefe bCopeland MG NesercO'KeefebAbbott 17 lbwbConway lbwbCopeland *+JJ PeirsoncMaddinsonbCopeland 13 8 97 JD WildermuthbCopeland SD HeazlettlbwbCopeland CR HemphreycCopelandbConway M LabuschagnebCopeland JA BurnscHughesbConway MT RenshawbCopeland Queensland Scorers Umpires: 2.58pts; Queensland7.13pts. Toss: 14-17 March,2018.Queenslandwonby36runs. At NorthDaltonPark,Towradgi, Wollongong, NewSouthWales. NewSouthWales : CGWilcoxon&IEWright.. PJ Gillespie&SJNogajski. NSW Bluesv. Queensland 95, Heazlett4). Day 3:Queensland(2)3-315(Hemphrey South Wales 7-382(Nevill52,Abbott79). 0-41 (Larkin19,Hughes17).Day2:New Close ofplay:Day1: Player oftheMatch: Referee: Fall: 0406472125131156 191226243 Fall: 3253299325348354388429438 PLMarshall. 2. vr)9 126.4 overs) MLabuschagne. New SouthWales wkts dec438 JLT Sheffi eld Shield Statistics

2017/18 BUPA SHEFFIELD SHIELD POINTS TABLE Team Played Won Drawn Lost Points Queensland 10 6 3 1 55.00 Tasmania 10 5 2 3 47.55 Victoria 10 3 5 2 39.91 Western Australia 10 3 2 5 37.09 New South Wales 10 3 2 5 34.37 South Australia 10 2 2 6 29.04 2017/18 SHEFFIELD SHIELD PERFORMANCES BATTING M Inn NO Runs HS 50 100 Avge Ct St KR Patterson 10 19 1 672 89 5 - 37.33 5 - DP Hughes 10 19 3 661 98* 4 - 41.31 6 - PM Nevill 10 17 1 396 70 3 - 24.75 30 4 MC Henriques 9 17 2 374 131* - 1 24.93 4 - EJM Cowan 6 11 1 347 68 3 - 34.70 3 - NJ Maddinson 7 13 - 307 87 1 - 23.62 4 - SPD Smith 3 6 - 268 127 1 1 44.67 7 - NCR Larkin 7 13 - 239 85 1 - 18.38 7 - DA Warner 3 6 - 188 83 1 - 31.33 1 - SA Abbott 5 9 - 187 79 1 - 20.78 1 - SNJ O'Keefe 5 9 2 184 52* 2 - 26.29 2 - TA Copeland 9 15 3 172 41 - - 14.33 7 - MA Starc 2 3 1 80 43 - - 40.00 - - P Uppal 2 4 - 72 24 - - 18.00 1 - PJ Cummins 2 2 1 36 27* - - 36.00 1 - DE Bollinger 3 4 1 26 26* - - 8.67 1 - GS Sandhu 2 2 - 20 14 - - 10.00 - - NM Lyon 4 5 1 19 6* - - 4.75 1 - MITCHELL STARC DG Fallins 1 2 1 16 10 - - 16.00 1 - CH Stobo 2 4 1 16 8 - - 5.33 3 - MW Edwards 2 4 - 13 8 - - 3.25 1 - HNA Conway 4 6 4 8 5* - - 4.00 1 - JR Hazlewood 1 1 - 6 6 - - 6.00 - - WER Somerville 1 2 - 3 3 - - 1.50 1 -

BOWLING M Overs Mdns Runs Wkts Avge Best 5wi 10wm TA Copeland 9 344 89 863 34 25.38 6-24 3 - SNJ O'Keefe 5 196.1 31 580 19 30.53 8-77 1 1 MA Starc 2 72.5 14 216 17 12.71 8-73 1 1 NM Lyon 4 98.3 18 283 13 21.77 3-59 - - DE Bollinger 3 95 17 370 11 33.64 3-38 - - SA Abbott 5 147 19 568 11 51.64 4-65 - - JR Hazlewood 1 33 9 73 6 12.17 3-24 - - PJ Cummins 2 65 18 176 6 29.33 2-22 - - CH Stobo 2 43 6 193 6 32.17 3-32 - - MW Edwards 2 39.1 8 153 5 30.60 2-48 - - MC Henriques 9 52 5 178 5 35.60 2-20 - - HNA Conway 4 108 16 338 5 67.60 2-49 - - DG Fallins 1 16.4 2 102 4 25.50 3-51 - - GS Sandhu 2 59 10 173 4 43.25 2-22 - - P Uppal 2 30 5 80 - - - - - WER Somerville 1 16 1 38 - - - - - EJM Cowan 6 14 - 62 - - - - - DANIEL HUGHES NJ Maddinson 7 6 1 35 - - - - - Cricket NSW Annual Report and Yearbook 2017/18 NSW MOST APPEARANCES i ECUC 5 7 826 1 3.8 --3 - 36 - - - 35.78 114 2362 8 74 50 Jim DECOURCY ae EL 3 41 5118 27 - 8 45 83 - - - 22.70 108 1521 17 84 53 James KELLY onDSN 4101 7321 42 1 60 - 7 - 78 1-0 46.00 1 44.27 241 6773 17 170 94 John DYSON i UK 7151 9120 53 0 24 -02 - 27 6-60 32.46 60 45.36 220 3901 19 105 67 - 83 8-97 30.67 293 26.61 101 2582 14 111 78 Johnny MARTIN rvrCAPL 1 9 6110 35 8 27 -23 - 30 4-12 22.74 58 33.51 150 2681 9 89 51 o ART 6 8 9213 16 15 34 -53 - 38 6-55 23.48 125 21.68 163 1952 8 98 56 rvrBYIS 8 61 0013 55 8 65 -44 - 41 4-64 26.50 8 35.58 163 3060 10 96 58 - 35 5-41 29.42 82 44.66 247* 4869 6 115 74 Tommy ANDREWS rn OEAD6 01 35161.1212.989 7- 57 8-92 27.29 231 17.91 106 1325 16 90 62 Trent COPELAND lyrMInN usH veWt veBs tSt Ct Best Avge Wkts Avge HS Runs NO Inn M Player rhrMRI 0 7 6023 38 1200 - 3 - 30 1-5 200.00 1 63.83 253 4660 4 77 50 Arthur MORRIS letHPIS 2 5 4728 04 16 56 -73 - 30 5-17 25.67 126 30.46 218 2437 5 85 52 Albert HOPKINS lnKPA 7151 0535 72 3 39 -63 - 35 4-66 63.92 13 67.27 315* 8005 16 135 87 Alan KIPPAX rhrMIE 7 93 85 6 46 34 76 -17 - 74 8-81 27.68 334 14.64 66 - 835 54 32 7-31 89 - 21.45 67 273 57 33.16 122* 1-6 Arthur MAILEY 10.00 2753 1 17 100 31.12 127 72 4171 8 Alan DAVIDSON 142 76 arnBRSE 3121 4925 30 - 8- 48 - - - 53.04 235 6419 11 132 83 Warren BARDSLEY an ODWRH 8 31 35 479 18 21 -12 - 26 7-41 32.14 188 7.98 34 375 16 63 58 tnMCB 5 9 5629 42 0 88 -63 - - 38 32 5-36 3-20 28.86 - 31.76 60 39 54 54.23 54.40 229* 7-130 200 26.49 4556 35 4733 5 4 61.73 89 306 91 55 56 5309 9 95 Stan McCABE 58 tv IO 17152 2918 50 - -- 4 49 249 - - - 25.09 128 3229 26 155 107 y RGR 116 3921 16 - 0- 50 - - - - - 41.63 201 42 93 5329 6-64 6-51 33.07 8 31.54 3573 87 136 9.74 81 56* 48.24 216* 789 6946 32 Syd GREGORY 15 113 159 90 93 Stuart MacGILL Steve WAUGH tatCAK6 02 4 21.6282.685 9- 19 8-58 29.36 228 - 14.26 59 62 4-20 941 41.05 - 102 24 73 35.14 90 183* - 69 3690 - 18 - 123 73 36.30 184 4610 Shane LEE 4 131 77 Steve SMALL tv ’EF 98 111 92.2182.487 6- 26 8-77 24.94 188 26.72 99 1710 21 85 59 Steve O’KEEFE itrTUPR 313 8322 10 3 49 -25 - 51 4-32 34.96 33 51.07 292* 5823 9 123 73 Victor TRUMPER ef AIS 7111 0517 40 6 38 -35 - 59 6-43 33.81 86 34.05 127 3065 11 101 57 Geoff DAVIES ef ASN15122 53 4 42 35 33 -15 - 51 - 6-31 23.37 118 395 8-52 14.23 28.65 74 417 1523 37.98 184 25 6266 132 115 35 200 135 Geoff LAWSON Greg MATTHEWS rhm HMS 815 3129 43 - 1- 61 - - 63 - - 4-18 40.29 14 44.39 229 32.17 4351 176 7 4085 105 5 68 132 72 a RI 5 3 3923 33 - 2- 22 - - - 43.32 213* 3379 5 83 55 et ILR 0 8 5824 70 19 53 -22 - 29 7-12 25.36 119 57.06 214 3538 6 68 50 er ’EFE 5 93 80 1 72 21 70 -95 - 53 6-49 27.05 211 27.24 81* 1880 30 99 65 Kerry O’KEEFFE ahnBAKN5 62 7 31.0102.0741 - 15 7-4 25.60 190 17.10 63 872 25 76 58 omONIL 0151 4923 26 6 51 -04 - 40 4-40 35.15 46 52.61 233 5419 12 115 70 Norm O’NEILL i ADNO 211539 5 29 77 -04 - 45 2-10 57.75 4 32.94 154 3492 5 111 62 Nic MADDINSON oe IHRS5 5420 6 86 - --2 - 23 - - - 28.64 164 2606 4 95 52 Corey RICHARDS hre ELWY 7 01 0118 78 25 38 -54 - 43 7-35 23.89 215 37.88 168 3031 10 90 57 Charles KELLEWAY hri AATE 1131 5121 07 18 34 -53 - 32 7-85 23.41 148 50.73 221 5581 13 123 81 Charlie MACARTNEY ai REMN 4 21 62 4 33 19 02 -91 - - 17 23 8-49 30.28 7-33 159 30.48 190 13.38 54* 8.44 26 602 17 380 62 26 54 71 54 David FREEDMAN Dave RENNEBERG ogBLIGR8 0 3404*82 9 81 -73 - 34 6-47 28.16 290 8.28 41* 480 43 101 89 Doug BOLLINGER ikWLHM 8111 2716 43 - --3 - 33 - - - - 39 44.30 6-30 166 32.08 203 4297 14 24.20 101 111 68 2106 20 107 Dirk WELLHAM 71 David COLLEY ogWLES13292 6223 18 1 50 -35 - 54 7-63 35.00 119 41.84 253 6612 21 279 103 Doug WALTERS ogFR 3 52 55 6 29 - 1057 120 - - - - 38 3-52 12.97 48.25 36* 32 545 44.94 23 261* 65 4224 63 16 110 64 Doug FORD Dominic THORNELY ebeCLIS 28 5 62 8 47 1 3.722 3 - 36 2-21 34.37 16 44.71 282 3622 5 86 52 ar ONN 8121 0610 28 4 40 -42 - 21 3-14 34.07 24 32.89 160* 3026 10 102 58 Harry DONNAN uryBNET 2 02 25 9 43 11 87 -23 - 37 6-32 28.72 131 24.30 59* 1215 20 70 52 akTYO 1012 9719 14 - 12- 132 - - - 54 - - 3-6 124 59.50 4-130 41.40 24 41.10 199 60 63.33 6997 216 53.27 3 229* 9309 172 8416 36 100 24 183 105 182 108 Mark TAYLOR Michael BEVAN Mark WAUGH ieWINY 4 63 31 8 58 34 73 -54 - 41 7-75 27.33 314 5.84 28* 321 31 86 94 akONIL 8 31 0418 04 4 94 -72 - 25 3-47 49.44 34 40.45 178* 3074 17 93 58 Mark O’NEILL - 45 - - - - 67 39.23 204 7-44 23.38 5257 230 4 49.58 281 138 74 5653 10 124 Michael SLATER 77 Monty NOBLE ossHNIUS6 91 14253.07 35 -72 - 28 5-17 33.51 70 36.30 265 3194 11 99 61 Moises HENRIQUES a IDAL 0 1 1014 11 16 27 -53 - 32 7-45 22.70 196 21.11 134* 1140 7 61 50 Ray LINDWALL e ORR5 21 85133.552.041 9- 29 4-13 29.40 5 36.65 163 2895 13 92 54 ilORIL 4 12 76 7 22 35 65 -13 - 38 9-41 16.52 325 12.22 47 746 20 81 54 Bill O’REILLY rn RDL 6 5 3016 58 5 58 - 4 - 41 3-1 35.80 5 35.80 196 3360 4 95 56 Frank IREDALE rdHDI 6112 89144.4---2325 293 - - - 41.94 154 5829 22 161 96 ikMCSE 9101 9818 87 2 20 -8 0 - 106 165 105 - 2-28 72.00 - - 2 106 - 48.76 - 168 7-18 26.01 63 23.23 5998 322 129 2-53 17 37.08 2393 72.16 158 140 6 12 79 4116 115 43.57 10 82 177 121 Rick McCOSKER 5577 86 18 Bert OLDFIELD 146 93 Richie BENAUD Brian BOOTH o IPO 7161 3739 31 9 24 -7 0 - 102 - 5-37 42 42.46 79 9-83 31.64 53.17 228 359 35 11.44 5317 53 207 16 - 618 116 67 - 19 73 - 68 Bob SIMPSON 16.54 109 Bob HOLLAND 1489 21 111 73 Brian TABER rdMNMR 9 31 1517 77 16 68 -33 - 35 6-43 26.83 116 27.78 137* 2195 14 93 59 Brad McNAMARA e ACE 4 41 36 1 91 23 60 -12 - 20 8-41 26.07 203 9.15 51* 366 14 54 54 ee HLOT 2 91 3916 44 13 10 -34 - 42 7-53 31.07 153 34.46 156 2309 12 79 52 Peter PHILPOTT hlEEY10194 2410 60 -- - 3 46 332 - - - 26.06 100* 3284 43 169 120 ee EIL7 1 137 3*4.7---2617 216 - - - - - 42.07 53 235* 58 - 3870 - - 21 - 113 - 71 - 39.08 158 41.31 240* Peter NEVILL 4572 5659 11 5 128 76 142 77 Peter TOOHEY Phil JAQUES

First

Class

Records TRENT COPELANDCELEBRATES AWICKET STEVE SMITHCOVER DRIVES LEADING RUN SCORERS Batsman M Inn NO Runs 100s Avge Michael BEVAN 105 183 36 9309 37 63.33 Mark WAUGH 108 182 24 8416 25 53.27 Alan KIPPAX 87 135 16 8005 32 67.27 Mark TAYLOR 100 172 3 6997 17 41.40 Steve WAUGH 93 159 15 6946 22 48.24 John DYSON 94 170 17 6773 14 44.27 Doug WALTERS 103 279 21 6612 19 41.84 Warren BARDSLEY 83 132 11 6419 20 53.04 Greg MATTHEWS 135 200 35 6266 9 37.98 Rick McCOSKER 79 140 17 5998 19 48.76 Victor TRUMPER 73 123 9 5823 15 51.07 41 69 10 5813 21 98.52 Brad HADDIN 96 161 21 5829 11 41.94 Monty NOBLE 77 124 10 5653 19 49.58 Charlie MACARTNEY 81 123 13 5581 22 50.73 Brian BOOTH 93 146 18 5577 11 43.57 Phil JAQUES 77 142 5 5659 14 41.31 Norm O’NEILL 70 115 12 5419 18 52.61 Syd GREGORY 81 136 8 5369 11 41.63 Bob SIMPSON 67 116 16 5317 15 53.17 Simon KATICH 58 95 9 5309 15 61.73 Michael SLATER 74 138 4 5257 13 39.23 Tommy ANDREWS 74 115 6 4869 11 44.66 Sid BARNES 56 91 4 4733 19 54.40 Arthur MORRIS 50 77 4 4660 17 63.83 Steve SMALL 77 131 4 4610 7 36.30 Peter TOOHEY 76 128 11 4572 11 39.08 Stan McCABE 55 89 5 4556 9 54.23 Grahame THOMAS 68 105 7 4351 15 44.39 Dirk WELLHAM 68 111 14 4297 9 44.30 Alan TURNER 76 142 8 4171 4 31.12 Dominic THORNELY 64 110 16 4224 10 44.94 PETER NEVILL Richie BENAUD 86 121 10 4116 9 37.08 Jim BURKE 67 105 19 3901 9 45.36 Peter NEVILL 71 113 21 3870 9 42.07 Greg MAIL 65 120 5 3745 8 32.57 Shane LEE 73 123 18 3690 7 35.14 Herbie COLLINS 52 86 5 3622 14 44.71 Keith MILLER 50 68 6 3538 10 57.06 Nic MADDINSON 62 111 5 3492 6 32.94 Ian CRAIG 55 83 5 3379 7 43.32 Phil HUGHES 38 69 5 3360 10 52.50 Frank IREDALE 56 95 4 3360 5 35.80 Phil EMERY 120 169 43 3284 1 26.06 Steve P D SMITH 39 69 7 3264 10 52.65 Steve RIXON 107 155 26 3229 6 25.03 Moises HENRIQUES 61 99 11 3194 7 36.30 49 80 6 3178 8 42.94 Michael CLARKE 45 80 7 3164 11 43.34 Mark O’NEILL 58 93 17 3074 8 40.45 Geoff DAVIES 57 101 11 3065 5 34.05 Trevor BAYLISS 58 96 10 3060 5 35.58 Charles KELLAWAY 57 90 10 3031 10 37.88 Harry DONNAN 58 102 10 3026 5 32.89 The highest average for NSW is 118.50 by Harry Rock who in five matches, seven innings, in seasons 1924-25 and 1925-26 scored 711 runs. MOST RUNS IN A SEASON Runs Batsman Season M Inn N.O H.S 100s Avge 1506 Simon KATICH 2007-08 11 17 1 306 5 94.12 1312 Michael BEVAN 1993-94 12 22 5 203* 5 77.17 1269 Phil JAQUES 2004-05 12 21 2 240* 3 66.78 1205 Dirk WELLHAM 1982-83 13 23 5 136* 2 66.94 1186 Steve SMALL 1990-91 13 23 - 126 4 51.56 1174 Mark TAYLOR 1988-89 12 22 1 152* 3 55.90 1153 Rick McCOSKER 1982-83 13 25 4 124 3 54.90 1127 Don BRADMAN 1928-29 7 12 4 340* 5 140.87 1065 Dominic THORNELY 2004-05 12 20 3 261* 4 62.64 1052 RICK McCOSKER 1974-75 10 19 1 164 4 58.44 1051 Don BRADMAN 1929-30 7 11 2 452* 2 116.77 1036 Don BRADMAN 1933-34 6 9 2 253 4 148.00 1024 Grahame THOMAS 1965-66 9 16 - 229 4 64.00 1019 Michael SLATER 1992-93 10 19 2 143 3 59.94 1015 John DYSON 1983-84 11 19 3 241 3 63.43 1009 Mark WAUGH 1989-90 12 17 4 198* 5 77.61 JOSH HAZLEWOOD 1005 Norm O’NEILL 1957-58 8 14 2 233 4 83.75 Cricket NSW Annual Report and Yearbook 2017/18 * Alsoscored acentury(111)inthesecondinnings. ** This wasCallaway’s onlyfirst-classinnings.ItwasmadeinNewWales’s lastfirst-class * HIGHEST INDIVIDUALINNINGS NSW France,onMay3,1917. matchuntilafterWorld War 1.Callawaywaskilled atthe2ndBattleofBullecourt,in CENTURY ONFIRSTCLASSDEBUTFORNSW i OL 4 itraSde 1918-19 Sydney Victoria 145 Jim BOGLE 5*DnBAMNQenln yny1929-30 Sydney Queensland DonBRADMAN 452* rvrCAPL 2 etr utai yny1979-80 Sydney Western Australia 120 Trevor CHAPPELL cr asa poetVneSeason Venue Opponent Batsman Score rhrMRI *18Qenln yny1940-41 1929-30 Sydney Sydney Queensland 148 M.C.C. 117 Arthur MORRIS** 1930-31 Arthur ALLSOPP 1924-25 Sydney 1923-24 1990-91 1960-61 1965-66 Sydney 1931-32 1900-01 1903-04 Melbourne Victoria Sydney 1957-58 Perth 1924-25 1962-63 Canterbury Western Australia Sydney M.C.C. DonBRADMAN Sydney Queensland Sydney CharlieMACARTNEY Sydney Victoria 2014-15 220 Sydney Tommy ANDREWS Queensland 1932-33 221 SouthAustralia 1920-21 MarkWAUGH 1920-21 224 GrahameTHOMAS Victoria SouthAustralia 229* NeilHARVEY 1886-87 Hobart 229 2004-05 Victoria Victoria StanMcCABE Sydney Adelaide 229 MontyNOBLE 1983-84 Sydney 229* Melbourne Victor TRUMPER Bankstown 1919-20 230 NeilHARVEY SouthAustralia 1963-64 1923-24 230 Tasmania NormO’NEILL SouthAustralia 231 Adelaide HarryROCK Victoria 233 1951-52 Warren BARDSLEY 1964-65 Queensland Sydney 1933-34 235 Victoria Warren BARDSLEY Sydney SouthAustralia Sydney 235 PeterNEVILL 235 1928-29 DonBRADMAN 1898-99 Western Australia Brisbane Adelaide 235* PercyMCDONELL 1930-31 SouthAustralia Sydney 1982-83 238 PhilJAQUES Victoria Melbourne 239 JohnDYSON SouthAustralia 240 1925-26 Sydney Queensland Bob SIMPSON Melbourne Adelaide 241 1959-60 2004-05 Queensland Tommy ANDREWS 247* 2016-17 AlanKIPPAX NewZealanders 247* 1903-04 DougWALTERS 1967-68 South Australia 248 Victoria Sydney ArthurMORRIS 1905-06 Sydney 253 Sydney DonBRADMAN 1912-13 Victoria Sydney 253 Victor TRUMPER 1887-88 1898-99 Sydney 253 Western Australia Melbourne DonBRADMAN Sydney SouthAustralia 253 AlanKIPPAX 258 Victoria Sydney DominicTHORNELY SouthAustralia Queensland 260* SteveSMITH Sydney Sydney 261* Queensland RayFLOCKTON 263 Victoria MoisesHENRIQUES 264* AlanKIPPAX Tasmania 265 ReggieDUFF 271* RobSIMPSON Tasmania Victoria 271 MontyNOBLE 277 HerbieCOLLINS 281 Victor TRUMPER 282 HarryMOSES 292* 297* 0 io AIHQenln yny2007-08 1927-28 1881-82 1928-29 Sydney 1963-64 Sydney Sydney 1906-07 Sydney Queensland Brisbane Queensland Brisbane Victoria Victoria Queensland SimonKATICH AlanKIPPAX 306 BillyMURDOCH Queensland 315* DonBRADMAN 321 BobSIMPSON 340* CharlesGREGORY 359 383 asa usOpnn eu Season Venue Opponent Runs Batsman an EBOK15Vcoi ebun 1984-85 Melbourne Victoria 1929-30 165 Sydney Wayne SEABROOK Tasmania 115 Wendell BILL ayGLOR12SuhAsrlaSde 1971-72 Sydney South Australia 122 Gary GILMOUR utsPTESN17WsenAsrlaSde 2011-12 Sydney Western Australia 157 Kurtis PATTERSON i ADNO 1 ot utai dlie2010-11 Adelaide South Australia 1958-59 113 Sydney SouthAustralia Nic MADDINSON 180* Neil MARKS 1914-15 Brisbane Queensland 207 Norman CALLAWAY * ikWLHM10Vcoi ebun 1980-81 Melbourne 1946-47 Victoria 100 Adelaide SouthAustralia 1927-28 118 Dirk WELLHAM 1923-24 Adelaide 1920-21 SouthAustralia Eric LUKEMAN Brisbane 118 Sydney Queensland 130 Queensland Don BRADMAN 143 Des MULLARKEY Edward FORSSBERG ar TEE10Qenln rsae1926-27 1924-25 Brisbane Sydney Queensland SouthAustralia 130 127 Harry STEELE Harry ROCK e ORR13Tsai oat2006-07 1993-94 Hobart Sydney Tasmania 1952-53 163 Tasmania 133* 1931-32 Perth Western Australia Ben ROHRER 121 Rodney DAVISON Adelaide South Australia 102 Ron BRIGGS 1895-96 Richard NUTT Sydney Queensland 150 Frank WALTERS e EBAE 2 amnaSde 1929-30 Sydney Tasmania 128 1896-97 Brisbane Len LEABEATER Queensland 166 Leslie PYE

First

Class

Records ArthurMorrisbecamethefirstplayerinworldcrickettoregisteracenturyeachinnings * aSheffieldShieldfixture). onfirst-classdebutscoring148and111againstQueensland attheS.C.G.in1940-41(not CENTURIES INBOTHINNINGSOFAMATCH i AKY15&12 ot utai yny1905-06 Sydney SouthAustralia 105&102* Jim MACKAY cr asa poetVneSeason Venue Opponent Batsman Score rhrMRI 4 1 uesadSde 1940-41 Sydney Queensland 148&111 Arthur MORRIS* lnKPA 2 3 uesadBibn 1926-27 1927-28 Brisbane Sydney Queensland SouthAustralia 127&131 131&122 Alan KIPPAX 0*Mr AG etIdasSde 1992-93 1979-80 1945-46 1933-34 Sydney Brisbane Brisbane 1919-20 1899-00 2005-06 2002-03 Brisbane 1970-71 West Indians Queensland Adelaide Queensland 1950-51 1935-36 Adelaide Sydney Sydney Queensland Sydney SouthAustralia 1913-14 1907-08 MarkWAUGH SouthAustralia AllanBORDER Brisbane Sydney 200* SidBARNES 1912-13 200 DonBRADMAN Queensland 200 Tasmania Sydney Sydney JamesBOGLE 1998-99 1997-98 1905-06 M.C.C. 200 MontyNOBLE Queensland Queensland 200 Sydney MichaelCLARKE NorthSydney 200 MichaelBEVAN 201* 2001-02 Brisbane Sydney DougWALTERS 1933-34 2006-07 201* 1993-94 Victoria SouthAustralia Victoria 2002-03 Keith MILLER 201* AlexMARKS 1962-63 1994-95 SouthAustralia 201* CharlieMACARTNEY Victoria Sydney Queensland 201 Sydney Victor TRUMPER Sydney Sydney 201 SydGREGORY 1956-57 Perth Western Australia 201* MichaelBEVAN Hobart Western Australia 201 1899-00 1914-15 Perth SteveWAUGH 1951-52 Western Australia 202* JimMACKAY 1906-07 Queensland 202* Western Australia 2002-03 2016-17 MichaelBEVAN Victoria Perth 203 1924-25 Melbourne MichaelBEVAN Sydney 203* Sydney MichaelSLATER Tasmania Western Australia 203* 1908-09 Melbourne Melbourne 1952-53 Sydney SimonKATICH 204 BobSIMPSON Sydney 205* BillBROWN 1950-51 Queensland Queensland 205 SteveWAUGH Victoria 1908-09 205 Sydney BillWATSON Sydney 206 NormanCALLAWAY 2003-04 Victoria Victoria Victoria 206 2010-11 Victor TRUMPER 1911-12 Sydney 207 Victoria ArthurMORRIS Adelaide SouthAfricans 208 1926-27 1990-91 AustinDIAMOND 210 Victoria Sydney SteveWAUGH 2004-05 Adelaide 210* SouthAustralia EdCOWAN Sydney 211 AlanKIPPAX M.C.C. Sydney 212 SouthAustralia 1908-09 IanCRAIG Perth 1931-32 212* 1956-57 MontyNOBLE Sydney Tasmania 213* MontyNOBLE Western Australia 213 UsmanKHAWAJA Victoria Adelaide 213 SouthAustralia KeithMILLER Adelaide Sydney 214 Victoria MichaelBEVAN 214 SteveWAUGH SouthAustralia 216 SouthAustralia RoyMINNETT SouthAfricans 216* PhilJAQUES 216* AlanKIPPAX 217* AlbertHOPKINS 217* DonBRADMAN 218 JimBURKE 219 220 asa usOpnn eu Season Venue Opponent Runs Batsman tv ML 1 2 elntnNrhSde 1990-91 NorthSydney Wellington 115&126 Steve SMALL tnMCB 0 0*Vcoi yny1931-32 Sydney Victoria 106&103* Stan McCABE rgMI 2 5*SuhAsrlaSde 2003-04 Sydney South Australia 128&152* Greg MAIL hri AATE 1 2 ot fiasSde 1910-11 Sydney SouthAfricans 119&126 Charlie MACARTNEY o RDA 3 3*Qenln rsae1928-29 Brisbane Queensland 131&133* Don BRADMAN akTYO 2 0 Qenln yny1989-90 1988-89 Sydney Queensland Perth Western Australia 127&100 107&152* Mark TAYLOR Mark TAYLOR ot OL 7 2 itraSde 1907-08 Sydney Victoria 176&123 Monty NOBLE ikMCSE 2*&18 itraSde 1981-82 1964-65 1974-75 Sydney Sydney Victoria Sydney Western Australia 123*&118* SouthAustralia 138&136* 121&142* Rick McCOSKER Rick McCOSKER Bob SIMPSON hlJQE 2 2 itraMlore2010-11 Melbourne Victoria 129&125 Phil JAQUES HIGHEST WICKET PARTNERSHIPS LEADING WICKET-TAKERS Wkt Ttl Batsmen Opponent Venue Season Bowler M Wkts Avge 5WI 1st 319 John DYSON & Rick McCOSKER Western Australia Sydney 1980-81 Greg MATTHEWS 135 417 28.65 20 308 Bob SIMPSON & Grahame THOMAS Western Australia Sydney 1963-64 Geoff LAWSON 115 395 23.36 13 298 Victor TRUMPER & Reggie DUFF South Australia Sydney 1902-03 Stuart MacGILL 90 357 33.07 18 2nd 378 Lynn MARKS & Doug WALTERS South Australia Adelaide 1964-65 Arthur MAILEY 67 334 27.66 28 334 Archie JACKSON & Don BRADMAN South Australia Adelaide 1930-31 Bill O’REILLY 54 325 16.52 26 323 Ian CRAIG & Queensland Sydney 1960-61 Richie BENAUD 86 322 26.01 17 3rd 363 Don BRADMAN & Alan KIPPAX Queensland Sydney 1933-34 Mike WHITNEY 94 314 27.33 13 345 Warren BARDSLEY & Johnny TAYLOR South Australia Adelaide 1920-21 Johnny MARTIN 78 291 30.88 12 Doug BOLLINGER 89 290 28.16 10 280 Wendell BILL & Alan KIPPAX Queensland Brisbane 1930-31 Alan DAVIDSON 72 273 21.45 10 4th 325 Norm O’NEILL & Brian BOOTH Victoria Sydney 1957-58 Charles TURNER 43 263 16.18 29 315 Monty NOBLE & Syd GREGORY Victoria Sydney 1907-08 Trent COPELAND 62 231 27.29 11 293 Reggie DUFF & Monty NOBLE South Australia Sydney 1903-04 Monty NOBLE 77 230 23.34 13 5th 464* Mark WAUGH & Steve WAUGH Western Australia Perth 1990-91 Stuart CLARK 69 228 29.36 9 397 Warren BARDSLEY & Charles KELLEWAY South Australia Sydney 1920-21 Bob HOLLAND 68 228 31.64 8 391 Ed COWAN & Moises HENRIQUES Queensland Sydney 2016-17 Charles KELLEWAY 57 215 23.90 7 6th 332 Neil MARKS & Grahame THOMAS South Australia Sydney 1958-59 Kerry O’KEEFFE 65 211 27.06 12 271 Steve WAUGH & Greg MATTHEWS Tasmania Hobart 1989-90 Len PASCOE 54 203 26.07 9 258 Victor TRUMPER & Frank IREDALE Tasmania Sydney 1898-99 David COLLEY 71 203 32.08 6 7th 255 Grahame THOMAS & Richie BENAUD Victoria Melbourne 1961-62 Ray LINDWALL 50 196 22.71 7 208 Charlie MACARTNEY & Albert HOPKINS Queensland Sydney 1906-07 Bill HOWELL 48 195 24.07 11 191 Dominic THORNELY & Brad HADDIN South Australia Sydney 2007-08 Nathan BRACKEN 58 190 25.60 9 8th 270 Victor TRUMPER & Eric BARBOUR Victoria Sydney 1912-13 Dave RENNEBERG 54 190 30.48 8 236 Reggie DUFF & Albert HOPKINS Lord Hawke’s XI Sydney 1902-03 Steve O’KEEFE 59 188 24.94 5 218 Charlie MACARTNEY & John SCOTT Queensland Sydney 1913-14 Wayne HOLDSWORTH 58 188 32.14 10 9th 226 Charles KELLEWAY & Bert OLDFIELD Victoria Melbourne 1925-26 Tom McKIBBIN 25 181 21.11 17 221 Ernest WADDY & Bill HOWELL South Australia Adelaide 1904-05 Albert COTTER 38 171 23.42 10 201 Edward FORSSBERG & Hammy LOVE Queensland Sydney 1920-21 David HOURN 41 161 27.47 11 10th 307 Alan KIPPAX & Hal HOOKER Victoria Melbourne 1928-29 David FREEDMAN 54 159 30.28 7 219 Dominic THORNELY & Stuart MacGILL Western Australia Sydney 2004-05 Matthew NICHOLSON 45 155 28.46 3 169 Roy MINNETT & Cecil McKEW Victoria Sydney 1911-12 Peter PHILPOTT 52 153 31.07 7 Note: Jack Fingleton, & Don Bradman shared a first wicket partnership of 340 against Victoria at Sydney John SCOTT 35 150 22.42 9 in 1933-34. Fingleton retired hurt on 78 with the total at 0/148 and did not resume until 4/486 the next day. Charlie MACARTNEY 81 148 23.41 3 27 145 14.95 15 MOST WICKETS IN A SEASON Hughie CHILVERS 32 142 25.38 11 Wkts Bowler Season M Balls Mdns Runs Avge Best Gary GILMOUR 42 140 33.36 3 63 Charles TURNER 1887-88 7 2513 262 865 13.73 8-39 Syd CALLAWAY 33 139 17.36 14 62 Stuart MacGILL 2004-05 12 2771 92 1441 23.24 6-65 Murray BENNETT 52 131 28.72 5 59 R “Jack” MASSIE 1912-13 10 2261 84 1101 18.68 7-110 Grahame CORLING 46 129 32.28 5 55 Bill O’REILLY 1939-40 7 1974 52 832 15.12 8-23 John GLEESON 35 126 25.63 7 55 Arthur MAILEY 1922-23 9 2384 52 832 21.63 6-45 Albert HOPKINS 52 126 25.67 6 53 Charles TURNER 1886-87 5 1425 178 377 7.11 8-32 Tom GARRETT 56 123 23.48 9 53 Wayne HOLDSWORTH 1992-93 12 2245 57 1376 25.96 7-41 Fred JOHNSTON 35 123 29.45 5 52 Greg MATTHEWS 1991-92 12 2896 153 1116 21.46 6-63 Keith MILLER 50 119 25.36 3 51 Richie BENAUD 1958-59 8 2611 81 995 19.50 7-32 Doug WALTERS 103 119 35.00 5 Brad McNAMARA 59 116 26.83 5 HAT-TRICKS Dave GILBERT 43 113 33.27 3 Bowler Opponent Venue Season 23 109 25.37 7 George GILBERT Victoria Melbourne 1857-58 38 105 26.12 4 Charles TURNER Victoria Melbourne 1886-87 Sam EVERETT 28 103 26.44 8 Monty NOBLE Tasmania Sydney 1898-99 Shane LEE 73 102 41.05 - Tom HOWARD Queensland Sydney 1902-03 John FERRIS 19 101 17.20 7 Albert HOPKINS South Australia Sydney 1903-04 Josh HAZLEWOOD 28 100 24.50 1 Charles KELLEWAY Queensland Brisbane 1913-14 40 100 26.91 6 Hal HOOKER * Victoria Sydney 1928-29 Alan WALKER Queensland Sydney 1948-49 John TREANOR ** Queensland Brisbane 1954-55 Gordon RORKE Queensland Sydney 1958-59 Alan DAVIDSON Western Australia Perth 1962-63 Len PASCOE South Australia Adelaide 1980-81 Dave GILBERT Victoria Sydney 1984-85 Stuart MacGILL New Zealanders Newcastle 1997-98 Stuart CLARK Western Australia Perth 2006-07 Doug BOLLINGER Western Australia Perth 2007-08 Scott COYTE Queensland Brisbane 2010-11 Doug BOLLINGER Victoria Wagga Wagga 2014-15 Mitchell STARC*** Western Australia Hurstville 2017-18 Mitchell STARC*** Western Australia Hurstville 2017-18 * Hal Hooker took four wickets in four balls, three in the 1st innings, one in the 2nd innings. ** John Treanor took his hat-trick on debut. *** Mitchell Starc took a hat-trick in each innings of the match Cricket NSW Annual Report and Yearbook 2017/18 YOUNGEST PLAYERS TOSCOREACENTURY MOST WICKETSINANINNINGS NSW ONE HUNDREDRUNSANDTENWICKETSINAMATCH CENTURY ANDFIVEWICKETSINANINNINGS MOST WICKETSINAMATCH -1 o cIBNVcoi yny1896-97 2016-17 1865-66 1962-63 1892-93 1895-96 Sydney 1895-96 2009-10 Sydney Melbourne 1890-91 2017-18 1920-21 Adelaide Sydney 1905-06 Melbourne Queensland Victoria Christchurch 1890-91 SouthAustralia 1896-97 Sydney Victoria WillSOMERVILLE Adelaide New Zealanders Tom McKIBBIN 2017-18 StKilda Victoria 1894-95 8-136 1897-98 MichaelPIERCE Sydney Victoria 2006-07 8-111 SamCOSSTICK Sydney SouthAustralia SydCALLAWAY 8-111 Queensland 1914-15 Sydney JohnnyMARTIN 8-109 1981-82 Adelaide SouthAustralia Tom McKIBBIN 8-98 1992-93 Trent COPELAND 8-97 Victoria Queensland Adelaide JohnFERRIS 1887-88 8-93 1995-96 Sydney SouthAustralia Sydney ArthurMAILEY 1887-88 8-92 Melbourne Perth HerbertHORDERN Victoria 8-84 South Australia SteveO’KEEFE 1985-86 8-81 SouthAustralia Tom Hobart McKIBBIN 1886-87 Western Australia 8-81 CharlesTURNER 8-77 1939-40 Sydney Newcastle 1923-24 MitchellSTARC 1935-36 8-74 Victoria Sydney Tom McKIBBIN 1893-94 8-74 1978-79 Victoria Sydney Western Australia StuartCLARK 8-73 1984-85 Tasmania AndrewNEWELL 8-66 West Indians Sydney GregMATTHEWS 1902-03 8-58 1894-95 Sydney RoyMINNETT 1933-34 EnglandXI Wellington 8-56 Sydney DavidFREEDMAN EnglandXI 8-52 NewZealanders Sydney LenPASCOE 8-50 Napier Sydney 1937-38 CharlesTURNER NewZealanders 8-49 Season CharlesTURNER EnglandXI 8-41 Sydney Melbourne SouthAustralia BobHOLLAND Queensland 8-40 Brisbane Melbourne HunterHENDRY 8-39 HawkesBay CharlesTURNER 8-33 SouthAustralia EdwardWHITE 8-33 Victoria Venue Adelaide BillO’REILLY 8-32 Queensland Victoria SydneyAUSTIN 8-31 BobHOLLAND Victoria 8-23 DavidHOURN SouthAustralia 8-14 Opponent Tom McKIBBIN 9-83 BillHOWELL 9-77 BillO’REILLY 9-68 BillO’REILLY 9-52 Bowler 9-50 9-41 Fig 41288 -0 onFRI ot utai dlie1890-91 1937-38 1894-95 1894-95 1862-63 Adelaide 1886-87 1895-96 1939-40 SouthAustralia Adelaide Brisbane Sydney SouthAustralia Domain SouthAustralia 1890-91 Wellington Queensland JohnFERRIS Sydney Sydney Tom McKIBBIN 8-84&6-108 1887-88 BillO’REILLY 1895-96 Wellington Victoria 1896-97 Tom 6-123&8-66 McKIBBIN 14-192 9-41&5-57 Sydney EnglandXI CharlesLAWRENCE Queensland 14-189 5-19&9-68 SydCALLAWAY Christchurch 14-98 7-48&7-25 CharlesTURNER Sydney NewZealanders 14-87 Adelaide 7-47&7-18 BillO’REILLY 14-73 Victoria 8-32&6-27 SouthAustralia 14-65 SydCALLAWAY 8-23&6-22 EnglandXI 14-59 CharlesTURNER 7-77&8-98 14-45 Tom McKIBBIN CharlesTURNER 8-74&7-100 15-175 7-51&8-74 15-174 8-39&8-40 15-125 16-79 onyMRI 0 -2 etr utai et 1963-64 Perth Western Australia 5-126 101 Johnny MARTIN om NRW 1*54 atruyCrscuc 1923-24 Christchurch Canterbury 5-41 111* Tommy ANDREWS lnDVDO 0 -1WsenAsrlaPrh1961-62 Perth Western Australia 7-31 108 Alan DAVIDSON rhrMRI 18 832Qenln yny1940-41 Sydney Queensland 342 18 Arthur MORRIS(148) rheJCSN(0)1 7Qenln yny1926-27 Sydney Queensland 97 17 Archie JACKSON(100) lyrBtigBwigOpnn eu Season Venue Opponent Bowling Batting Player lyrBtigBwigOpnn eu Season Venue Opponent Bowling Batting Player lyrYasDy poetVneSeason Venue Opponent Days Years Player ksFgrsBwe poetVneSeason Venue Opponent Bowler Figures Wkts tv MT 0 -4SuhAsrlaSde 2009-10 Sydney SouthAustralia 7-64 100 Steve PDSMITH ef AIS1264 uesadSde 1967-68 Sydney Queensland 6-43 112 Geoff DAVIES rgMTHW 5 766 -0Qenln yny1991-92 Sydney Queensland 6-63&5-70 85*&67 Greg MATTHEWS a RI 23)1 0 ot fiasSde 1952-53 Sydney SouthAfricans 205 17 Ian CRAIG(213*) utsPTESN(5)1 0 etr utai yny2011-12 Sydney Western Australia 206 18 Kurtis PATTERSON (157) omCLAA 27 830Qenln yny1914-15 2010-11 Sydney Adelaide Queensland SouthAustralia 320 294 18 Norm CALLAWAY 18 (207) Nic MADDINSON(113) oi cOL1056 ot utai dlie1940-41 Adelaide SouthAustralia 5-65 100 Colin McCOOL lmHL 7&9 -8&54 uesadSde 1932-33 Sydney Queensland 7-18&5-49 17&91 ogWLES1665 itraSde 1972-73 Sydney 1964-65 Adelaide Victoria SouthAustralia 6-51 7-63 176 Doug WALTERS 253 Doug WALTERS rcBROR(2* 839Qenln yny1909-10 Sydney Queensland 339 18 Eric BARBOUR(124*) ogWLES(0* 89Vcoi ebun 1963-64 Melbourne Victoria 9 18 Doug WALTERS (109*) ot OL 5 -1Vcoi yny1899-00 1898-99 1903-04 Sydney Sydney Adelaide SouthAustralia Victoria Victoria 5-67 6-91 5-128 147 155 100 Monty NOBLE Monty NOBLE Monty NOBLE iheBNU 5 -8Qenln rsae1953-54 Brisbane Queensland 5-88 158 Richie BENAUD o IPO 14 835Vcoi yny1954-55 Sydney Victoria 345 18 Bob SIMPSON (104) ee HLOT1566 etr utai yny1964-65 Sydney Western Australia 6-65 125 Peter PHILPOTT

First

Class

Records STEVE O’KEEFE PAT CUMMINS YOUNGEST PLAYERS TOTAKE FIVEWICKETSINANINNINGS ae LEE(-5 836Vcoi ebun 1882-83 1926-27 Melbourne Victoria Brisbane Queensland 316 66 18 18 James CLEEVE(6-95) Jim CAMPBELL(6-118) onFRI 52)1 4 itraSde 1886-87 Sydney Victoria 248 19 John FERRIS(5-28) la OPR(-2)1 6 itraMlore1935-36 Melbourne 1903-04 1889-90 Victoria Sydney 269 19 M.C.C. Auckland 107 71 Allan COOPER(6-128) 19 19 Andrew NEWELL(5-53) Albert COTTER(5-44) lyrYasDy poetV Opponent Days Years Player tnMCB 53)1 7 uesadSde 1929-30 Sydney Queensland 171 19 Stan McCABE(5-36) ogWLES(-6 835Pksai yny1964-65 1895-96 Sydney Christchurch Pakistanis Canterbury 355 340 18 18 Doug WALTERS (6-66) Dave NOONAN(7-98) icelSAC(-4 934Qenln rsae2009-10 2006-07 Brisbane Queensland 334 Brisbane Queensland 19 270 Mitchell STARC (5-74) 19 Moises HENRIQUES(5-17) o IPO 53)1 6 18 Bob SIMPSON(5-37) Australia Western yny1953-54 Sydney neSeason enue FIVE WICKETS IN AN INNINGS ON FIRST-CLASS DEBUT FOR NSW Bowler Figures Opponent Venue Season John McKONE 5-25 Victoria Melbourne 1855-56 Edward WARD 5-15 Victoria Domain 1856-57 George RICHARDSON 6-42 Victoria Melbourne 1859-60 Charles LAWRENCE 7-48 Victoria Domain 1862-63 Sam COSSTICK 8-109 Victoria Melbourne 1965-66 Edwin EVANS 6-25 Victoria Albert 1874-75 James CLEEVE 6-95 Victoria Melbourne 1882-83 Michael PIERCE 8-111 South Australia Adelaide 1892-93 Bill HOWELL 5-44 AE Stoddart’s XI Sydney 1894-95 Dave NOONAN 7-95 Canterbury Christchurch 1895-96 Tom HOWARD 6-59 Queensland Sydney 1899-00 Jack MARSH 5-181 South Australia Sydney 1900-01 Herbert HORDERN 8-81 Queensland Sydney 1905-06 Leslie MINNETT 7-131 M.C.C. Sydney 1907-08 Cyril DOCKER 5-67 Queensland Sydney 1909-10 Bernard FOLKARD 6-37 South Africans Sydney 1910-11 Arthur MAILEY 5-46 Western Australia Sydney 1912-13 Charles MORRISSEY 6-30 Queensland Brisbane 1924-25 Hal HOOKER 5-81 Queensland Sydney 1924-25 Jim CAMPBELL 6-118 Queensland Brisbane 1926-27 Ernest O’BRIEN 5-99 South Australia Sydney 1926-27 F. ‘Harry’ DUPAIN 5-44 Tasmania Sydney 1927-28 Robert ROXBY 5-84 South Australia Adelaide 1953-54 John TREANOR 5-146 Queensland Brisbane 1954-55 Wally WELLHAM 6-43 Queensland Brisbane 1959-60 Wayne HOLDSWORTH 6-55 Victoria Melbourne 1988-89 DAVID WARNER Greg McLAY 5-55 Western Australia Sydney 1990-91 Glenn McGRATH 5-79 Tasmania Sydney 1992-93 Trent COPELAND 8-92 Queensland Sydney 2009-10 Harry CONWAY 5-45 Tasmania Hobart 2015-16

MOST DISMISSALS BY A WICKET-KEEPER Wicket-keeper M Dismissals Catches Stumpings Runs Avge H.S Phil EMERY 120 378 332 46 3284 26.06 100* Brad HADDIN 96 316 291 24 5829 41.94 154 Steve RIXON 107 298 249 49 3229 25.03 128 Bert OLDFIELD 82 271 165 106 2393 2323 129 Brian TABER 73 242 207 35 1489 16.54 109 Peter NEVILL 63 229 212 17 3567 43.50 235* Doug FORD 63 177 120 57 545 12.97 36* James KELLY 53 126 81 45 1521 22.70 128 Hanson CARTER 44 121 81 40 1262 23.37 149 Ron SAGGERS 40 115 85 30 1427 25.94 90 42 114 99 15 1332 27.18 88* The highest score by a wicket-keeper for NSW is 321 by Billy Murdoch.

MOST CATCHES BY A FIELDSMAN Fieldsman Matches Catches Mark TAYLOR 100 132 Mark WAUGH 108 124 Greg MATTHEWS 135 118 Richie BENAUD 86 106 Rick McCOSKER 79 105 Bob SIMPSON 67 102 NATHAN LYON Johnny MARTIN 78 103 Steve WAUGH 93 93 John DYSON 94 78 Arthur MAILEY 67 74 Steve SMALL 77 74

YOUNGEST FIRST-CLASS PLAYERS FOR NEW SOUTH WALES Player Years Days Opponent Venue Season Batting Bowling Ian CRAIG 16 249 South Australia Sydney 1951-52 91 - Bob SIMPSON 16 355 Victoria Sydney 1952-53 44* & 8* 1-24 & 0-11 Doug WALTERS 17 8 Queensland Sydney 1961-62 1 & 50 0-7 Victor TRUMPER 17 64 South Australia Adelaide 1894-95 11 & 0 - Archie JACKSON 17 82 Queensland Brisbane 1926-27 5 & 86 - Edgar WADDY 17 134 Queensland Brisbane 1896-97 1 - Francis DOWNES 17 196 Victoria Melbourne 1881-82 1 & 4* 2-75 & 0-26 Len VAUGHAN 17 242 Western Australia Sydney 1925-26 3 - Charles OLIVER 17 246 Victoria Melbourne 1865-66 6* & 29 - Patrick CUMMINS 17 299 Tasmania Hobart 2010-11 0* & 0* 2-80 Arjun NAIR 17 318 South Australia Coffs Harbour 2015-16 37 2-71 & 0-14 Eric BARBOUR 17 339 Queensland Sydney 1908-09 40 & 0 2-58 & 1-22

NICK LARKIN Cricket NSW Annual Report and Yearbook 2017/18 JLT (25) andNicMaddinson(19). the ball,takingimportantearlywicketsofopenersDanielHughes (3-34)wasthetalismanforWestern Australiawith dismissed for260. chase lostallmomentum.NSW6/28inthefi naleightoverstobe When NSWlostitscaptainPeterNevill(15)inthe43rdover, the centuries, butitwasnotenough. Kurtis Patterson(51)andEdCowan(53)alsopitchedinwithhalf- before hewasdismissedbyleft-armwristspinnerD’ArcyShort(2-26). captain MoisesHenriquestopscoredwithabetterthanrunball72, Unfortunately forNSW, noonecouldrepeatthefeatsofMarsh.Blues provided goodsupport. bowlers, whileHarryConway(2-49)andSeanAbbott(2-54)also Seamer GurinderSandhu(4-57)wasthemosteffectiveofBlues’ as heguidedhisstateto9/269. opening batsmancarriedhisbatandpostedamatch-defi ningcentury, However, theBluescouldnotcontainShaunMarsh(132out).The 4/91. The defendingchampionsbowledfi rst,reducingWestern Australiato One DayCupcampaigninathrillingfi xturethatwentdowntothewire. New SouthWales travelledtoPerthfortheopeningmatchofitsJLT 29 September2017–WACA Ground Round 1: xrs9b4 13 260 (1) 0 (7) (13) 10 2 (1) (5) 0 0 (67) (48) 53 (16) 51 15 (70) Turner 6-0-31-0;Short6-0-26-2. Bowling: Richardson10-0-54-2;Behrendorff9.2-0-34-3; Tye 10-0-55-2;Moody8-0-51-0; (30) 72 Fall: 3952133202232233240259260 (38) 25 (206 min,49.2overs) 19 Extras 9lb4w HNA Conwaynotout MW EdwardsbBehrendorff NM Lyon cKlingerbShort GS Sandhurunout(Richardson) SA AbbottlbwbRichardson +PM NevillcBancroftbRichardson EJM CowancShortbTye *MC HenriquescRichardsonbShort KR Pattersonc&bTye NJ MaddinsoncTurner bBehrendorff DP HugheslbwbBehrendorff New South Wales xrs8b3 11 (1) 269 1 (1) (1) 0 (14) (3) 0 17 (9) 0 (75) 10 (136) 9wkts (18) 57 132 13 (33) Lyon 10-0-38-1; Henriques2-0-13-0. 28 Bowling: Sandhu9-1-57-4;Conway9-0-49-2;Abbott10-0-54-2;Edwards10-1-50-0; (9) Fall: 8658691210226267268 (216 min,50overs) 0 Extras 8lb3w DJM Moodynotout JP BehrendorffcHenriquesbSandhu AJ Tye cConwaybSandhu JA Richardsonc&bSandhu DJM ShortcHughesbConway JW Wells cPattersonbConway AJ Turner lbwbAbbott *MR MarshcHughesbLyon +CT BancroftcNevillbAbbott SE Marshnotout M KlingercMaddinsonbSandhu Western Australia Australia 4pts. Toss: 2017. Western Australiawonby 9runs. At WACA Ground,Perth,29September, WESTERN AUSTRALIA vNEWSOUTH WALES NewSouthWales. Western

NSW Bluesv. Western Australia One - Day Player oftheMatch: Referee: Scorers: Umpires:

DTalalla. LW Catchpole&SAWheeler. GJDavidson&PJGillespie. Cup SEMarsh. the Bluesanemphaticfi rstwinoftheseason. the ball.Tasmania wasbowledoutfor214inthe40thovertogive Lyon andSeanAbbott (3-29)alsoproducedfi neperformanceswith including thekeywicketofSilk. The Manly-Warringah fastbowlerpickedup4-31fromhisnineovers, In justhissecondmatchfortheBlues,MickeyEdwardswasexcellent. that pointonandalackofsubstantialpartnershipsproveddecisive. Apart fromJordanSilk(55),Tasmania lostconsistentwicketsfrom (3-58) removedBenDunk(38). It racedto0/69,althoughtheimpetusvanishedwhenNathanLyon performance. the previousseasonandmadeagoodstartinpursuitofrepeat Tasmania hadwonthecorrespondingfi xturebetweenthesetwoteams Cowan, helpedsetTasmania thetoughtaskof317forvictory. His innings,alongwithaquickfi re51notoutfrom32ballsbyEd with 23foursandonesix. The left-handerwentontoamassatremendous137from119deliveries However, Maddinsondidnotmisstheopportunitytopostabigscore. by leg-spinnerCameronBoyce(2-50). combined foranopeningstandof136beforeHughes(56)wasremoved The BluesstartedwellwithDanielHughesandNicMaddinson.pair 2 October2017–WACA Ground Round 2: xrs3b7 10 (4) 214 0 (15) (4) (7) 24 1 5 (40) (18) 30 (11) 11 5 (52) (21) 55 (30) Edwards 9-1-31-4. 4 Bowling: Conway7-1-47-0;Sandhu7-1-46-0;Lyon 10-1-58-3; Abbott6.2-0-29-3; (34) 38 Fall: 69758096117168197211213214 31 (168 min,39.2overs) 7 Extras 3lb7w RP Meredithnotout AL FeketecNevillbAbbott 316 JM BirdcNevillbEdwards CJ BoycebLyon (5) (6) SA MilenkocAbbottbLyon 4 CA Wakim cCowanbEdwards 1 JC Silkcsub(Lenton)bEdwards (20) (32) *GJ BaileybAbbott 21 AJ DoolancHughesbAbbott 51 (36) BR McDermottcNevillbEdwards (19) 6wkts 26 +BR DunkcNevillbLyon 13 Tasmania Boyce 10-0-50-2. (63) Bowling: Bird10-0-62-2;Fekete10-1-65-1;Milenko10-0-84-1;Meredith10-0-54-0; (119) Fall: 136207230247282284 56 137 (210 min,50overs) Extras 1lb6w HNA Conwaydidnotbat MW Edwardsdidnotbat NM Lyon didnotbat GS Sandhunotout SA AbbottbFekete *+PM NevillbMilenko EJM Cowannotout RJ GibsonstDunkbBoyce KR PattersonbBird NJ MaddinsoncDoolanbBird DP HughesstDunkbBoyce New South Wales Umpires: Toss: New SouthWales wonby102runs. At WACA Ground,Perth,2October, 2017. NEW SOUTH WALES v TASMANIA Tasmania. NewSouthWales 5pts. GJDavidson&PJGillespie. NSW Bluesv. Tasmania Player oftheMatch: Referee: Scorers: W Catchpole&SAWheeler. RW Stratford. NJ Maddinson. Round 3: NSW Blues v. South Australia Round 4: NSW Blues v. Cricket Australia XI 6 October 2017 – Hurstville Oval 8 October 2017 – Hurstville Oval The Blues headed back to Sydney for their third match of the It was a day for Peter Nevill to shine against the Cricket Australia XI tournament to take on South Australia, but were outclassed by in Hurstville with New South Wales back in the winners’ circle. the visitors. Nevill was magnifi cent behind the stumps. He claimed six catches After winning the toss and bowling, South Australian openers and two stumpings to equal the world record of eight dismissals in and together smashed 100 runs from 93 a domestic one-day fi xture. balls before Sean Abbott (3-59) claimed the fi rst wicket of Carey (60). Nic Maddinson was just as outstanding with the bat. He made 123 The 138-run fourth wicket partnership between centurions Weatherald from 113 balls and combined with Daniel Hughes (68) for a 132-run (103) and the big-hitting (110) capitalised on that good start opening stand to again get the Blues off to the ideal start. It was their to set up a huge total of 6/346. second century partnership of the tournament. On his return from injury, Mitchell Starc took 1-55. The platform provided by the openers allowed Ryan Gibson (51) and Despite the early loss of Nic Maddinson (5), NSW made an impressive Kurtis Patterson (30) to wield the willow and set the Cricket Australia start in reply. Daniel Hughes and Kurtis Patterson shared a 189-run XI a daunting target of 333 to win. partnership for the second wicket. However, the Blues’ nerves may have been jangling when Hughes scored an outstanding 105 from 104 deliveries and, on home opened the shoulders early in the chase. turf, St George local Patterson chimed in with 84 from 88 balls. The opener hit 89 from 61 balls before Nathan Lyon (2-25) removed However, the dismissals of Hughes and Patterson in the space of two Bryant with the score at 143 in the 21st over, and the candle had been deliveries ultimately signalled the demise of any hopes of victory. burnt. NSW took the next six wickets for 94 to secure victory. Hughes departed with the score on 202 and, with the next , Blues veteran Doug Bollinger picked up 3-62, while Lyon bowled with Patterson was run out by , leading to a monumental great precision to tie down the batsmen throughout his 10 overs. collapse. NSW lost 9/99 to be bowled out for 301 and give South Australia the win.

NEW SOUTH WALES v SOUTH AUSTRALIA NEW SOUTH WALES v CRICKET AUSTRALIA XI At Hurstville Oval, 6 October, 2017.South Scorers: TJ Lorraine & CG Wilcoxon. At Hurstville Oval, 8 October, 2017. Scorers: RL Sanday & CG Wilcoxon. Australia won by 45 runs. Referee: D Talalla. New South Wales won by 93 runs. Referee: D Talalla. Toss: New South Wales. South Australia Player of the Match: AI Ross. Toss: Cricket Australia XI. New South Wales Player of the Match: NJ Maddinson 4 pts. 5 pts. Umpires: GJ Davidson & MW Graham-Smith. Umpires: CA Polosak & P Wilson. South Australia New South Wales +AT Carey b Abbott 60 (55) DP Hughes c Nielsen b Hinchliffe 68 (72) JB Weatherald c Nevill b Starc 103 (114) NJ Maddinson b Hinchliffe 123 (113) *CJ Ferguson lbw b Lyon 19 (25) KR Patterson st Nielsen b Kuhnemann 30 (28) TLW Cooper lbw b Lyon 0 (1) RJ Gibson c Steketee b Hinchliffe 51 (45) AI Ross c Nevill b Abbott 110 (85) EJM Cowan run out (Carder-Nielsen) 2 (3) JS Lehmann c Conway b Abbott 24 (19) *+PM Nevill c Kuhnemann b Merlo 24 (16) CT Valente not out 0 (1) SA Abbott c Nielsen b Merlo 0 (1) JM Mennie not out 1 (1) GS Sandhu c Bryant b Hinchliffe 15 (13) MJA Cormack did not bat NM Lyon not out 8 (5) NP Winter did not bat DE Bollinger not out 4 (5) DJ Worrall did not bat MW Edwards did not bat Extras 14lb 13w 2nb 29 Extras 1b 2lb 3w 1nb 7 (226 min, 50 overs) 6 wkts 346 (195 min, 50 overs) 8 wkts 332 Fall: 100 149 149 287 341 345 Fall: 132 184 269 275 294 295 311 318 Bowling: Starc 10-0-55-1; Conway 10-0-77-0; Abbott 10-1-59-3; Lyon 9-0-88-2; Bowling: Steketee 7-0-58-0; Thornton 8-0-40-0; Webster 4-0-35-0; Pengelley 5-0-30-0; Edwards 10-1-48-0; Maddinson 1-0-5-0. Merlo 10-0-53-2; Hinchliffe 10-0-71-4; Kuhnemann 5-0-33-1; Uppal 1-0-9-0. New South Wales Cricket Australia XI DP Hughes c Valente b Worrall 105 (104) JM Carder c Nevill b Sandhu 6 (15) NJ Maddinson c Carey b Winter 5 (8) MA Bryant c Nevill b Lyon 89 (61) KR Patterson run out (Ferguson) 84 (88) *BJ Webster c Nevill b Bollinger 29 (34) RJ Gibson c Worrall b Mennie 5 (13) CD Hinchliffe c Edwards b Bollinger 7 (7) EJM Cowan b Valente 23 (21) P Uppal c Nevill b Bollinger 7 (8) *+PM Nevill lbw b Mennie 16 (10) JA Merlo st Nevill b Lyon 18 (26) SA Abbott c Weatherald b Mennie 5 (7) BJ Pengelley c Nevill b Abbott 3 (15) MA Starc c Worrall b Cooper 23 (21) HTRY Thornton c Maddinson b Abbott 10 (18) NM Lyon c Cooper b Mennie 4 (4) +HJ Nielsen not out 38 (36) MW Edwards b Worrall 11 (14) MT Steketee c Nevill b Edwards 10 (13) HNA Conway not out 10 (8) MP Kuhnemann st Nevill b Maddinson 14 (13) Extras 2lb 8w 10 Extras 2lb 6w 8 (207 min, 49.4 overs) 301 (177 min, 41 overs) 239 Fall: 13 202 202 226 241 252 252 264 283 301 Fall: 21 117 127 143 145 165 171 175 192 239 Bowling: Winter 7-0-40-1; Worrall 10-1-53-2; Mennie 10-0-53-4; Cormack 8-0-61-0; Bowling: Sandhu 6-0-32-1; Abbott 10-0-69-2; Bollinger 10-0-62-3; Edwards 5-0-48-1; Valente 10-0-62-1; Cooper 4.4-0-30-1. Lyon 10-2-25-2; Maddinson 0.0-0-1-1. Cricket NSW Annual Report and Yearbook 2017/18 seven ballstospare. over andNSWwentontosealitsthirdvictoryofthetournamentwith Hughes waseventuallydismissedwiththescoreon250in44th pivotal partnership,whichendedwhenMaddinsondeparted. In reply, HughesandMaddinsonscoredatarunballthroughouttheir Queensland posted7/282. 217-run thirdwicketpartnershipand,despitethelossoflatewickets, (138)andMarnusLabuschagne(91)combinedfora However, itwouldbesome37oversbeforetheBlues’nextscalp. (3-48) hisfi rstandtheBullswere2/20. The dismissalofJoeBurns(4)soonfollowedtogiveMitchellStarc the keywicketofMattRenshaw(4). the bowlingandoff-spinnerdidnotdisappointhisskipper, claiming In asurprisemovebycaptainPeterNevill,NathanLyon (1-36)opened laid thegroundworkforwhatwasacomfortablechase. Nic Maddinson(86).Thepairadded192runsforthefi rstwicketwhich The openeralsosharedhisthirdcenturystandofthecompetitionwith tournament. Hughes scored122from137ballstoposthishighestscoreofthe win overtheirnorthernneighbours. fi nalshopesaliveatDrummoyneinasuperbcenturysix-wicket New SouthWales openingbatsmanDanielHugheskepttheBlues’ 13 October2017–DrummoyneOval Round 5: JLT xrs6b7 n 14 283 (0) (2) 0 4 (12) 4 wkts (54) 14 Cutting 3-0-20-0;Renshaw 10-0-43-0. 43 Bowling: Doggett8-0-58-1;Gannon8.5-1-39-1; Neser9-0-48-1;Swepson10-0-69-0; (89) Fall: 192250279 (137) 86 (189 min,48.5overs) 122 Extras 6lb7w1nb DE Bollingerdidnotbat NM Lyon didnotbat SA Abbottdidnotbat MA Starcdidnotbat AJ Nairdidnotbat *+PM Nevillnotout EJM Cowannotout RJ GibsoncNeserbGannon KR Pattersonrunout(Neser) NJ MaddinsoncPeirsonbDoggett DP HughescSwepsonbNeser New South Wales xrs5b5 n 11 282 (0) 0 (3) (10) (5) 1 23 7 (9) (111) 91 7wkts 3 (11) 4 Nair 10-0-71-0. (13) (139) Bowling: Lyon 10-1-36-1;Starc10-1-48-3;Bollinger10-0-49-0;Abbott10-0-73-2; 138 Fall: 820237248251274276 4 (216 min,50overs) Extras 5lb5w1nb BJ Doggettdidnotbat MJ Swepsondidnotbat CJ Gannonnotout MG Neserrunout(Abbott) +JJ PeirsoncNevillbAbbott BCJ Cuttingnotout SD HeazlettcNevillbAbbott M LabuschagnebStarc JA BurnshitwicketbStarc *UT KhawajacAbbottbStarc MT RenshawcGibsonbLyon Queensland Toss: New SouthWales wonby6wickets. At DrummoyneOval,13October, 2017. NEW SOUTH WALES vQUEENSLAND NewSouthWales 4pts.

n Day One NSWBluesv. Queensland

Cup Player oftheMatch: Referee: Scorers: Umpires: RL Sanday&IEWright. GAAbood&JDWard. DJ Harper. DPHughes. by 35runsaccordingtotheDuckworth-Lewismethod. Play wassubsequentlyabandonedandthematchawardedtoVictoria condition ofthepitchwastoodangerousforplay. good positionat4/108after26oversbeforetheumpiresdeemed Seb Gotch(25notout)andBlakeThomson(17putVictoria ina and thematchwasbackonanevenkeel. struck againwhenBollinger(1-24)removedShortlbwinthe16thover innings thatguidedVictoria intocalmerwaters.However, theBlues Victorian openerMattShort(43)stabilisedthesituationwithasolid all withinthefi rstnineoversasthevisitorstumbledto3/28. (6) andVictorian captainandwicketkeeperPeterHandscombforaduck, Starc claimedtheimportantwicketsofMarcusHarris(2), the Victorian toporder. In reply, AustralianandBluesspearheadMitchellStarc(3-35)skittled fi guresforVictoria. of theorder. WillSutherland(4-11)returnedthemostimpressive Nic Maddinson(28)wasthenextbestscoreforBluesattop fi nalwicket. as heanddebutantWillSomerville(9notout)added40runsforthe within 43overs.DougBollinger(30)salvagedsomeprideforNSW, On alivelypitch,theBluesbattedfi rstandwerebowledoutfor144 competition inunusualcircumstances. at thepicturesqueNorthSydneyOval,butwaseliminatedfrom New SouthWales facedanothermust-winscenarioagainstVictoria 15 October2017–NorthSydneyOval Round 6: xrs4 l w15 108 (36) (44) 17 25 4wkts (17) 6 (2) (7) Somerville 1-0-3-0. (50) 2 0 Bowling: Starc8-0-35-3;Cummins8-2-24-0;Bollinger 6-0-24-1;Abbott3-0-13-0; 43 Fall: 3222866 5 (137 min,26overs) Extras 4b5lb6w Fawad Ahmeddidnotbat 144 SM Bolanddidnotbat PM Siddledidnotbat (34) (22) CP Tremain didnotbat 30 9 WJ Sutherlanddidnotbat BR Thomsonnotout (12) (16) (3) SE Gotchnotout 6 8 *+PSP HandscombcCowanbStarc 0 TJ DeancNevillbStarc (20) (39) MS HarriscAbbottbStarc 10 MW ShortlbwbBollinger 18 Victoria (35) (13) Sutherland 5.2-2-11-4;FawadAhmed6-1-24-3. 14 Bowling: Short5-0-13-0;Boland8-1-34-1;Siddle10-3-14-0;Tremain 13 8-0-48-2; (47) (13) Fall: 7474865738799104144 28 3 (174 min,42.2overs) Extras 5w DE BollingerbSutherland WER Somervillenotout SA AbbottcHarrisbFawadAhmed PJ CumminsbFawadAhmed MA StarcbSutherland *+PM NevilllbwbFawadAhmed EJM CowancHandscombbSutherland RJ GibsonbSutherland KR PattersoncShortbTremain NJ MaddinsoncGotchbTremain DP HughescThomsonbBoland New South Wales Toss: Victoria wonby35runs(DLSMethod). At NorthSydneyOval,15October, 2017. NEW SOUTH WALES v VICTORIA NewSouthWales. Victoria 5pts. NSW Bluesv. Victoria Referee: Scorers: Umpires: DJHarper. CL Bennison&CGWilcoxon. SD Fry&JDWard. JLT One-Day Cup Statistics

2017/18 JLT ONE-DAY CUP POINTS TABLE Team Played Won Lost No Result BP Points NRR Western Australia 6 5 1 0 2 22 0.8860 South Australia 6 4 2 0 1 17 -0.0171 Victoria 6 3 3 0 3 15 0.5563 New South Wales 6 3 3 0 2 14 0.4118 Queensland 6 3 3 0 1 13 0.0135 Tasmania 6 2 4 0 2 10 -0.4271 Cricket Australia XI 6 1 5 0 0 4 -1.3116 Net run-rate was calculated by subtracting runs conceded per over from runs scored per over.

2017/18 MATADOR ONE-DAY CUP PERFORMANCES BATTING M Inn NO Runs HS Avge 50 100 Ct St Stk-Rt NJ Maddinson 6 6 - 398 137 66.33 1 2 2 - 96.14 DP Hughes 6 6 - 379 122 63.17 2 2 3 - 90.45 KR Patterson 6 6 - 248 84 41.33 2 - 1 - 85.81 EJM Cowan 6 6 2 146 53 36.50 2 - 2 - 105.80 PM Nevill 6 6 1 94 24 18.80 - - 16 2 93.07 RJ Gibson 5 5 - 93 51 18.60 1 - 1 - 85.32 MC Henriques 1 1 - 72 72 72.00 1 - 1 - 102.86 DE Bollinger 3 2 1 34 30 34.00 - - - - 87.18 MA Starc 3 2 - 29 23 14.50 - - - - 87.88 MW Edwards 4 2 - 21 11 10.50 - - 1 - 77.78 GS Sandhu 3 3 1 19 15 9.50 - - 1 - 82.61 NM Lyon 5 3 1 14 8* 7.00 - - - - 87.50 HNA Conway 3 2 2 10 10* - - - 2 - 111.11 WER Somerville 1 1 1 9 9* - - - - - 40.91 PJ Cummins 1 1 - 8 8 8.00 - - - - 50.00 SA Abbott 6 5 - 6 5 1.20 - - 3 - 33.33 AJ Nair 1 ------

BOWLING M Overs Mdns Runs Wkts Avge Best RPO SA Abbott 6 49.2 1 297 12 24.75 3-29 6.02 NM Lyon 5 49 4 245 9 27.22 3-58 5.00 MA Starc 3 28 1 138 7 19.71 3-35 4.93 GS Sandhu 3 22 2 135 5 27.00 4-57 6.14 MW Edwards 4 34 3 177 5 35.40 4-31 5.21 DE Bollinger 3 26 - 135 4 33.75 3-62 5.19 HNA Conway 3 26 1 173 2 86.50 2-49 6.65 NJ Maddinson 6 1 - 6 1 6.00 1-1 6.00 MC Henriques 1 2 - 13 0 - - 6.50 WER Somerville 1 1 - 3 0 - - 3.00 PJ Cummins 1 8 2 24 0 - - 3.00 NIC MADDINSON CUTS TO POINT AJ Nair 1 10 - 71 0 - - 7.10

SEAN ABBOTT CELEBRATES A WICKET Cricket NSW Annual Report and Yearbook 2017/18 NSW MOST DISMISSALSBYWICKET-KEEPERS MOST CATCHES BYAFIELDSMAN FASTEST FIFTIES oa 9 6 2 4 4 - 124 2 165 9 297 2 - 1 - 22 - 1 14 21 33 28 - 1 29 1969-70 26 26 1 - 45 47 27 56 25 1973-74 1975-76 1972-73 31 32 Total 59 Others 58 South Australia 1969-70 1971-72 Tasmania Victoria Western Australia Queensland Major Opponents 8Ba ADNVcoi yny2004-05 Sydney Victoria BradHADDIN 38 8SmnKTC amnaHbr 2003-04 2000-01 Hobart Tasmania 38 SimonKATICH A.C.T. BradHADDIN 38 38 36 35 35 35 33 33 32 31 31 31 31 30 25 24 B Balls rgDE 22 55 2 15 9 14 19 20 8 29 76 21 22 35 87 38 90 21 124 S 28 95 65 Greg DYER 159 C 57 Daniel SMITH 87 Steve RIXON D Phil EMERY Peter NEVILL M Brad HADDIN Wicketkeeper oe IHRS6 24 26 27 28 60 28 56 29 32 34 78 47 68 43 56 49 Corey RICHARDS 63 Simon KATICH 77 Dominic THORNELY Moises HENRIQUES Steve PDSMITH Catches Nic MADDINSON Matches Mark TAYLOR Shane LEE Mark WAUGH Fieldsman THORNELY Dominic MADDINSON Nic MADDINSON Nic JAQUES Phil HADDIN Brad WARNER David SMALL Steve COWAN Ed MADDINSON Nic WARNER David JAQUES Phil HIGGS Mark BEVAN Michael WARNER David NASH Don atsman

poetV Opponent Australia Western amnaPrh2017-18 Australia South 2006-07 Perth Tasmania Hobart 2001-02 Tasmania Brisbane Queensland Victoria amnaPrh2017-18 Australia 2017-18 South Perth Hurstville Tasmania CA XI amnaSde 2004-05 Australia South Sydney 2001-02 Tasmania 1992-93 Sydney Queensland Sydney 2008-09 Victoria Hurstville Tasmania Australia Western is ac o otN T NR Lost Won M First Match One Sydney North la odr2014-15 Allan Border Sydney North dlie1992-93 Adelaide olnog2009-10 Wollongong Sydney North enue - Day Season 2004-05 2013-14 2000-01

HIGHEST INDIVIDUALSCORES FASTEST CENTURIES LEADING RUNSCORERS 4Mie ERQE itraNrhSde 2014-15 2013-14 2004-05 2001-02 NorthSydney 2017-18 2003-04 1999-00 NorthSydney NorthSydney 2017-18 Bankstown Hurstville NorthSydney Brisbane Perth 2006-07 2010-11 2007-08 2008-09 2016-17 Sydney Adelaide Western Australia 2011-12 Hobart Victoria NorthSydney 2008-09 Western Australia NorthSydney Victoria 2013-14 NorthSydney 2001-02 Tasmania Hurstville Queensland MoisesHENRIQUES CAXI NorthSydney Bankstown BradHADDIN Season SteveWAUGH Tasmania 94 Australia DavidWARNER Western 94 Venue SouthAustralia MarkWAUGH 93 NicMADDINSON 2003-04 92 Victoria ShaneLEE Tasmania Victoria 92 2017-18 2003-04 2015-16 NicMADDINSON Victoria 90 2005-06 UsmanKHAWAJA 90 2013-14 Tasmania HADDIN Brad 88 2007-08 Victoria DominicTHORNELY Tasmania 88 NicMADDINSON 88 BradHADDIN 87 Opponent Drummoyne Drummoyne 2013-14 DanielSMITH 84 2005-06 DavidWARNER Perth NorthSydney 82 2001-02 Hobart DavidWARNER 77 2015-16 SouthAustralia BradHADDIN 2005-06 76 Hobart Queensland 1981-82 75 Victoria NorthSydney Batsman 74 2008-09 MatthewPHELPS 2009-10 Tasmania Balls Victoria Tasmania StevePDSMITH (140) 2011-12 Sydney SimonKATICH 2016-17 Tasmania Bankstown NicMADDINSON (142) 2013-14 Perth Queensland 136 Adelaide DavidWARNER (129) (119) 136* PhilJAQUES CricketAustraliaXI Sydney (111) 136* Western Australia Hurstville Queensland BradHADDIN (137) 137 Season Sydney DavidWARNER NorthSydney SouthAustralia 138 (116) StevePDSMITH NorthSydney Hurstville (126) 138 SouthAustralia CoreyRICHARDS 138* (122) PhilJAQUES (149) 139 Tasmania CricketAustraliaXI Queensland PhilJAQUES 143* RickMcCOSKER (141) Victoria Venue 151 (141) MoisesHENRIQUES Victoria (144) 152* DavidWARNER 158* (135) PhilJAQUES 164 (139) Opponent DanielSMITH 164* DavidWARNER (143) 165* (122) (141) 171* 179* Batsman 197 (Balls) Score rvrBYIS5 7719 0*612.066.36 29.90 1 6 104* 1196 7 47 50 Trevor BAYLISS asa n ORn S5 0 v Stk-Rt Avg 100 50 HS Runs NO Inn M Batsman tv ML 53 0811412.071.55 28.80 1 4 101 1008 0 35 35 Steve SMALL hn E 35 5515733.387.93 31.53 3 87.97 79.53 55.68 40.13 7 2 2 115 13 16 1545 143* 136* 7 1726 1846 56 10 4 63 41 50 43 56 Shane LEE Steve PDSMITH Simon KATICH tv AG 85 121 3 355.384.64 50.33 5 13 131 2315 11 57 58 Steve WAUGH i ADNO 65 9817953.689.43 38.06 5 9 137 1978 3 55 56 Nic MADDINSON oe IHRS6 6610 5 00 68.88 30.02 2 9 151 1501 6 56 60 Corey RICHARDS dCWN4 8615 1 023.672.55 39.16 106.31 2 42.91 4 10 4 119 73.92 1253 197 28.91 6 1416 1 2 38 11 41 35 108 35 1865 6 Ed COWAN David WARNER 71 78 Dominic THORNELY ihe LRE4 6515 0*713.371.58 68.29 34.13 24.23 1 1 7 7 101* 115 1058 1139 5 2 36 49 40 53 Michael CLARKE Michael SLATER akTYO 94 498 5-3.959.02 30.59 - 15 84 88.00 36.67 1499 2 - 7 49 164* 49 1907 9 Mark TAYLOR 61 68 Moises HENRIQUES akWUH7 3721 2 333.580.75 36.55 73.16 3 61.21 1 13 23 123 135* 2412 7 2571 20 73 62 77 62 Mark WAUGH Michael BEVAN rdHDI 98 7618 653.893.61 34.08 5 16 138* 2726 7 87 89 Brad HADDIN hlJQE 66 3111 96 88.01 39.68 5 9 171* 2341 5 64 66 Phil JAQUES Records etbwigaant -3BLuhi Qenln)a ars2008-09 2014-15 1972-73 2013-14 2015-16 2007-08 2000-01 2000-01 JRHazlewoodatAllanBorderField BLaughlin(Queensland)atCairns 7-36 6-23 DAWarner atNorthSydneyOval MWGoodwin(Western Australia)atPerth 197 165 vQueenslandatBrisbane byCricketAustraliaXIatBankstown Best bowlingagainst: 92 59 Best bowlingfor: Highest scoreagainst: Highest scorefor: vTasmania atBankstown byVictoria atSydney 4-397 Lowest totalagainst: 8-352 Lowest totalfor: Highest totalagainst: Highest totalfor: Records -5 yVcoi tNrhSde 2012-13 byVictoria atNorthSydney 4-352 LEADING WICKET TAKERS Bowler M Overs Mdns Runs Wkts Avg 5W Best RPO Bowler M Overs Mdns Runs Wkts Avg 5W Best RPO Stuart MacGILL 64 538.5 25 2812 127 22.14 4 5-40 5.22 Geoff LAWSON 44 381.3 49 1340 53 25.28 - 4-31 3.51 Shawn 50 303.4 20 1496 47 31.83 - 4-23 4.93 Stuart CLARK 85 752.2 58 3165 105 30.14 - 4-24 4.20 BRADSTREET Brett LEE 29 283.5 22 1293 43 30.06 1 5-47 4.55 Doug BOLLINGER 72 635.0 37 3031 100 30.31 - 4-24 4.77 Dominic 78 262.1 12 1288 40 32.20 - 3-20 4.91 THORNELY Nathan BRACKEN 70 619.0 60 2655 91 29.18 1 5-38 4.29 34 299.4 13 1327 40 33.18 - 3-25 4.43 Wayne Shane LEE 63 385.1 13 1812 61 29.70 - 4-35 4.70 31 247.5 17 1040 36 28.89 1 5-28 4.20 HOLDSWORTH Mike WHITNEY 49 438.0 49 1625 59 27.54 - 4-13 3.71 Steve WAUGH 58 199.0 21 937 35 26.77 - 4-32 4.71 Gavin 33 252.5 19 1035 34 30.44 - 4-46 4.09 Greg MATTHEWS 60 441.4 31 1720 59 29.15 - 4-22 3.89 ROBERTSON Aaron BIRD 25 187.0 7 1051 34 30.91 1 5-26 5.62 Mitchell STARC 19 182.0 14 844 58 14.57 3 6-25 4.64 Nathan LYON 27 229.1 16 1129 34 33.20 - 4-10 4.94 Mark WAUGH 77 202.2 10 1027 31 33.13 - 4-52 5.08 Brad McNAMARA 46 353.4 23 1365 58 23.53 1 6-25 3.86 Glenn McGRATH 23 208.0 26 736 30 24.53 - 4-17 3.54 Matthew Gurinder SANDHU 30 258.3 15 1308 58 22.55 1 5-35 5.05 25 209.2 9 1174 30 39.13 - 3-34 5.61 NICHOLSON Josh 37 348.1 26 1669 56 29.80 1 7-36 4.79 Trevor CHAPPELL 24 185.0 12 715 27 26.48 - 4-35 3.86 HAZLEWOOD Pat CUMMINS 14 118.4 7 609 25 24.36 - 4-26 5.13 Sean ABBOTT 36 249.5 6 1379 55 25.07 - 3-29 5.52 Anthony STUART 16 138.4 11 612 25 24.48 - 4-22 4.41 Moises Trent COPELAND 21 187.1 7 977 25 39.08 1 5-44 5.22 68 403.1 18 2047 54 37.91 - 4-17 5.08 HENRIQUES Steve O’KEEFE 43 295.0 12 1450 25 58.00 - 3-65 4.92

BEST BOWLING IN AN INNINGS MOST APPEARANCES Wkts Bowler Opponent Venue Season Brad HADDIN 89 7-36 Josh HAZLEWOOD South Australia Allan Border 2014-15 Stuart CLARK 85 6-25 Brad McNAMARA Tasmania Sydney 1996-97 Dominic THORNELY 78 6-25 Mitchell STARC CA XI Bankstown 2015-16 Mark WAUGH 77 6-60 Scott COYTE Tasmania Hobart 2011-12 Doug BOLLINGER 72 5-11 Scott THOMPSON Canterbury Christchurch 1993-94 Nathan BRACKEN 70 5-21 Richard DONE Zimbabweans Bulawayo 1985-86 Moises HENRIQUES 68 5-26 Aaron BIRD Queensland Sydney 2008-09 Phil JAQUES 66 5-28 Len PASCOE Western Australia Sydney 1979-80 Phil EMERY 65 5-28 Bob HOLLAND Wellington Wellington 1984-85 Stuart MacGILL 64 5-28 Wayne HOLDSWORTH Queensland Brisbane 1990-91 Shane LEE 63 5-35 Gurinder SANDHU Tasmania Hobart 2012-13 Michael BEVAN 62 5-38 Nathan BRACKEN Victoria Melbourne 2001-02 Peter NEVILL 61 5-39 Mitchell STARC Queensland Brisbane 2011-12 Greg MATTHEWS 60 5-39 Mitchell STARC Tasmania Hurstville 2015-16 Corey RICHARDS 60 5-40 Stuart MacGILL A.C.T. Canberra 1998-99 5-44 Trent COPELAND Western Australia Sydney 2011-12 5-47 Brett LEE Western Australia Perth 2010-11 5-50 Stuart MacGILL Western Australia Sydney 2001-02

MOST ECONOMICAL BOWLING (10 OVERS) Runs Wkts Bowler Opponent Venue Season 10 4 Nathan LYON Queenland North Sydney 2016-17 12 1 Nathan BRACKEN Queensland Sydney 2006-07 14 0 Graham SPRING South Australia Sydney 1982-83 15 0 Greg MATTHEWS Victoria Sydney 1986-87 16 2 Stuart MacGILL A.C.T. Canberra 1997-98 17 4 Glenn McGRATH Queensland Brisbane 1993-94 17 0 Greg MATTHEWS Victoria Sydney 1996-97 18 1 Geoff LAWSON Tasmania Launceston 1983-84 19 2 Len PASCOE Victoria Melbourne 1980-81 19 2 Mike WHITNEY Western Australia Perth 1991-92 20 2 Warwick ADLAM England A Bowral 1991-92

HIGHEST PARTNERSHIP FOR EACH WICKET Wkt Runs Batsman Opponent City Season 1st 253 Rick McCOSKER & John DYSON South Australia Sydney 1981-82 2nd 199 Richard CHEE QUEE & Michael BEVAN Western Australia Sydney 1993-94 3rd 240 Steve WAUGH & Mark WAUGH Victoria North Sydney 1991-92 4th 181 Steve PD SMITH & Moises HENRIQUES Queensland Drummoyne 2015-16 5th 171* Phil JAQUES & Dominic THORNELY South Australia Adelaide 2005-06 6th 105* Steve WAUGH & Mark HIGGS Queensland Sydney 2001-02 6th 105* Peter FORREST & Stephen O’KEEFE Western Australia Hurstville 2010-11 7th 116 Corey RICHARDS & Brad HADDIN South Australia North Sydney 2000-01 8th 93 Stephen O’KEEFE & Nathan HAURITZ Victoria Sydney 2010-11 9th 96* Scott THOMPSON & Shawn BRADSTREET Queensland North Sydney 1998-99 10th 54 Brad McNAMARA & Gavin ROBERTSON South Australia Adelaide 1996-97 MOISES HENRIQUES Cricket NSW Annual Report and Yearbook 2017/18 (For Limited-overandT20matchesthefigurein the5Wcolumnisforfourwicketsininnings) (For Limited-overandT20matchesthefigurein5Wcolumnisforfourwicketsinnings) For NewSouthWales Doug BollingerCareerStatistics Farewells Milk Cup. at 28.37inwhatwasthenknownasthePura during 2006/07whenheclaimed37wickets The breakthroughseasonforBollingercame good chance(earlyon),”Bollingersaid. “I wasprettyrawandtheygavemeareally encouragement. his assistantTrevor Baylissfortheir to formerBluescoachSteveRixonand Bollinger remainsparticularlygrateful and nineT20Internationalscalps. He alsocollected62One-DayInternational Wellington. best fi guresof5-28againstNewZealandin at theimpressiveaverageof25.92with formats. Heclaimed50wicketsin12Tests Bollinger representedAustraliainallthree Lawson andMikeWhitney. fast bowlerofall-timebehindlegendsGeoff cricket andthethirdmostsuccessfulNSW wicket-takers forthestateinfi rstclass which makeshimninthonthelistofleading His careertallyincluded290scalpsforNSW, 411 fi rstclasswicketsonthefi eld. him theadmirationoffansandcontributedto quick worehisheartonsleeve.Itearned Throughout adecoratedcareer, theleft-arm for hiscountry. to playwithhismatesandendedupplaying Seven Hills-Toongabbie RSLasa15-year-old The kidfromWestern Sydneywholobbedat Doug Bollingerbecametheaccidentalhero. 2002-2017 Doug Bollinger–NSW: hne 92.022 0 0 0 0 0 2 0 0 0 11 0 2-22 10 0 0 3-21 3-22 0 0 4-24 1 24.50 2 6-47 33.71 5 30.00 11 30.31 2 49 1-22 4-13 16 708 28.15 420 5-35 5-35 3031 27.66 5-28 25.47 2 8166 21 6-47 14 23.90 27.12 100 249 3541 25.92 290 2 28.06 24 16 1482 5507 72 9 139 1296 89 11533 62 203 50 129 9 Thunder 411 Sixers 134 T20 39 List A First-Class 12 124 T20 T20I List A ODI First-Class Tests a k usAeBs 5w 10w Best Ave 5w 10w Runs Best Wkt Ave Mat Runs Wkt Mat DOUG BOLLINGER SCG in2009. for hiscountryagainstSouthAfricaatthe arena wascompletewhenBollingerdebuted the risefromparkcrickettoTest match It wasonthebackofthoseperformancesthat Pura MilkCuptitlethatcampaign. and waspivotaltotheBluesclaiming with 45fi rstclasswicketsatjust15apiece He thenfollowedthatupthenextseason and alwaysimposedhimselfonthegame. celebrated awicketwithunrestrainedjoy often neededinthedressingroom.He Bollinger wasthelargerthanlifepresence Ed Cowan – NSW: 2005-2009, 2015-2018 Ed Cowan’s love of cricket was obvious from a young age when as a schoolboy he rose before dawn to attend 6am training sessions. When he retired from professional cricket at the end of the 2017/18 season, Cowan boasted more than 10,000 First Class runs and 1,001 runs at Test level for Australia. During 143 fi rst class matches, mostly for the Blues and Tasmania, Cowan scored a magnifi cent 10,097 runs at an average of 41.89. This included six centuries and 14 fi fties for NSW in the Sheffi eld Shield, with a highest score of 212 at the MCG in February 2017. Cowan came through the ranks at Cranbrook School and then Sydney University Cricket Club. Early in his career, the combative left-hander found it diffi cult to break into an enormously ED COWAN talented Blues squad and subsequently made the move to Tasmania, where he scored over 4,000 His fi rst and, as it turned out, only Test century He was the leading run-scorer throughout runs and posted his highest fi rst class score, 225. came in 2012, at against South the Sheffi eld Shield competition in 2016/17 Africa when he made 136 from 257 balls. with 959 runs at the remarkable average A weight of runs in 2011/12 forced his way of 73.76. into calculations for national selection and On his return to NSW in 2015/16, Cowan Cowan made his Test debut on Boxing Day made an immediate impact during that He continues to play Premier Cricket against India at the MCG in 2011. He fi nished campaign, scoring 509 runs and, in the with Sydney University. that Sheffi eld Shield season with 948 runs at twilight of his career, produced one of 59.25, two seasons after he had recorded 957 his best campaigns the next season. runs at 53.16.

Ed Cowan Career Statistics

Type Span Mat H.S. Runs Ave 100 50 Ct Tests 2011/12-2013 18 136 1001 31.28 1 6 24 First-Class 2003-2017/18 143 225 10097 41.89 25 48 94 List A 2004/05-2017/18 98 131* 2984 36.83 4 22 30 T20 2006/07-2015/16 16 70 229 16.35 0 1 2 New South Wales

Type Span Mat H.S. Runs Ave 100 50 Ct First-Class 2004/05-2017/18 45 212 2807 37.42 6 14 27 List A 2004/05-2017/18 41 119 1253 39.15 2 10 11 T20 2006/07-2015/16 4 25 53 13.25 0 0 1 Tasmania

Type Span Mat H.S. Runs Ave 100 50 Ct First-Class 2009/10-2014/15 53 225 4085 44.40 13 16 32 List A 2009/10-2014/15 46 131* 1550 40.78 2 12 16 T20 2009/10-2010/11 3 23 35 11.66 0 0 0 Cricket NSW Annual Report and Yearbook 2017/18 lendlease.com to leavealastinglegacy Supporting theirdreams Lendlease Breakers Coachs Report

LENDLEASE BREAKERS’ COACH JO BROADBENT ADVISING

This season our Lendlease Breakers squad career as the winning Captain of the Breakers, (Strength and Conditioner), Andrew Gilchrist had 19 members, boasting fi ve Australian holding up the trophy one last time. In the (Administrator), Justine Whipper (Player contracted players and 14 state players. fi nal, ’s century and Ellyse Perry’s Development Manager), Gerard Faure-Brac The following players were elevated from our 96 cemented a total over 300 and our bowlers (Psychologist), Jeanne Fourie (Media), Jim Women’s High Performance squad: Mikayla fi nished the job in style, bowling Western Robson (What’s Your Plan B Indoor Centre Hinkley, Saskia Horley, Carly Leeson, Rachel Australia out for 251. Manager) and Satyen Ashar (Facilities). Trenaman, Hannah Trethewy and Tahlia Ellyse Perry’s outstanding season was We also thank Chair of Selectors, Kerry Wilson, while Stefanie Daffara moved to acknowledged with the Belinda Clark Medal Marshall, for her input with selection and for Tasmania and Ash Gardner went to South as the Lendlease Breakers Player of the Year her support as the team’s manager during the Australia. An addition to our squad was former and Rachael Haynes received the NSW WNCL season. Kerry works a lot behind the scenes player Lisa Griffi th, who performed well at Player of the Year award. and contributes to the game while working a the Australian Country Championships and The Lendlease Breakers were well represented full-time role outside of cricket. through the club system after being away in international cricket, with Sarah Aley, Alex Finally, we are extremely grateful to the from the game for six seasons. Blackwell, Lauren Cheatle, Rachael Haynes, Cricket NSW Board, our major sponsor Our pre-season consisted of two City-Country Alyssa Healy, Ellyse Perry, Naomi Stalenberg Lendlease, and Cricket NSW General matches (both won by City), practice matches and Belinda Vakarewa selected for the Manager, Cricket Performance, David Moore against underage regional boys in Coffs Australian Women’s for their ongoing support for the Breakers Harbour and centre-wicket practices at Cricket Team throughout the season. squad and staff to achieve our best. Sunshine Coast and Blacktown International Naomi Stalenberg, , Rachel Joanne Broadbent Sports Park, as well as our weekly training Trenaman and Belinda Vakarewa were Lendlease Breakers Head Coach sessions on Monday, Tuesday and Thursday at selected for Commonwealth Bank Shooting the Sydney Cricket Ground, Sydney University Stars this season. and Blacktown International Sports Park. 2017/18 Lendlease Breakers: Saskia Horley, Rachel Trenaman and Tahlia The Breakers had one of our best seasons, Alex Blackwell (c), Ellyse Perry (vc), Wilson were selected to tour South Africa winning every round match with a bonus point. Sarah Aley, , Lauren Cheatle, with the Under 19 Australian team. ACT challenged us during their encounter by , Maisy Gibson, Lisa Griffi th, taking early wickets; however the true spirit of Our sincere thanks are offered to the following Rachael Haynes, Alyssa Healy, the Breakers shone through with a couple of people who, by constantly challenging Mikayla Hinkley, Saskia Horley, Carly Leeson, steady partnerships and a century from Ellyse our players, helped to set the team’s high Lauren Smith, Naomi Stalenberg, Perry. No other team in the competition could standards: Dominic Thornely (Assistant Rachel Trenaman, Hannah Trethewy, match our skill and determination as we took Coach), , Steve Jenkins and Belinda Vakarewa and . the Ruth Preddey Cup for a 19th time in 22 Mark McInnes (Specialist Coaches), Nicole seasons. Alex Blackwell fi nished her stellar Mepstead (Physiotherapist), Tom Reddin Cricket NSW Annual Report and Yearbook 2017/18 also clinchedthebonuspoint. partnership betweenHaynesandNaomiStalenberg(41notout),that The winwassecuredcourtesyofa100-rununbeatenfi fthwicket partnership whichcontinuedtheBreakers’momentum. Haynes andNicolaCarey(25)combinedfora67-runfourthwicket them down. Perry (17)atthecrease,andevendepartureofdidnotslow However, theBreakersmaintainedahealthyrunratewithHaynesand captain AlexBlackwell(6)withinthefi rstfi veovers. In reply, theBreakerswereinearlytroublelosingAlyssaHealy(5)and provided goodcontributions. Fast bowlerReneFarrell(2-32)andoff-spinnerLaurenSmith(2-40)also the wayforBreakersattack. Ellyse Perry(3-37)startedherseasoningreatformwiththeballandled A steadyfl owofwicketsmeantQueenslandwasbowledoutfor225. way backintothematchwithsometightbowling. Mooney (73)andcaptainKirbyShort(53),theBreakersclawedtheir After a112-runopeningstandfromAustralianbatterBeth successful chase. outstanding forthevictors.Shescored103notoutfrom93ballsin Australian andBreakersopeningbatterRachaelHayneswas Cricket Leaguewithadominantsix-wicketwinoverQueensland. New SouthWales starteditstitledefenceintheWomen’s National Sports ParkNo.2 6 October2017–BlacktownInternational Round 1: Womens xrs2b2w2b29 4wkts226 (55) 41 (45) 25 (20) (93) (5) 17 103 Kimmince 4-0-30-1;Jonassen 8.1-0-42-0;Barsby6-0-34-1;Birkett3-0-21-0. 5 (13) Bowling: Johnson4-1-20-1; Hill5-0-28-1;Harris7-0-31-0;Ferling1-0-18-0; Fall: 82159126 6 (141 min,38.1overs) Extras 2lb25w2nb BW Vakarewa didnotbat 225 (3) 10 LG Smithdidnotbat (1) RM Farrelldidnotbat 2 0 SE Aleydidnotbat (5) MC Hinkleydidnotbat (3) NE Stalenbergnotout 6 NJ CareycShortbBarsby (26) 0 EA PerrycMooneybKimmince (16) 10 (16) *AJ BlackwellcKimmincebJohnson 19 +AJ HealycMooneybHill 15 (63) RL Haynesnotout 53 (58) South Wales WomenNew (20) 27 Aley 4-0-28-0;Carey6-0-37-1;Hinkley2-0-6-1. 10 Bowling: Farrell9.4-1-32-2;Perry9-1-37-3;Smith10-1-40-2;Vakarewa 9-0-38-1; Fall: 112137157183184190205223225 (88) (192 min,49.4overs) 73 Extras 4b3lb2w1nb C HillcHaynesbFarrell HL Ferlingnotout HP BirkettcSmithbPerry SJ JohnsoncStalenbergbFarrell JL BarsbycCareybPerry GM HarrisbPerry JL JonassenlbwbSmith DM KimmincecCareybVakarewa TM CooperstHealybSmith *KLH ShortbCarey +BL MooneycVakarewa bHinkley Queensland Women New SouthWales Women 5pts. Toss: won by6wickets. 6 October, 2017.NewSouthWales Women At BlacktownInternationalSportsparkNo.2, NEW SOUTH WALES WOMEN vQUEENSLAND WOMEN NewSouthWales Women. LendleaseBreakersv. Queensland

National Player oftheMatch: Referee: Scorers: Umpires: TMDonahoo. SJ Woodhouse &IEWright. MAW Nickl&GSStubbings. RL Haynes.

Cricket NSW, astheBreakerscontainedVictoria to7/212. her 10overs.FastbowlerReneFarrell(2-38)wasagainimpressivefor Nicola Careyreturnedthebestfi guresfortheBreakerswith3-26from lower ordersimplyhadtoomuchworktodo. Emma Inglis(63)alsoperformedadmirablyforthevisitors,although keep therunratebelowwhatwasrequired. her teamto2/90inthe22ndover, buttheBreakersdidagoodjobto Victoria madeasolidstarttothechase.SophieMolineux(62)helped Kristen Beams(5-52). limited to9/302,largelythanksafi ve-wickethaulbyleg-spinner However, theBreakerslost7/29infi naleightoversandwere appeared destinedforatotalinexcessof300at3/273. Despite thelossofEllysePerry(30)in43rdover, theBreakers and 94runsforthesecondthirdwickets. 120 balls,andthatwasfollowedbysimilarlybriskpartnershipsof56 The openingstandbetweenHaynesandHealyposted123runsfrom centuries, asthehomesidesetVictoria 303forvictory. captain AlexBlackwell(77)allscoredbetterthanarunballhalf- imposing 90-runwin.RachaelHaynes(83),AlyssaHealy(68)and Superb performancesbytheBreakerstopordersettonefor Sports ParkNo.2 8 October2017–BlacktownInternational Round 2: xrs8b9 n 19 7wkts212 Carey 10-1-26-3. Bowling: Farrell10-0-38-2; Perry7-0-23-1;Smith9-0-46-1;Cheatle7-0-31-0; Aley7-0-40-0; Fall: 5590115127199 211 (183 min,50overs) Extras 8lb9w2nb TJ Vlaeminckdidnotbat HK Brennandidnotbat K em o u 1 (4) (1) 1 0 (10) 2 (10) 5 (45) 31 (82) (39) 63 (41) 16 (70) 13 62 15 (1) 9wkts302 1 *KM Beamsnotout NM FaltumbCarey (15) (7) GL Wareham notout 8 AM KingcStalenbergbFarrell 9 (10) MR StranobPerry 7 +EJ IngliscHaynesbFarrell AJ LanningcBlackwellbCarey (4) (6) MA BlowslbwbSmith SG MolineuxcAleybCarey 2 2 (39) Victoria Women (73) 30 Beams 10-0-52-5;King7-0-25-1;Blows1-0-14-0. (66) 77 (79) Bowling: Vlaeminck7-0-59-0;Brennan5-0-42-0;Strano10-1-39-3;Molineux10-0-64-0; 68 Fall: 123179273275283285298302 83 (188 min,50overs) Extras 7lb7w1nb LR Cheatledidnotbat LG Smithnotout RM FarrellcKingbBeams SE AleylbwbBeams MC HinkleylbwbBeams NE StalenbergcBrennanbStrano NJ CareycMolineuxbBeams EA PerrycVlaeminckbStrano *AJ BlackwellcKingbBeams +AJ HealycVlaeminckbKing RL HaynescBlowsbStrano New South Wales Women Women 5pts. Toss: won by90runs. 8 October2017.NewSouthWales Women At BlacktownInternationalSportsparkNo.2, SOUTH WALESNEW v VICTORIA WOMEN WOMEN Victoria Women. NewSouthWales

Lendlease Breakersv. Victoria League Scorers: Umpires: Player oftheMatch: Referee: TMDonahoo. TJ Lorraine&SJWoodhouse. A Hobson&RMNelson. RL Haynes. Round 3: Lendlease Breakers v. Western Australia Round 4: Lendlease Breakers v. Australian Capital 25 November 2017 – Murdoch University Ground, Territory 26 November 2017 – Murdoch University Perth Ground, Perth New South Wales continued that winning feeling when they travelled Ellyse Perry scored 127 not out from 120 deliveries in the emphatic 97- to Perth. run victory. Her knock included 13 fours and three sixes. Australian wicketkeeper-batter Alyssa Healy was the star performer for After captain Alex Blackwell won the toss and elected to bat, the the Breakers in the seven-wicket triumph. Breakers posted 7/246 from their allotted 50 overs. Healy fell agonisingly short of her fi rst century of the season after she Wickets tumbled early on as NSW lost 4/27 in its fi rst 10 overs. South hit 99 from just 89 balls to help secure the win, as NSW chased down African medium-pace bowler (4-24) was the main 240 for victory with more than 10 overs in hand. destroyer for the ACT. She claimed the vital scalps of Alyssa Healy (7) However, it was once again the bowling attack that set up the Breakers’ and Blackwell (11). third consecutive victory. Perry held the innings together and consecutive partnerships of 58 and Off-spinner Lauren Smith (3-52) opened the bowling for the Breakers 70 runs with Naomi Stalenberg (23) and Mikayla Hinkley (24) guided the and returned the best fi gures for NSW. The next best fi gures were Breakers out of trouble. claimed by Sarah Aley (2-31). In the fi nal 10 overs, Perry continued to score freely and combined with In reply, Healy and Breakers captain Alex Blackwell (68) combined for Rene Farrell for an unbeaten 86-run stand. yet another imposing start with the bat. Farrell was as uncompromising as Perry during an aggressive 35 not out The pair added 165 runs from just 157 balls to immediately put the from 31 balls. visitors on the front foot in the chase. The fast bowler carried on that good form with the ball. She claimed A century appeared a certainty for Healy, but her dynamic innings was the important wickets of for a and ACT captain Erin ended one run shy of by Piepa Cleary (1-34). Osborne (7) in her fi rst two overs. Farrell fi nished with 4-35. The wicket of Healy did not stop the Breakers though, as Blackwell and The run chase never gained suffi cient momentum as the Breakers Perry continued to score at a run a ball. dismissed the ACT for 149 in the 44th over. Both Aley (3-26) and Carey (3-28) also returned excellent fi gures in the bonus point victory. Perry scored 45 not out from 49 balls, and together with Naomi Stalenberg (17 not out), clinched the bonus point victory.

WESTERN AUSTRALIA WOMEN v NEW SOUTH WALES WOMEN CAPITAL TERRITORY WOMEN v NEW SOUTH WALES WOMEN At Murdoch University Ground, Perth, Umpires: J Paterson & T Steenholdt. At Murdoch University Ground, Perth, 26 Umpires: JP Hewitt & J Paterson. 25 November, 2017. New South Wales Scorers: D Dixon & S Rodgers. November, 2017. New South Wales Women Scorers: D Dixon & S Rodgers. Women won by 7 wickets. Referee: TA Prue. won by 97 runs Referee: JP Biddiss. Toss: New South Wales Women. Player of the Match: AJ Healy. Toss: New South Wales Women. Player of the Match: EA Perry. New South Wales Women 5 pts. New South Wales Women 5 pts. Western Australia Women New South Wales Women C Piparo c Farrell b Stalenberg 15 (28) RL Haynes c Leys b Bates 4 (6) NE Bolton c Gibson b Smith 0 (5) +AJ Healy c Koski b Kapp 7 (18) *EJ Villani c Aley b Farrell 34 (43) *AJ Blackwell lbw b Kapp 11 (29) HL Graham lbw b Aley 18 (31) EA Perry not out 127 (120) AR Jason-Jones c Perry b Aley 67 (70) NJ Carey b Kapp 0 (1) MG Carmichael c Smith b Carey 12 (25) NE Stalenberg lbw b Osborne 23 (43) +MP Banting c Stalenberg b Smith 50 (54) MC Hinkley c & b Bates 24 (50) KL Cross b Perry 5 (19) SE Aley c Reakes b Kapp 0 (2) PM Cleary st Healy b Smith 10 (17) RM Farrell not out 35 (31) T Peschel run out (Aley-Carey) 7 (6) LG Smith did not bat EL King not out 4 (4) ML Gibson did not bat Extras 1b 4lb 10w 2nb 17 Extras 5lb 5w 5 pen 15 (195 min, 50 overs) 239 (182 min, 50 overs) 7 wkts 246 Fall: 4 50 60 90 129 185 202 219 232 239 Fall: 5 24 27 27 85 155 160 Bowling: Smith 10-1-52-3; Perry 10-1-43-1; Farrell 10-0-38-1; Stalenberg 2-0-5-1; Bowling: Bates 10-0-37-2; Kapp 10-2-24-4; Hancock 9-0-57-0; Osborne 10-0-56-1; Carey 8-0-41-1; Aley 7-0-31-2; Gibson 3-0-24-0. Jensen 10-0-52-0; Burns 1-0-10-0. New South Wales Women Australian Capital Territory Women +AJ Healy c Peschel b Cleary 99 (89) KM Mack c Aley b Farrell 0 (2) *AJ Blackwell c Cross b Peschel 68 (82) HNK Jensen lbw b Aley 11 (24) EA Perry not out 45 (49) *EA Osborne b Farrell 7 (12) NJ Carey run out (Bolton) 0 (1) EA Burns b Carey 14 (28) NE Stalenberg not out 17 (16) AR Reakes c Healy b Aley 4 (2) RL Haynes did not bat M Kapp b Farrell 1 (7) MC Hinkley did not bat CJ Koski b Carey 14 (22) SE Aley did not bat +E Kershaw not out 36 (80) RM Farrell did not bat EA Leys c sub b Farrell 16 (41) LG Smith did not bat NM Hancock c Healy b Carey 13 (31) ML Gibson did not bat SL Bates c sub b Aley 5 (8) Extras 1b 1lb 9w 1nb 12 Extras 4b 5lb 19w 28 (39.2 overs) 3 wkts 241 (153 min, 43.3 overs) 149 Fall: 165 202 202 Fall: 1 9 34 38 42 59 73 106 142 149 Bowling: Cleary 6-0-34-1; Cross 7.2-0-50-0; Peschel 10-0-56-1; Graham 9-0-44-0; Bowling: Farrell 10-2-35-4; Perry 6-1-18-0; Aley 8.5-2-26-3; Carey 8-1-28-3; King 5-0-42-0; Bolton 2-0-13-0. Gibson 10-0-33-0. Cricket NSW Annual Report and Yearbook 2017/18 The mannerofvictorysecuredtheBreakersanotherbonuspoint. confi rmthewin. , whotogetherwithHaynes,added60from42ballstoallbut The departureofHealybroughtcaptainAlexBlackwell(19)tothe Breakers’ openingpairadded64runsinthefi rst11overs. Haynes andAlyssaHealy(35)madealightningstarttothechase.The multiple wickettakers. Spinners MaisyGibson(2-24)andLaurenSmith(2-39)joinedFarrellas that pointon,theBreakerstook9/73todismissTasmania for175. The wicketofStefanieDaffara(63)followedtwooverslater, andfrom Redmayne (44),bowledbyBelindaVakarewa (1-21),waspivotal. but thedismissalofformerBreakerswicketkeeper-batter Georgia Tasmania appearedtobeinastrongpositionat1/102the31stover, from 10overs. Breakers spearheadReneFarrellclaimedthemiserlyfi guresof3-24 victory. NSWfi nishedthematch3/179in27overs. In pursuitof176fortheirfi fthstraightwin,theBreakershurtledto fours andthreesixes. the runchase.Shescoredanunbeaten92from71ballsincluding10 Haynes wasunrelentinginherassaultontheTasmanian attackduring during itsseven-wicketvictoryoverTasmania. Rachael HaynescontinuedheroutstandingformforNewSouthWales 16 February2018–LindisfarneOval,Hobart Round 5 xrs1b8 9 3wkts179 (19) 9 (17) (71) (36) 15 92 35 Thompson 3-0-21-0;Phillips1-0-16-0. Bowling: Pyke8-0-44-0;Raack8-0-44-1;Joyce 2-0-22-1;Fazackerley5-0-31-1; (19) Fall: 64124163 19 (93 min,27overs) Extras 1lb8w BW Vakarewa didnotbat ML Gibsondidnotbat LG Smithdidnotbat SE Aleydidnotbat RM Farrelldidnotbat NJ Careydidnotbat NE Stalenbergnotout EA PerrycHepburnbRaack *AJ BlackwellcWrightbFazackerley +AJ Healyc&bJoyce RL Haynesnotout South Wales WomenNew ac o u 0(8) 9 175 0 (0) 0 (17) (7) 13 (4) (25) (15) 6 0 16 9 (35) (91) 13 63 (84) Gibson 5.3-0-24-2;Smith10-1-39-2;Carey7-1-32-0. (12) 44 Bowling: Farrell10-4-24-3;Perry5-1-14-0;Vakarewa 5-0-21-1;Aley7-1-18-0; 2 Fall: 4102113143152154169175 (177 min,49.3overs) Extras 3lb5w1nb C Raacknotout *BL Hepburnrunout EG FazackerleycBlackwellbFarrell V PykecHealybGibson E ThompsoncFarrellbGibson M PhillipslbwbSmith IMHC Joycerunout(Gibson) CL HallbSmith SG DaffaralbwbFarrell +GP RedmaynebVakarewa LE WrightcCareybFarrell Tasmania Women New SouthWales Women 5pts. wickets. New SouthWales Women wonby7 At LindisfarneOval,16February, 2018. TASMANIA WOMEN vNEWSOUTH WALES WOMEN Womens Toss: : LendleaseBreakersv. Tasmania New SouthWales Women.

National Player oftheMatch: Referee: Scorers: Umpires:

Cricket L Hayes&RLoh. DRClose&WStewart. SJ Davis.

League RLHaynes. spinner LaurenSmith(2-24)alsochippedinwithvaluablecontributions. It lost8/60inalittlemorethan17overs.NicolaCarey(2-22)andoff- collapsed. Tahlia McGrath(48)inthe21stoverSouthAustralianbattingorder South Australiarecoveredtoreach2/109,however, oncePerryremoved Australia 2/17inthesixthover. and ReneFarrell(2-38)claimedthesecondshortlyaftertoleaveSouth dismissed Tegan McPharlinforaduckwiththelastballoffi rstover, In reply, SouthAustraliamadealessthanidealstart.Perry(2-30) quick runs.NaomiStalenbergcontributedahandy30from41balls. The Breakerslost6/61inthelatterstagesoftheirinningssearch then ensuedtotakethescorepast200. Another valuable74-runpartnershipbetweenBlackwellandPerry(42) score to132. Haynes andBlackwellputon90forthesecondwickettomove dismiss SouthAustraliafor169indefenceof9/272. It wasalsoacompleteteambowlingperformancebytheBreakersto Alex Blackwell(76). Rachael Haynes,whoscored76from67balls,andBreakerscaptain It washighlightedbysomeaccomplishedtop-orderbattingfrom 103-run bonuspointvictoryoverSouthAustralia The Breakerssecuredaberthintheir22ndstraightWNCLFinalwith 18 February2018–LindisfarneOval,Hobart Round 6: xrs2 2 (8) 169 2 (25) 5 Gibson 4-1-20-1;Vakarewa 2.5-0-7-1. Bowling: Perry7-0-30-2;Farrell6-2-38-2;Aley 5-0-28-0; Carey6-0-22-2;Smith7-1-24-2; Fall: 117109110114133155157165169 (140 min,37.5overs) Extras 2w SM Bettsnotout A PricecStalenbergbVakarewa LSht el mt 6 (18) (13) 6 14 (15) 9 (9) (6) 2 1 (52) 73 (60) (15) (6) 48 7 0 11 (0) (6) 9wkts272 ML SchuttcHealybSmith 0 2 SJ LowelbwbGibson T SavillecCareybSmith (2) (22) A Wellington cHealybCarey (17) (1) 2 AK GardnercHealybCarey 16 11 SFM DevinecCareybFarrell 0 TM McGrathcVakarewa bPerry BE PattersoncHaynesbFarrell (44) (78) *+TJ McPharlincSmithbPerry 42 (41) 76 South Australia Women (22) 30 Gardner 9-0-52-1;Price3-0-25-0;Lowe5-0-25-1;Wellington 9-0-45-2. 6 (67) Bowling: Schutt10-2-25-2;Devine7-0-48-1;Betts4-0-24-1;McGrath3-0-26-0; 76 Fall: 42132206211232261268271 (188 min,50overs) Extras 1b1lb9w BW Vakarewa notout ML Gibsonnotout LG Smithrunout(Wellington) SE AleycGardnerbWellington RM FarrellbGardner NJ CareybSchutt NE StalenbergcBettsbWellington EA PerrycLowebDevine *AJ BlackwellbSchutt +AJ HealycSchuttbBetts RL HaynescSchuttbLowe New South Wales Women New SouthWales Women 5pts. Toss: New SouthWales Women wonby103runs. At LindisfarneOval,18February, 2018. NEW SOUTH WALES WOMEN vSOUTH AUSTRALIA WOMEN New SouthWales Women. LendleaseBreakersv. SouthAustralia Umpires: Player oftheMatch: Referee: Scorers: LHayes&RLoh. SJDavis. MQureshi&WStewart. AJ Blackwell. Womens National Cricket League Final Final: Lendlease Breakers v. Western Australia 24 February 2018 – Blacktown International Sports Park No. 2

New South Wales provided the fi tting farewell for retiring Breakers NSW fi nished its allotted 50 overs at 6/302 and, in response, Western great and captain Alex Blackwell, as the Breakers claimed their 19th Australia were keen to give themselves the best possible opportunity of WNCL title in 22 years with another superior performance in the Final victory. against Western Australia. Despite the loss of Australian opening batter (15) in the It completed an extraordinary tournament of dominance for the seventh over, behind off the bowling of opening bowler Rene Breakers, who fi nished the competition undefeated. Farrell (2-31), the visitors recovered to be 1/82 in the 19th over. Australian wicketkeeper-batter Alyssa Healy starred for the Breakers, Nicola Carey (2-49) then struck twice in the space of two overs to put producing her best performance of the tournament in the match that Western Australia on the back foot in the chase. mattered most. (74) and (59) gave Western Australia some The Player of the Final sent the ball to the 18 times during her hope of victory, but a methodical bowling performance supported by match-defi ning knock of 122 from 109 balls. fi elding of the highest calibre steadily increased the required run-rate, Australian allrounder Ellyse Perry was also outstanding for the eventual and the consistent loss of wickets made the task that much harder. champions. Her innings of 96 from as many balls took her to 372 runs Sarah Aley (3-37) completed the job by claiming the fi nal wicket of for the season at 74.40. Emma King for a second ball duck in the 48th over to dismiss Western Perry fi nished the season as the Breakers’ leading run-scorer, nine Australia for 251. runs ahead of Rachael Haynes, who scored 363 runs at the incredible Farrell fi nished with the excellent fi gures of 2-31 from nine overs to average of 90.75. fi nish as the Breakers leading wicket taker with 16 scalps. Perry (2-38) Blackwell made a solid 24 from 43 balls in the fi nal innings of her and Carey also provided valuable contributions with the ball in the professional career. 51-run win.

FINAL – NEW SOUTH WALES WOMEN v WESTERN AUSTRALIA WOMEN At Blacktown International Sportspark No.2, 24 February, 2018. Scorers: D Mattison & CG Wilcoxon. New South Wales Women won by 51 runs. Toss: New South Wales Women. Referee: RL Parry. Umpires: DR Close & NR Johnstone. Player of the Match: AJ Healy. TV Umpire: BC Treloar.

New South Wales Women Western Australia Women RL Haynes c Jones b Cleary 5 (6) NE Bolton c Healy b Farrell 15 (19) +AJ Healy c Cross b Graham 122 (109) C Piparo c Smith b Carey 29 (56) *AJ Blackwell lbw b Bolton 24 (43) *EJ Villani c Perry b Farrell 74 (67) EA Perry c King b Graham 96 (96) HL Graham b Carey 5 (3) NE Stalenberg c Banting b Cross 28 (33) +AE Jones c Healy b Perry 59 (64) NJ Carey c Carmichael b Cross 7 (7) MG Carmichael c & b Perry 8 (17) RM Farrell not out 8 (6) MP Banting not out 22 (26) SE Aley did not bat KL Cross c Blackwell b Aley 12 (11) LG Smith did not bat PM Cleary c & b Aley 14 (14) ML Gibson did not bat T Peschel run out (Aley) 2 (5) BW Vakarewa did not bat EL King c Stalenberg b Aley 0 (2) Extras 4lb 8w 12 Extras 3b 4lb 4w 11 (204 min, 50 overs) 6 wkts 302 (191 min, 47.2 overs) 251 Fall: 5 67 214 278 288 302 Fall: 23 82 93 158 184 201 218 239 245 251 Bowling: Cross 10-3-35-2; Cleary 10-0-62-1; Peschel 5-0-42-0; Graham 10-0-58-2; Bowling: Farrell 9-0-31-2; Perry 8-1-38-2; Aley 7.2-0-37-3; Vakarewa 3-0-21-0; Bolton 3-0-26-1; King 10-0-60-0; Villani 2-0-15-0. Gibson 9-1-41-0; Carey 8-0-49-2; Smith 3-0-27-0.

ALEX BLACKWELL CELEBRATES ANOTHER WNCL TITLE WITH HER BREAKERS TEAM MATES Cricket NSW Annual Report and Yearbook 2017/18 Alex BlackwellCareerStatistics just 111ballsatthetopoforder. times, andoveritonce,asshemade157from ball totheboundaryofNorthSydneyOval21 Breakers in2010againstTasmania, sendingthe Blackwell postedherpersonalbestscoreforthe run-scorer forNSWintheWNCL. 30 half-centuries,andbecametheleading from 139matches,including11centuriesand 4,788 runsfortheNSWBreakersat46.94 echelons offemalecricket,Blackwellscored Over morethanadecadeattheupper against EnglandinLincoln,NewZealand. international debutsoonfollowedinearly2003, for NewSouthWales in2001/02andher senior domesticdebutasabowlingallrounder The prodigiousright-handedbattermadeher over Western Australia intheFinal. title in22yearswithaconvincing51-runwin style, leadingtheBreakerstotheir19thWNCL Blackwell fi nishedherincrediblecareerin women’s cricketinNSWandAustralia.” Margaret Pedenduringtheveryearlydaysof female cricketersandleadersdatingbackto leader, thelatestinalonglineofgreatNSW “More thanthat,she’s awonderful,wonderful as captain,”MrJonessaid. T20 titlesandfi veWorld Cups,manyofthose National CricketLeaguetitles,threedomestic “She haswonanextraordinary14Women’s year career. her achievementsthroughoutabrilliant16- Jones, echoedthosesentimentsandlauded Cricket NSWChiefExecutiveOffi cer, Andrew play forAustraliaandNSW. most successfulcareersofanycricketerto female playermarkedtheendtooneof In February2018,Australia’s mostcapped one ofthegreatsgame. consummate professional,admiredleaderand cricketer willforeverberememberedasthe Alex Blackwellthewomanand Alex BlackwellNSW: 2001-2018 Farewells In WBBL For NewSouthWales 2 86 6 9 965.3011 0 54.33 1956 99* 26 62 68 T20 hne 44 4 1 143.003 0 1 4 37.80 0 1134 0 21.19 81* 22.20 1314 14 444 61 44 74 19 44 2 81 22 Thunder 95 12 T20I Tests NL19182 5 784.41 30 11 46.94 4788 157 27 128 139 WNCL D 4 2 71439 60 25 3 36.00 3492 114 27 124 144 ODI a n OH usAe1050 100 50 Ave 100 50 Runs Ave 100 HS Runs Ave NO HS Runs Inn NO HS Mat Inn NO Mat Inn Mat excellent strikerateof92.92. within theT20Internationalarenaat She alsoposted1,314runsforAustralia highest scoreof74. Australia andscored444runswitha Blackwell played12Test matchesfor including threecenturiesand25fi fties. matches forAustraliawith3,492runs extraordinary 144One-DayInternational Her remarkablecareerincludedan behind onlyMegLanning. Rolton andsecondinT20runsforAustralia and BreakersgreatBelindaClarkKaren scorers forAustraliabehindformerAustralian Blackwell isthirdonthelistofone-dayrun- domestic matchesfortheBreakers. She alsoscored1,956runsat54.33in68T20 ALEX BLACKWELL the inauguralWBBLtitle. Sydney Thunder, whichshecaptainedto Blackwell willcontinuetoplayforthe caps innationalcolours. almost 100capsforNSWandover50 Kate hadherownfi necareer, earning In awonderfulpieceoffamilyhistory, twin sisterKatefortheBreakers. for morethanadecadeplayedalongsideher Griffi th,intheRiverinaregionofNSW, and Blackwell wasbroughtupinYenda and Canberra, inFebruary2016. from 112ballsagainstIndiaatManukaOval, Her highestscoreforhercountrywas114 WNCL Season Statistics

2017/18 WOMEN’S NATIONAL CRICKET LEAGUE POINTS TABLE Team Played Won Tied Lost BP Points NRR New South Wales 6 6 0 0 6 30 1.8636 Western Australia 6 5 0 1 2 22 0.6216 South Australia 6 3 0 3 3 15 0.0213 ACT 6 3 0 3 2 14 0.0534 Queensland 6 2 0 4 3 11 0.0804 Victoria 6 2 0 4 0 8 -0.8665 Tasmania 6 0 0 6 0 0 -1.7535 Net run-rate was calculated by subtracting runs conceded per over from runs scored per over.

2017/18 WOMEN’S NATIONAL CRICKET LEAGUE PERFORMANCES BATTING M Inn NO Runs HS Avge 50 100 Ct St Stk-Rt EA Perry 7 7 2 372 127* 74.40 1 1 3 - 96.62 RL Haynes 7 6 2 363 103* 90.75 3 1 3 - 113.08 AJ Healy 7 7 - 342 122 48.86 2 1 8 2 99.13 RACHAEL HAYNES AJ Blackwell 7 7 - 281 77 40.14 3 - 3 - 83.38 NE Stalenburg 7 7 3 150 41* 37.50 - - 5 - 70.42 RM Farrell 7 4 2 68 35* 34.00 - - 2 - 103.03 NJ Carey 7 6 - 45 25 7.50 - - 5 - 60.00 MC Hinkley 4 2 - 31 24 15.50 - - - - 51.67 SE Aley 7 3 - 8 8 2.67 - - 4 - 44.44 LG Smith 7 2 1 3 2 3.00 - - 4 - 100.00 ML Gibson 5 1 1 2 2* - - - 1 - 33.33 BW Vakarewa 4 1 1 0 0* - - - 2 - - LR Cheatle 1 ------

BOWLING M Overs Mdns Runs Wkts Avge Best RPO RM Farrell 7 64.4 9 236 16 14.75 4-35 3.65 NJ Carey 7 53 3 235 12 19.58 3-26 4.43 LG Smith 7 49 4 228 10 22.80 3-52 4.65 EA Perry 7 52 5 203 9 22.56 3-37 3.90 SE Aley 7 46.1 3 208 8 26.00 3-26 4.51 BW Vakarewa 4 19.5 - 87 3 29.00 1-7 4.39 RENE FARRELL ML Gibson 5 31.3 2 142 3 47.33 2-24 4.51 NE Stalenburg 7 2 - 5 1 5.00 1-5 2.50 MC Hinkley 4 2 - 6 1 6.00 1-6 3.00 LR Cheatle 1 7 - 31 0 - - 4.43

ALYSSA HEALY PLAYS TO LEG Cricket NSW Annual Report and Yearbook 2017/18 MOST DISMISSALSBYWICKET-KEEPERS MOST CATCHES BYAFIELDER MOST APPEARANCES LAUREN SMITH NSW oa 9 6 611 1 36 160 1 198 - 1 - - 19 1 - 39 - - 7 60 1 - - 1996-97 8 9 5 9 Total 2010-11 32 35 10 Western Australia 2009-10 41 40 Victoria 1996-97 1996-97 Tasmania South Australia Queensland ACT Opponents Major en ALC 82 84 25 18 62 37 22 87 S 61 18 67 23 98 C 99 24 D 24 24 25 66 M Jenny WALLACE 26 33 Alyssa HEALY 101 80 51 35 45 46 Wicketkeeper 91 111 52 47 61 109 Martha WINCH Michelle GOSZKO 145 66 68 139 Catches Nicola CAREY Matches Lisa KEIGHTLEY 76 80 83 80 Belinda CLARK Sarah ALEY Lisa STHALEKAR 83 91 Alex BLACKWELL Fielder 98 101 109 105 111 Martha WINCH Ellyse PERRY 139 145 Bronwyn CALVER Matches Alyssa HEALY Sarah ANDREWS Lisa KEIGHTLEY Leonie COLEMAN Michelle GOSZKO Sarah ALEY Julie HAYES Alex BLACKWELL Lisa STHALEKAR Players Match 969 03 - - 1 39 40 1996-97 First

WNCL WLNRTMW

Records HIGHEST INDIVIDUALSCORES LEADING RUNSCORERS 0*(1)Ae LCWL ot utai dlieN. 2008-09 2005-06 2004-05 2015-16 1996-97 2016-17 2017-18 NorthSydney No.2 Adelaide No.2 2003-04 Newcastle Manuka 2013-14 Blacktown Waitara Blacktown 2 1998-99 2009-10 SouthAustralia NorthSydney 1999-00 2014-15 SouthAustralia 2016-17 AlexBLACKWELL WACA Launceston Western Australia Western Australia MarthaWINCH 2009-10 2012-13 Trinity College KateBLACKWELL Waitara (116) 2015-16 Queensland LisaKEIGHTLEY 2015-16 (77) EllysePERRY ACT (114) Floreat 101* Western Australia RachaelHAYNES 2015-16 Brisbane Manly (138) 2017-18 Blacktown 101* Western Australia AlexBLACKWELL 2017-18 (120) Manuka 2000-01 Western Australia 102 LisaSTHALEKAR Tasmania (92) 102* LisaSTHALEKAR (123) WACA Western Australia Manuka 103 2011-12 (111) BelindaCLARK Blacktown2 103* LeahPOULTON Western Australia Hurstville MurdochUni 2005-06 (93) 108 LisaKEIGHTLEY Queensland Hurstville (126) 108 AlexBLACKWELL Tasmania 2011-12 (115) 1996-97 108* (156) AlexBLACKWELL 2012-13 SouthAustralia 108* RachaelHAYNES Western Australia ACT (97) Hobart 2014-15 2016-17 109 2009-10 AlexBLACKWELL (117) Western Australia WACA 112 Queensland 2010-11 (120) AlexBLACKWELL ACT 112* AlyssaHEALY (139) Beenleigh 113* Blacktown ACT BelindaCLARK SCG (107) Trinity College 115 AlyssaHEALY (109) Blacktown 118* EllysePERRY Brisbane Western Australia NorthSydney Season (153) 121* (138) EllysePERRY Tasmania 122 AlexBLACKWELL (115) Western Australia 122* Western Australia AlexBLACKWELL (120) Queensland Western Australia 124 (133) AlexBLACKWELL Venue AlexBLACKWELL 126 (125) Victoria 127* LisaKEIGHTLEY (110) Tasmania AlyssaHEALY Tasmania 130 (143) RachaelHAYNES 132* (158) AlexBLACKWELL 135* (137) AlyssaHEALY 138 Opponent (139) 144* (111) 146 (116) 156 Batsman 157 159 (Balls) Score etbwigfr -1Els er C tDumye2010-11 2004-05 2005-06 2016-17 2006-07 2009-10 2016-17 2010-11 EllysePerryvACTatDrummoyne CatherineFitzpatrick(Vic) atGlenWaverley 5-11 AlyssaHealyvTasmania atBrisbane 6-22 byKarenRolton(SA)atNewcastle vVictoria atBankstown bySouthAustraliaatBankstown 159 141* Best bowlingagainst: 71 45 Best bowlingfor: vTasmania atNorthSydney byQueenslandatBrisbane Highest scoreagainst: Highest scorefor: 5-395 3-318 Lowest totalagainst: Lowest totalfor: Highest totalagainst: Highest totalfor: Records ui AE 1 32 7 8 11.12 - 1 58* 578 21 73 111 Julie HAYES lsaHAY8 1722 5 3434.81 4 13 159 46.94 2228 11 7 30 71 157 4788 83 27 129 139 Alyssa HEALY Alex BLACKWELL asa n ORn S5 0 Avg 100 50 HS Runs NO Inn M Batsman aa LY195 3616 14.67 - 25.58 - 28.47 1 - 6 69 5 95 631 72 665 13 911 2 56 6 28 109 38 30 41 Sarah ALEY Shannon CUNNEEN aeBAKEL7 52 48121 33.67 1 10 102 1448 22 65 76 Kate BLACKWELL ioaCRY4 24616 22.54 - 3 65 631 4 32 46 Nicola CAREY lyePRY6 71 5917 45.85 3 8 127* 1559 13 47 68 Ellyse PERRY ataWNH6 21 1511 23.57 1 4 101* 1155 13 62 66 Martha WINCH ihleGSK 0 8821 51 26.84 - 14 85 2416 8 98 101 Michelle GOSZKO ahe ANS5 8516 5 4345.67 55.64 3 2 14 22 156 122* 1964 2170 5 8 48 47 50 47 Rachael HAYNES Belinda CLARK ehPUTN15121 71191 30.12 37.12 1 3 34.14 19 21 2 109 144* 17 2741 3081 108* 11 3414 8 102 29 91 129 105 91 145 Leah POULTON Lisa KEIGHTLEY Lisa STHALEKAR LEADING WICKET TAKERS Bowler M Overs Mdns Runs Wkts Avg 5w Best RPO Lisa STHALEKAR 145 1203 188 3644 166 21.95 - 4-7 3.03 Julie HAYES 111 955.1 163 3030 112 27.05 - 4-12 3.17 Ellyse PERRY 68 548.2 66 2011 104 19.34 2 5-11 3.67 Emma LIDDELL 80 678.5 117 2109 100 21.09 - 4-33 3.11 Bronwyn CALVER 80 697 134 2172 94 23.11 - 3-18 3.12 Sarah ANDREWS 83 599.5 89 1992 89 22.38 1 5-16 3.32 Sarah ALEY 109 569.5 51 2269 87 26.08 - 4-35 3.98 Erin OSBORNE 51 366.3 40 1208 65 18.58 - 4-18 3.34 Therese MCGREGOR 47 403 78 1228 64 19.19 - 4-15 3.05 Rene FARRELL 32 238.4 24 933 50 18.66 - 4-35 3.91 43 245.4 22 980 44 22.27 - 4-25 3.99 48 229.3 7 1048 44 23.82 - 4-10 4.57 Sharon MILLANTA 64 372.3 48 1389 43 32.30 - 4-24 3.73 Nicola CAREY 46 172.3 13 692 36 19.22 - 3-26 4.01 Charlotte ANNEVELD 29 194 22 712 34 20.94 - 4-29 3.67 Lauren SMITH 26 163.4 9 736 31 23.74 - 4-35 4.50 Debbie NELSON 32 181.4 24 692 29 23.86 - 3-9 3.81

BEST BOWLING IN AN INNINGS Wkts Bowler Opponent City Season 5-11 Ellyse PERRY ACT Drummoyne 2010-11 5-16 Sarah ANDREWS Victoria Glen Waverley 2005-06 5-19 Ellyse PERRY South Australia Bankstown 2009-10 4-7 Victoria Glen Waverley 2005-06 4-10 Ellyse PERRY Tasmania North Sydney 2010-11 4-10 Angela REAKES South Australia Prospect 2012-13 4-12 Julie HAYES Queensland Allan Border 2002-03 4-12 Lisa STHALEKAR South Australia Manly 2011-12 4-13 Jo GAREY South Australia Park 25 1996-97 4-14 Lisa STHALEKAR Western Australia Aquinas 2009-10 4-15 Therese McGREGOR Western Australia Scotch College 1997-98 NICOLA CAREY 4-18 Erin OSBORNE Victoria Hurstville 2008-09 HIGHEST PARTNERSHIP FOR EACH WICKET Wkt Runs Batters Opponent City Season 1st 179 Rachael HAYNES & Alyssa HEALY Tasmania Brisbane 2016-17 2nd 165 Belinda CLARK & Sally GRIFFITHS Victoria Sydney 1996-97 3rd 232 Alex BLACKWELL & Ellyse PERRY ACT Manuka 2015-16 4th 129 Alyssa HEALY & Ellyse PERRY Western Australia Blacktown 2014-15 5th 122 Lisa STHALEKAR & Sarah COYTE Victoria Blacktown 2011-12 6th 111 Leah POULTON & Ellyse PERRY Tasmania Launceston 2013-14 7th 94 Leah POULTON & Nicola CAREY Queensland 2014-15 8th 86 Ellyse PERRY & Rene FARRELL ACT Murdoch University 2017-18 9th 59 Angela REAKES & Sarah ALEY South Australia Adelaide No.2 2014-15 10th 38 Leonie COLEMAN & Rene FARRELL South Australia Bankstown 2007-08

ELLYSE PERRY THE SYDNEY SIXERSWOULD LIKETO THANKALLCLUB PARTNERS FOR THEIRCOMMITMENT ANDSUPPORT THROUGH BBL|07ANDWBBL|03 THE SYDNEY THUNDER WOULD LIKETO THANK ALL CLUB PARTNERS FOR THEIR COMMITMENT AND SUPPORT THROUGH BBL|07 AND WBBL|03 COMMERCIAL Cricket NSW Annual Report and Yearbook 2017/18 PARTNERS THE SYDNEY SIXERSWOULD LIKETO THANKALLCLUB PARTNERS FOR THEIRCOMMITMENT ANDSUPPORT THROUGHOUT BBL|07ANDWBBL|08 AO ATE WBBLPRINCIPAL PARTNER PARTNER MAJOR PRINCIPAL PARTNER PRINCIPAL PARTNER Sydney Sixers – KFC BBL|07

SEAN ABBOTT CELEBRATES A WICKET WITH TEAM MATES

After a slow start to their BBL|07 campaign, With the Sixers’ fi nals hopes now hanging by a The Sixers backed it up in Melbourne three the Sydney Sixers stormed home to win the thread, they were dealt a hammer blow when days later, with Lyon (3/18) spinning a web last four matches and fi nish the regular season they travelled to Geelong for their next match, around the , while Hughes as arguably the form side of the competition. losing to the by eight (49 not out off 46 balls) and Nic Maddinson The season started with a narrow fi nal-ball wickets. Despite the heavy defeat, the Big Bash (62 off 31) made light work of chasing down loss to cross-town rivals Sydney Thunder, debut of gifted fast bowler Mickey Edwards the home side’s modest target of 129. with the performance of BBL debutant Daniel proved to be a major highlight for the club. Full of confi dence, the Sixers returned home Sams a clear highlight. Sams picked up the The Sixers then travelled to Blundstone Arena to take on the . Abbott ripped impressive fi gures of 4/14 in his fi rst game in to take on the in a must-win through the Heat’s highly regarded batting magenta, giving him the best bowling fi gures clash. An heroic innings from Sam Billings line-up, fi nishing with the impressive fi gures by a debutant in BBL history. (61 not out off 31 balls) took the match to of 4/11 as the visitors were rolled for a miserly This was followed by a six-wicket defeat at the wire. Needing 17 to win with three balls 73. Hughes (37 off 28) top scored again as the the hands of the Perth Scorchers at the SCG, remaining, Billings hit consecutive sixes, but Sixers chased down the total with 10 overs despite Sean Abbott’s three-wicket haul giving was unable to complete the trifecta to give the to spare. the Sixers a slight glimmer of hope after men in magenta an unlikely victory. The Sixers wrapped up their season against posting a modest total of 132. Following the defeat to the Hurricanes, Billings the Stars at the SCG fi ve days later. The The heartbreak continued against the Adelaide and left camp for international home side secured their fourth consecutive Strikers after Christmas. A half-century to duty with England. Fellow Englishman win, chasing down an imposing target of 189 (50 off 32) and some big hitting and international with 15 balls to spare, on the back of superb from lower order batsmen Steve O’Keefe (28 joined the squad as their batting displays from Denly (72 not out off 45) off 15) and Ben Dwarshuis (21 off 11) brought replacements. The Sixers line-up was further and Maddinson (61 off 26). the Sixers within a whisker of Adelaide’s total bolstered by the return of Nathan Lyon from In the end, BBL|07 was a case of what of 3/167. However, O’Keefe was unable to hit international duty and Moises Henriques from might’ve been for the men in magenta, with the required six off the fi nal ball of the match personal leave. their slow start to the season leaving too to force a . The new additions gave the Sixers a timely big a mountain to climb as they eventually The Sixers welcomed the New Year with boost ahead of the second Sydney Smash of fi nished fi fth. The fact the Sixers had one of another BBL|06 Big Final rematch against the season at the SCG. Chasing 157 for victory, the best net run rates in the competition is a the Scorchers at The Furnace. The Sixers Denly wasted no time endearing himself to the fair refl ection of how close they came in their put together their best batting performance home crowd, with a quickfi re 43 off 29 balls, losses and how dominant they were in their of the season to date, with Silk (45 not out while Daniel Hughes (66 not out off 55 balls) victories. However, the strong fi nish to the off 33 balls) top scoring again as the boys in anchored the innings superbly. In the end, it season, combined with the fact the core of the magenta posted 4/167. However, it proved too was left to Henriques to hit the winning runs squad will be returning next year, bodes well little as the home side passed the total with off the fi nal ball of the game to give the Sixers for BBL|08. fi ve balls to spare. their fi rst win of the campaign. Cricket NSW Annual Report and Yearbook 2017/18 Sydney Perry (64off56)guided theSixerstoa Renegades. Acomposed half-centuryfrom back-to-back matchesagainsttheMelbourne The SixersusheredintheNewYear with Scorchers outfi t. proved tobetoofewagainstapowerful Perth, wheretheirtotalof138once again The Sixersthentravelledcross-country to convincing nine-wicketvictory. the Sixersonceagaincameoutontopwitha the returnfi xtureattheSCGpriortoChristmas, setting upa33-runwinovertheHurricanes.In South AfricancaptainDanevanNiekerk(4/20) fi vedayslater, withanincrediblehat-trickfrom Our ladiesinmagentabouncedbackHobart of thePerthScorchers. Sixers sufferedanine-wicketlossatthehands A roadtriptoWollongong followed,wherethe earning PlayeroftheMatchhonours. Sydney Thunder, withAlyssaHealy(49off27) with asix-wicketvictoryovercrosstownrivals, Sixers backedthisuplessthan24hourslater an 86-runwinovertheMelbourneStars.The Sixers postedaWBBLrecordtotalof4/242in (91 notoutoff49balls)battedsuperblyasthe Ash Gardner(114off52balls)andEllysePerry Opening Weekend. to-back winsatNorthSydneyOvalonWBBL started theseasoninidealfashion,withback- Championship runinWBBL|02,theSixers With expectationshighfollowingtheir securing theirsecondtitleinasmanyseasons. the benchmarkofcompetitioninWBBL|03, The SydneySixersreaffi rmedtheirpositionas SIXERS CAPTAIN ELLYSE PERRY, LEFT, ANDVICE-CAPTAIN ALYSSA HEALY WITHTHEWBBLTROPHY

Sixers – in hand. run chase,passing thetotalwithfi vewickets 20 overs.TheSixersmadelightwork ofthe restricted thehomesideto7/106from their an impressivebowlingperformance that (2/13) andKimGarth(2/15)spearheading the Starstwodayslater, withMarizanneKapp The SixerstravelledtoMelbourne takeon 18-run win. 39) earningPlayeroftheMatchhonoursinan following day, withErinBurns(54notoutoff two sidesmetagainatHurstvilleOvalthe the BrisbaneHeatintheirnextouting.The winners’ circlewithanine-runvictoryover off 23)ensuredtheSixersreturnedto Healy (70off43)andvanNiekerk(44notout from Aley(3/11). despite animpressivebowlingperformance on thisoccasion,securingafour-wicket win, it wasthevisitorswhowonbraggingrights second SydneySmashoftheseason.However, returning totheSCGfaceThunderin The Sixersenjoyeda10-daybreakbefore eventually emergingvictorious. to determinethewinner, withtheRenegades scores nowtied,aSuperOverwasrequired amongst theRenegadesplayers.With the fi nalballofthematchfollowingconfusion Ange Reakessneakanunlikelysecondrunon incredible seriesofeventssawSarahAleyand Geelong wasnotsostraightforward.An However, thefollowingday’s fi xturein of thedouble-header. comfortable 36-runwininthefi rstmatch Rebel

WBBL|03 silverware tothetrophy cabinet. to ensuretheSixers addedanotherpieceof side pastthetargetwithfi veoversremaining Perry (36notoutoff42)calmlyguided their Scorchers alloutfor99.Healy(41off 32)and performance ledbyCoyte(3/17)saw the at theAdelaideOval.Anoutstanding bowling Final, theSixerstookonPerthin decider In arematchofthepreviousseason’s Big consecutive WBBLFinalwitha17-runvictory. ensure theSixersbookedtheirspotinathird rip aparttheStrikersbattingline-upand Aley (4/18)andGarth(2/14)combinedto competitive totalof5/138fromtheir20overs. 45) ensuringtheladiesinmagentaposteda explosive half-centuryfromGardner(72off days later. TheSixersbattedfi rst,withan again inthesemi-fi nalat AdelaideOvalfi ve The resultmeantthetwosideswouldmeet ladder withanotherseven-wicketwin. the SixerswrappeduptopspotonWBBL picking upfi guresof3/18thefollowingdayas Coyte wastednotimemakinghermark, seven-wicket victoryinthefi rstencounter. century fromHealy(106off66)setupa Strikers atHurstvilleOval.Anincredible with adouble-headeragainsttheAdelaide The Sixerswrappeduptheregularseason brought intothesquadastheirreplacements and EnglandinternationalAmyJoneswere Former SouthernStarsbowlerSarahCoyte for internationaldutywithSouthAfrica. and vanNiekerk,whoweresummoned The fi xturewasthelastoutingforKapp Sydney Thunder – KFC BBL|07

Sydney Thunder captain Shane Watson showed he is still one of the most destructive batsmen in Australia but was left disappointed with the team’s fi nal position on the table after another inconsistent season. Thunder’s squad remained relatively similar from BBL|06 with Callum Ferguson being the only high profi le addition to the squad, alongside two highly rated overseas stars in England’s Jos Buttler and quick Mitch McClenaghan. Once again hosting the opening match of the season at Spotless Stadium, Thunder beat local rivals the Sydney Sixers in a last-ball thriller. and Arjun Nair kept their cool when they needed 15-runs from the fi nal over, accomplished with Nair running a single from the fi nal ball. Thunder struggled to take the momentum into the next match against the at the . The run chase fell over when Thunder lost six wickets for 19 runs after restricting the Strikers to 6/163 with teenager Arjun Nair taking three wickets. A frustrating loss to the Brisbane Heat at the Gabba followed, when the hosts were able to win a rain-affected match with a ball to spare. Watson had earlier scored his second half century of the season as Thunder made 4/149. Thunder then travelled to Tasmania for SHANE WATSON the fi rst BBL match in Launceston, with Jos Buttler’s magnifi cent 67 from 41 balls and a by three runs despite a nervy fi nal over from In a match that could potentially decide solid, all-round bowling performance bettering Mitch McClenaghan that included a four, a six the fi nal spot to make it into the fi nals, the Hobart Hurricanes. and a no ball that went for two. Thunder hosted the Melbourne Renegades in However, in a return match at Spotless Vince was fi t enough to be named in the side Canberra at Manuka Oval, the fi rst time Big Stadium two days later, on New Year’s Day, to play the Sydney Sixers at the SCG and Bash had been played in the capital since the roles were reversed. D’Arcy Short’s 97 was made 34 from 25 balls. made his the fi nal of BBL|04. Thunder were without the difference despite a highly competitive highest score for Thunder, running himself out Usman Khawaja (hand) and Callum Ferguson 180 posted by the Thunder in the chase, on 49 while Jay Lenton and Ben Rohrer put (hamstring), who had both been ruled out for with 81 of those runs coming from another on a 27-run partnership at the end as Thunder the remainder of the season following the explosive Jos Buttler innings. made 6/156. Thunder struggled to take Melbourne Stars fi xture just four days earlier. Jos Buttler played his fi nal match for Thunder wickets with the Sixers determined to end After witnessing Thunder come out on top before joining up with England’s ODI squad on a run of six matches without a win. Despite in the WBBL fi xture at a traditionally batting 7 January when a Strikers victory saw them taking only two wickets, some tight bowling friendly ground, the Renegades posted 6/189 go top of the table. took three saw the Sixers still need 9 runs from the fi nal with only Fawad Ahmed able to restrict the wickets but it was (48) and Alex over bowled by Chris Green. In the end, Dan opposition to less than seven runs an over. Carey (34) whose runs helped the visitors to a Hughes was able to score two off the fi nal ball His cunning wrong’un fooled Matt Short and convincing victory. to give the Sixers an eight-wicket win. he was cleanly stumped by Jay Lenton for 28. Sydney Thunder were hopeful of being able Thunder could still mathematically secure A slow start and Thunder looked in trouble to welcome two Ashes batsman into the side a place in the fi nals as they travelled to needing 83 from 42 balls until Ben Rohrer took to face the Scorchers, with Usman Khawaja Melbourne to take on the Stars. Sydney 28 off one over, as he put playing his fi rst match for Thunder since the Thunder won a toss that was attended by on an 84-run, 38-ball partnership with Arjun fi nal of BBL|05 and England’s Hollywood superstar Will Smith and chose Nair. Thunder ended up needing 14 from the replacing Jos Buttler for the remainder of the to bowl. made 57, but their fi nal over, ultimately falling short with just four season. Vince would miss the match due to innings fell away with all fi ve Thunder bowlers runs and two wickets coming from the fi nal six illness but a magnifi cent 85 from the returning picking up at least a wicket. Usman Khawaja, balls to fi nish the season sixth on eight points. Khawaja helped Thunder beat the Scorchers James Vince and Shane Watson all made it into the forties to win with 23 balls remaining. Cricket NSW Annual Report and Yearbook 2017/18 devastated the Melbourne Stars. devastated theMelbourne Stars. compiling a95-run openingpartnershipwhich (42)and Haynes(78notout) degree heat,withNewZealandinternational Thunder returnedtoHowellOval,Penrith, in42 to aneight-wicketwin. century ofthetournamenttolead Thunder Carey 2-17.Haynes(54)scoredhersecond half 8/114, withHarmanpreetKaurtaking 3-18and just twodayslater. TheStarswere restrictedto Bash inAlburyagainsttheMelbourneStars their annualtriptoregionalNSWfortheBorder There wasnorestfortheThunderastheymade the Thunderfallingfi verunsshort. from 52balls;howeveritwasn’t enoughwith captain AlexBlackwellimpressedwithher58 a competitivetargetof147forvictory. Thunder 4,500 cheeringfromthesidelines,Sixersset the SydneySixers.Withacrowdofmorethan following daytofacethereigningchampionsin Thunder returnedtoNorthSydneyOvalthe the Thunderprevailedby11runs. Despite aspiritedrun-chasefromtheRenegades, the Renegades’battersahugetaskforvictory. Rene Farrell(25notoutfrom13)ultimatelyset between NicolaCarey(47notoutfrom17)and An unbeatenstandof83off29deliveriesshared of threeballs. at 6/117whenbothbattersfellinthespace back ontrack,buttherewasstillworktodo Stalenberg (38from25balls)gottheteam partnership betweenHaynesandNaomi saw theThunderstumbleto4/41.A76-run fl yingstartbut aquicksuccessionofwickets Rachael Haynes(55)gotthesideofftoa weekend atNorthSydneyOval. Melbourne RenegadesintheWBBL’s opening the massivescoreof6/200against in record-breakingfashionwhentheyposted Sydney ThunderbegantheirWBBL|03campaign NICOLA CAREY Sydney

Thunder for the remainder of the competition. for theremainderof thecompetition. England World Cupwinningbatter FranWilson to India.SydneyThunder replacedherwith with internationaldutiesrequiringher toreturn ’s fi nalmatchoftheWBBL remain intopspotontheladder. Itwasalso down theSixerstotalin19thover and Stalenberg (48from41)sawtheThunder chase fi guresof3-21thestandout. restricted theSixersto113runswithBates’ seem toaffecttheThunderbowlers,who An hourdelayduetoalooseroofpaneldidn’t weekend defeatatthehandsofSixers. opportunity tomakeamendsfortheiropening header attheSCGgaveThunder The highlyanticipatedSydneySmashdouble- of theseason. stop theThundersufferingtheirseconddefeat (81 notoutfrom58balls)wasn’t enoughto the ball.Acaptain’s inningsfromBlackwell following dayastheThunderstruggledwith It wasadifferentstoryattheWACA the win byasinglerun. Priest sawtheThunderavoidasuperoverand allrounder LisaGriffi th andwicketkeeperRachel the localsatLilacHill.Alastballrun-outfrom entertaining gameofcricketplayedinfront The NewYear startedwithatriptoPerthforan the ThundertotopspotonWBBLladder. and anunbeaten43fromBlackwellthatsteered script; howeveritwasSamanthaBates(3-12) The matchthenextdayfollowedasimilar with theball,taking4-15inaseven-wicketwin. the fi rstmatch. StafanieTaylor wasastand-out fi neformcontinued withher64from49ballsin Launceston inback-to-backmatches.Haynes’ before facingtheHobartHurricanesin The Thunderweretreatedtoa13-daybreak matches withninewicketstospare. The Thundercruisedtotheirthirdwinfromfour – Rebel

WBBL|03 their WBBL|03 season. their WBBL|03season. the Thunderfallingshortby27runsand ending partnership. Itwasn’t enoughhowever, with (46) briefl yreignitingtheirinningswitha42-run international replacementplayerFran Wilson Thunder weresoon5/46beforeCarey (22)and back tothedugoutforjustasinglerun.The with acloselbwdecisionsendingHaynes The inningsdidn’t startwellfortheThunder wickets downat2/148. The Scorchersfi nishedtheirinningsjusttwo (1-16) gotthebreakthroughinninthover. Bolton putona65-runpartnershipbeforeCarey Scorchers openingpairElyseVillani andNicole Perth atthenewlyopenedOptusStadium. were consignedtoplaytheirhomesemi-fi nalin Due tothestructureofcompetition,Thunder in 17.4overs. undone, losingtheirfi nalsixwicketsfor24runs but someoverzealousbattingbroughtthem looked incontrolearlyat4/91the14thover ladder fromtheAdelaideStrikers.TheHeat in under16overstostealfourthspotonthe task, needingtochasetheThunder’s 8/117 The followingday, theHeatweresetabig the 18thover. Harris sawtheHeatreachrequiredtotalin partnership fromDelissaKimminceandGrace to astrongtotalof5/145,butblistering Haynes (43)andBlackwell(41)ledtheThunder appearance. GoodbattingfromAustralianduo with Thunderalreadycementingasemi-fi nal Heat inthefi nal twohomeandawaymatches, days whentheyarrivedinBrisbanetofacethe The teamhadalreadybeenontheroadfornine target inthe16thovertowinbyfourwickets. hard workoftherunchasebutreached their inningstojust68runs.TheThundermade Renegades, withtheThunderbowlerslimiting got underwayitwasadaytoforgetforthe skies delayedthestartingtimebutonceplay Melbourne RenegadesinCanberra.Grey ahead ofthefi nalswithawinagainstthe Thunder weredeterminedtoregainmomentum After relinquishingtopspottotheSixers, with thebattowintwoballsspare. runs inthesuperoverandthenreturnedfi re Sophie DevinelimitedtheThundertojustsix 114 tosendthematchintoasuperover. Striker managed todefendarelativelylowtotalof Returning thefollowingday, theStrikers balls remaining. with achance,bowledoutfor111four total of4/148.TheStrikersneverlookedin with 51runsandhelpedThundertoaninnings Oval. Priestbattledtheheattotopscore under blisteringconditionsatRobertson the AdelaideStrikersinWagga Wagga Thunder playedback-to-backmatchesagainst Sydney Thunder – Rebel WBBL|03 Semi-Final

Sydney Thunder v. Perth Scorchers 1 February 2018, A successful season did not end the way that the Sydney Thunder had hoped at the new Perth Stadium after their loss by 27 runs to the Perth Scorchers in the semi-fi nal. It was an unfortunate draw for the Thunder, who fi nished second on the competition table, but due to scheduling were required to travel to Perth. England middle-order batter Fran Wilson starred for the Thunder with a rapid fi re 46 from 28 balls, but her efforts were not quite enough. The Thunder was restricted to 8/121 in pursuit of 149 to win. Thunder captain Alex Blackwell won the toss and elected to fi eld fi rst, yet it was the Scorchers who took the upper hand in the fi rst innings. FRAN WILSON REVERSE SWEEPS FOR THE SYDNEY THUNDER Scorchers captain Elyse Villani (38) and opening partner Nicole Bolton (37) demonstrated all SEMI-FINAL – SYDNEY THUNDER WOMEN v PERTH SCORCHERS WOMEN their class and experience as Australian players At Perth Stadium, on 1 February, 2018. TV Umpire: SA Lightbody. to get their team off to a fast start. Perth Scorchers Women won by 27 runs. Scorers: LW Catchpole & SA Wheeler. The pair added 65 from 55 balls for the fi rst Toss: Sydney Thunder Women. Referee: RL Parry. wicket which established a momentum that the Umpires: GC Joshua & AK Wilds. Player of the Match: NE Bolton. Thunder was unable to stop. The Scorchers lost Perth Scorchers Women only one further wicket on their way to 2/148. *EJ Villani lbw b Carey 38 (37) NE Bolton c Stalenberg b Taylor 37 (26) English allrounder Natalie Sciver (38 not out) NR Sciver not out 38 (28) and Heather Graham (27 not out) remained HL Graham not out 27 (29) unbeaten for the Scorchers. PM Cleary did not bat The best fi gures for the Thunder were returned LK Ebsary did not bat by world-class West Indian allrounder Stafanie KH Brunt did not bat Taylor (1-23) and Nicola Carey (1-16). EL King did not bat TMM Newton did not bat In reply, the Thunder chase suffered a MP Banting did not bat signifi cant setback in the second over. The +EJ Smith did not bat off-spin of Bolton removed the prodigious Extras 2lb 6w 8 Rachael Haynes (1) with a clever use of the (20 overs) 2 wkts 148 arm ball and the innings immediately lost the Fall: 65 86 impetus it required. Bowling: Farrell 4-0-34-0; Bates 3-0-22-0; Vakarewa 3-0-21-0; Taylor 4-0-23-1; Carey 2-0-16-1; Gibson 4-0-30-0. Sydney Thunder Women Haynes had scored an impressive 425 runs at an +RH Priest c Sciver b Cleary 25 (19) average of nearly 31 leading into the semi-fi nal. RL Haynes lbw b Bolton 1 (3) The Thunder lost 5/46 within 11 overs and there *AJ Blackwell c Villani b King 9 (22) was simply too much ground to make up. NE Stalenberg st Smith b King 1 (6) In partnership with Nicola Carey, who scored 22 SR Taylor c Sciver b Graham 7 (11) NJ Carey b King 22 (20) from 20 balls, Wilson did her best to give the FC Wilson run out (Sciver-Smith) 46 (28) Thunder a chance of recovery, but when Carey RM Farrell c Smith b Brunt 3 (5) chopped on in the 16th over, it would prove ML Gibson not out 2 (4) crucial. SL Bates not out 2 (2) The new batters found it diffi cult to quickly BW Vakarewa did not bat settle into their innings and, as a result, Wilson Extras 1lb 2w 3 was unable to develop any partnerships that (20 overs) 8 wkts 121 could get the Thunder into the Final. Fall: 10 31 35 44 46 88 107 118 Bowling: Brunt 4-0-24-1; Bolton 4-0-22-1; Cleary 4-1-24-1; King 4-0-17-3; Graham 4-0-33-1. The off-spin of Emma King (3-17) not only tied down the Thunder batters, but her happy knack of picking up wickets when required was key to the Scorchers win. King claimed the important wickets of Carey, Blackwell (9) and Naomi Stalenberg (1). Cricket NSW Annual Report and Yearbook 2017/18 Garth (2-14) alsomadeavaluable contribution. the upperechelons offemalecricketandKim Coyte (2-32)continued herremarkablereturnto bowlers, ledbythe indomitableAley. Sarah It wasadominantdisplaybytheSixers’ of 50from46balls. Strikers’ slimchancesalivewithabrisk knock only EnglandbatterTammy Beaumontkeptthe Four oftheAdelaidebattersfellforducks and a Strikersvictory. that wouldultimatelyevaporateanyhopeof The dismissalledtothedisastrouscollapse an attemptedpullshot. failed toavertLaurenSmithatmid-wicketwith Bates astheleadingrun-scorerforStrikers Aley thenstruckwithherfi rstballtoremove She racedto14fromasmanyballs. wicket ofBatesquicklybecameapriority. restrict apotentStrikersbattingline-upandthe The Sixersstillhadataskaheadtodismissor a morethancompetitivetotal. they fellshortofthe150-mark,stillposted seven overs.TheSixerslost4/48and,while However, theStrikersfoughtbackinfi nal in excessof150. appeared theSixersweredestinedforatotal ominous tonefortheiroppositionandit (16), worth87runsfrom70balls,setan The partnershipbetweenGardnerandPerry feats ofGardner. managed tosetaterrifi c platformduetothe Alyssa Healy(2)inthesecondover, theSixers and electedtobatfi rst.Despitethelossof Sixers captainEllysePerrywonthetoss and secondballducks. McGrath andAmanda-JadeWellington forfi rst (14) wasfollowedbyAustralianplayersTahlia wicket ofNewZealandopenerSuzieBates with Aleyclaimingthreescalps.Theimportant The Strikerslost5/3inthespaceofthreeovers, exhibition whichtriggeredadramaticcollapse. performance withanoutstandingbowling Aley (4-18)thenfollowedthatsuperb innings andcleareditonsixoccasions. reached theboundaryfi vetimesduringher away fromthehomeside.Theallrounder balls inaninningswhichsnatchedthematch possible opportunity. Shehit72fromjust45 Gardner punishedtheStrikersattackatevery by theSixers. restricted to9/121inresponse5/138posted 17 runsattheAdelaideOval.TheStrikerswere The minorpremiersdefeatedtheirhostsby Gardner andseamerSarahAley. excellent performancesbyallrounderAshleigh against theAdelaideStrikersthanksto successive WBBLFinalinconvincingfashion The SydneySixersadvancedtotheirthird 2 February2018,AdelaideOval Sydney Sixersv. AdelaideStrikers Sydney

Sixers – SYDNEY SIXERSVETERAN SARAHALEYCELEBRATES AWICKET Umpires: Toss: Sydney SixersWomen wonby17runs. At AdelaideOval,on2February, 2018. FINAL –SYDNEY SIXERS WOMEN v ADELAIDE STRIKERS WOMEN 2 vr) ks121 (8) 9wkts (16) (17) 8 (2) (2) 19 14 0 (3) 0 (46) (1) 0 50 (7) 0 (14) 7 14 138 5wkts Bowling: Gardner3-0-24-0;Perry2-0-20-0;Aley4-1-18-4;Garth3-0-14-2;Coyte4-0-32-2;Burns4-0-13-1. Fall: 2022237195112 (6) (20 overs) (12) Extras 2w 3 KL Popenotout +TJ McPharlinnotout 12 (17) AE PricestHealybCoyte M SchuttlbwbBurns (31) TMS SavillelbwbAley 25 (8) (45) A Wellington lbwbAley BE PattersoncHealybGarth 16 TT BeaumontlbwbCoyte 2 72 TM McGrathcCoytebAley *SW BatescSmithbAley14(14) SFM Devinec&bGarth7(7) Adelaide Strikers Women McGrath 1-0-9-0. Bowling: Schutt4-0-17-1;Devine4-0-21-2;Bates3-0-29-1;Wellington 4-0-28-1;Pope2-0-17-0;Price Fall: 390104131136 (20 overs) Extras 6w KJ Garthdidnotbat SJ Coytedidnotbat LG Smithdidnotbat SE Aleydidnotbat AR Reakesnotout AE JoneslbwbBates SJ McGlashannotout EA BurnscMcPharlinbSchutt AK GardnerstMcPharlinbWellington EA Perry*cMcGrathbDevine +AJ HealycPattersonbDevine Sydney Sixers Women SydneySixersWomen. Rebel MWGraham-Smith&JDWard.

WBBL|03 Player oftheMatch: Referee: Scorers: TV Umpire: MHHarper&NARicketts. DTalalla.

Semi CA Polosak. SEAley. - Final (4) 2 7 6 (1) 2

Sydney Sixers – Rebel WBBL|03 Final

Sydney Sixers v. Perth Scorchers 4 February 2018, Adelaide Oval It took the Sydney Sixers just 15 overs of batting to secure their second consecutive WBBL title against the Perth Scorchers at the Adelaide Oval, with captain Ellyse Perry taking the honour of hitting the winning runs. A classical cut shot through the off-side by Perry sealed the comprehensive nine-wicket victory and cued scenes of ecstasy in celebration. An outstanding bowling display, highlighted by Sarah Coyte’s 3-17, set up the win. The Scorchers were bowled out for 99 at the end of the 20th over. Coyte was named Player of the Final, completing a fairytale return to cricket. The Sydney Sixers medium-pacer collected 10 wickets at the amazing average of 8.10 from her four matches during the tournament, which included SYDNEY SIXERS CLAIM SUCCESSIVE WBBL TITLES two fi nals.

One of her three wickets in the decider was the FINAL – PERTH SCORCHERS WOMEN v SYDNEY SIXERS WOMEN vital scalp of Australian player Elyse Villani (16) At At Adelaide Oval, on 4 February, 2018. TV Umpire: MW Graham-Smith. in the seventh over. A subtle variation in pace Sydney Sixers Women won by 9 wickets. Scorers: MH Harper & NA Ricketts. deceived the Scorchers captain, as she danced Toss: Perth Scorchers Women. Referee: DJ Harper. down the pitch and was expertly stumped by Umpires: GJ Davidson & JD Ward. Player of the Match: SJ Coyte. Alyssa Healy. Perth Scorchers Women The wicket of Nicole Bolton (5) soon followed. *EJ Villani st Healy b Coyte 16 (29) NE Bolton lbw b Garth 5 (13) Irish allrounder (1-7) trapped the NR Sciver c Healy b Perry 2 (4) Australian opening batter in front and suddenly MP Banting c Smith b Burns 5 (9) the Scorchers were 2/26 at the beginning of TMM Newton lbw b Coyte 12 (17) the eighth over, with arguably two of their most HL Graham b Coyte 14 (16) important players back in the dressing room. KH Brunt c Gardner b Aley 10 (13) The situation became worse when Perry (1-9) LK Ebsary c Healy b Burns 4 (4) dismissed English allrounder Natalie Sciver (2) PM Cleary not out 18 (14) EL King run out (Gardner-Burns) 2 (2) cheaply and the Scorchers were reeling at 3/29. +EJ Smith run out (Gardner-Burns) 0 (0) Wickets continued to tumble and the Scorchers’ Extras 2lb 8w 1nb 11 innings failed to gain any momentum. A full (20 overs) 99 of length, -to-stump line proved fruitful Fall: 23 26 29 41 61 66 71 90 94 99 for Coyte and the other quicker bowlers, who Bowling: Gardner 4-0-19-0; Perry 2-0-9-1; Aley 4-0-19-1; Garth 2-0-7-1; Coyte 4-0-17-3; Burns 4-0-26-2. claimed most of the wickets for the Sixers. Sydney Sixers Women +AJ Healy st Smith b King 41 (32) Off-spinner also pitched in with 2-26 *EA Perry not out 36 (42) from her four overs and combined with Ashleigh AK Gardner not out 22 (16) Gardner for two run-outs. EA Burns did not bat In reply, the Sixers were intent on completing SJ McGlashan did not bat the task as quickly as possible. The opening AE Jones did not bat partnership of Healy and Perry added 64 runs AR Reakes did not bat from 61 balls before Healy was dismissed for 41 SE Aley did not bat LG Smith did not bat from just 32 deliveries. SJ Coyte did not bat Healy was stumped as she advanced down the KJ Garth did not bat pitch to the off-spin of Emma King (1-26). Her Extras 1w 1 innings included fi ve boundaries and one six in a (15 overs) 1 wkt 100 clinical exhibition of clean hitting. Fall: 64 Gardner then joined Perry in the middle and Bowling: Brunt 3-0-20-0; Bolton 2-0-20-0; Graham 4-0-17-0; Cleary 2-0-17-0; King 4-0-26-1. continued the frequent fl ow of runs, as both women guided the Sixers to the title. Gardner fi nished 22 not out from only 16 deliveries, while Perry scored 36 not out from 42 balls to complete an emphatic defence of the crown. Cricket NSW Annual Report and Yearbook 2017/18 spread acrossthe fi vematchesandnotfour. attended thematches aspreviousseason,just league, withaview thatthesamepeople downwards byaround12%YOYacross the Crowds acrosstheBigBashdidtrend 121,018 inBBL|06. attended Sixershomematches,upfrom match attheSCG.Atotalof124,399 people for theseason,evenwithanadditional home The Sixerssawonlyasmallriseinattendance Attendance exclusively broadcastbyFoxSports. as 40matchesoftheBBLand14 Sports simulcast23WBBLmatches,aswell next seasonwillseeChannelSevenandFox The introductionofthenewbroadcastdeal average of269,895acrossfi vematches. attracted 415,842viewers,withaseason Sixers featuringinaprime-timematchthat The WBBLcontinuedtotrendwellwiththe average is4%. in averageaudiencesforBBL,wherestate Sydney marketonlyrecordeda1.5%drop trend ofadeclinearound3-6%,althoughthe other marketsheldinlinewiththeTVIndustry Victoria wherea 16.4%dropwasrecorded.All 8% YOY, thiswasdrivenalmostexclusivelyby While averageBBLTVaudiencesweredown from 982,769thepreviousyear. audience thissummerwasdownto901,779 Following industrytrends,theSixersaverage Television Ratings the seasonafterstartingwithsixstraightlosses. straight wins,showingwhatcouldhavebeenfor The BBLteamfi nished theseasonwithfour fi naliststheScorchersatsamevenue. against theStrikersbeforefacingWBBL|02 travelled toAdelaideOvalforthesemi-fi nal the tableforsecondyearrunning,team Scorchers inAdelaide.Afterfi nishingontopof Champions, winningthefi nalagainstthePerth The SixerswereonceagaincrownedWBBL across themen’s andwomen’s teams. what couldhavebeen,withmixedfortunes Last BigBashseasonwasoneofsuccessand SYDNEY SIXERSSTAFF 2017/18 Sydney

Sixers

General that willattractsignificant anddiversecrowds. day experienceatbothBBLandWBBLmatches alone in2019.Thefocusfallstocreatingamatch moving forwardandtheWBBLbecomingstand away seasonseeingsevenmatchesattheSCG Club inthecomingseasonswithafullhomeand This isthebiggestareaofdevelopmentfor match attheSCGsaw16,380inattendance. around 1,000spectatorstoeachday. Thederby with theremainingsuburbanmatchesattracting attendance of8,726acrosstheweekend, The WBBLOpeningWeekend sawan record publicticketsalesforthematch. Pleasingly, theSydneySmashderbysaw sales weredownon BBL|06. primarily throughat venuesales,whileonline merchandise revenue.Theincrease was driven WBBL|03, theSixerssawa4.5%increase in With anewdesignforBBL|07and Merchandise will beaddedtotheprogrammoving forward. on thisprogram.Additionalfocusandproducts change instaffNovemberandalossoffocus summer by6%.Thiswasprimarilyduetoa Hospitality revenuewasalsodownthispast adding additionalbenefi tsthroughtheWBBL. generating revenueviayieldwithafocuson Moving forward,theClubwillworkon the yieldofpackageswithinprogram. grew justover4%duetosomegoodworkon on thepreviousseason;howeverrevenue Membership numbersweredowninBBL|07 Membership &Hospitality continued theirsupport. iiNet, BrokenwoodandSydneyWater Pictures onboard,whilelongtermpartners The ClubalsowelcomedAAMIandSony Major PartnerfortheWBBLteam. Partner fortheBBLteamandNature’s Giftas this summer, welcomingToyo Tires asMajor in theCommercialPartnershipscategory The Sixersonceagainachievedrecordsales Commercial Partnerships

aae s Manager General Manager –SydneySixers Jodie Hawkins during theseason. Offi ceSixersteamfortheirpositiveefforts coaching staff,supportstaffandtothe Head I offermysincerethankstotheplayers, further rolledoutinthenextyear. and physicalpointofview. Theprogram willbe that willbenefi tyoungwomenfromapersonal who hasworkedtirelesslytocreateaprogram our FanEngagementManagerLizMcPherson, NSW Government.Theprogramisacreditto syllabus andhasreceivedfundingfromthe making, alignswiththeNSWHighSchool wellbeing. Theprogram,twoyearsinthe developing relationships,settinggoalsand face astheygrowuparoundsocialmedia, women tacklesomeofthechallengesthey program, “BeTheBestMe”,helpingyoung The Sixersalsopilotedanewfemaleleadership mentoring programagainseeinggreatresults. markets andtheWBBLteam’s SixersSisters Cricket Leaguedoublinginteamscertain generation ofyounggirlswiththeSixersGirls The WBBLcontinuedtoinspirethenext huge success. opening matchatNorthSydneyOvalandwasa WBBL OpeningWeekend andtheSixersWBBL Fan Daywasheldinconjunctionwiththe and willberolledoutfurtherinthecomingyear. for afi rstattempt atsomethingofthisnature atmosphere toattractfamilies.Itwasasuccess of integratingskillssessionswithacarnival ‘Sixers Festival’inNewcastle,withtheaim The Sixersalsodeliveredanewlycreated beaches. Lismore toKiamaandthroughoutSydney’s brand anddroveregistrationsfortheELPsfrom season andsuccessfullyshowcasedtheSixers The SixersBeachBlastwasbackforasecond Programs (ELPs). with acontinuedemphasisontheEntryLevel into alllevelsofjuniorcricketparticipation, Market Developmenttointegratethebrand The SixerscontinuedtoworkwithGameand Community andFanEngagement

Report Sydney Thunder General Manager s Report

A year focussed on our purpose and founded on our community work resulted in a number of highlights for the club.

Purpose To be a loved club that inspires and unites our Thunder Nation.

Performance A BBL squad that was largely unchanged from the season before had a mixed season. Although heading into our fi nal match we were in with a chance of making the fi nals, our inconsistency ultimately cost us. A highlight was certainly the development of our “younger” players including Arjun Nair and Chris Green. Their performances were complemented by excellent returns from Shane Watson (the Mike Hussey Medal winner), Fawad Ahmed and some blockbusting T20 cricket from Jos Buttler. SYDNEY THUNDER STAFF 2017/18 There were also cameo performances from For the fi rst time, we organised a Womens The success of the Sydney Thunder community other members of the squad that bodes well Thunder Nation Cup and the ACT Thunder program continued to deliver passionate for the future of the club. Nation Cup held in Canberra. support of the club, which resulted in over Our WBBL side saw a changed squad perform We welcomed emerging regional stars Blake 6,000 members and dedicated fans at our very well. After leading the round robin stages MacDonald and Claire Murray to train with our home matches. It was great to be able to host for most of the season, the side eventually Big Bash squads during the summer after their one of these home matches at Manuka Oval in fi nished second on run differential to the selection via our ACT/Country NSW Regional Canberra in front of a sold out crowd. Sixers. In a twist of the draw, this resulted in Rookie program. the side having to travel to Perth to play the Now in its third year, the Indigenous T20 Cup Partnerships Scorchers. Unfortunately, this proved to be a returned to Orange, where the best Indigenous I would like to thank our supporters, cricket bridge too far and the Scorchers deservedly talent represented Thunder against the Hobart community, councils and commercial partners won the match to advance to the fi nal. Hurricanes in a victorious series of three for their support during the season. Mazda, Our Player of the Year was Rachael Haynes, matches. Ben Patterson, Nate Jones and HomeWorld and Amart Furniture continue to who had a fantastic season opening the Tyran Liddiard all played with distinction. help us achieve our purpose. batting. Her dynamic opening partnership with Patterson and Liddiard joined Brendan Smith, Thunder is a club built by people for people. Rachel Priest more times than not provided the Brynley Richards, Jonte Pattison and Hannah impetus for a daunting fi rst innings total or an In my fi rst season, I have been continually Darlington in the CA Aboriginal touring squads achievable run chase. amazed at the passion that our players, that commemorated the 150th anniversary of off-fi eld team, fans and supporters show Naomi Stalenberg played some attacking the 1868 Pioneers tour of the United Kingdom for our club. knocks, Nicola Carey had an outstanding in June, 2018. all-round campaign and I would like to thank the CNSW Board, CEO With the support of the NSW and Federal performed very well with her left-arm spin. Andrew Jones and members of the SLT, Governments, our Leadership Program was CNSW staff, the Sydney Thunder coaches delivered in over 25 schools in the Thunder Community and Jo Broadbent, our Director region. The program utilises Sydney Thunder of Cricket Mike Hussey, captains Shane The Thunder’s pre-season continued to grow players to help students develop their leadership Watson and Alex Blackwell as well as the as the breadth of our community engagement skills, establish a sense of community and players, support staff and the Thunder Game program continued to expand. belonging and outline key goals and dreams. Development teams for their tireless and The MoneyGram Thunder Nation Cup returned We took the Thunder to the fans in Albury positive support. for its fi fth season, culminating in traditional again, staging the Border Bash, a BBL/WBBL I would also like to acknowledge the rivals India and Pakistan facing off again double-header against the Melbourne Stars outstanding work of the Thunder Front Offi ce in a curtain-raiser to the Thunder-Adelaide and once again attracting a very good crowd team: Chris Botherway, Vicky Tyas, Daniel Strikers match at Spotless Stadium, with to Lavington Oval. Stenglin, Jono Lees, Jenny Symons and India triumphing. A large number of teams The Thunder Foundation raised $23,670 Patrick Hogan, who continue to make Thunder from Sydney’s diverse cricket community which was then donated back to the cricket the club it is today and strives to be tomorrow. participated in the tournament with India, Sri community in the form of club grants and Lee Germon Lanka, Pakistan, , Afghanistan, Fiji, support for cricket organisations. The reach General Manager – Sydney Thunder Bhutan and Nepal proudly represented. of our community program grew signifi cantly, assisting cricketers in Jamaica, Kenya, and Fiji. Cricket NSW Annual Report and Yearbook 2017/18 KFC 2017/18 SYDNEYSIXERSBIGBASHLEAGUEPERFORMANCES 2017/18 SYDNEYTHUNDERBIGBASHLEAGUEPERFORMANCES MBr ------1 JM Bird CBtlr66-228 36 143.26 - 5 - 2 33.67 81 202 - 6 6 JC Buttler SLno 12 10 170.83 125.00 1 - 1 - - - - - 41.00 25.00 23 40 41 75 1 - 2 3 4 3 JS Lenton JM Vince JRy66-6 11.3--1-103.33 - 1 110.29 - 131.53 - - 130.00 2 - - 2 10.33 - 6 - 21 - - 62 1 18.75 1 - 73.00 32* 52.00 72* 75 6 50 146 1 6 2 156 5 1 4 10 4 4 JJ Roy 8 J Botha JL Denly JC Silk MBr 113.013 7.75 5.75 1-31 1-19 6.50 31.00 23.00 1-13 1 1 65.00 31 23 3 - - 195 4 - 4 1 30 4 10 JM Bird JL Denly J Botha LFkt . 419.013 9.56 1-37 7.07 94.00 1 3-36 22.78 94 9 - 205 9.5 - 3 29 133.73 10 - 1 AL Fekete - - AJ Nair 27.75 45 111 4 8 10 AJ Nair LFkt .0----14.29 - - 115.38 - - - 1 1.00 - 1 - 1 7.50 - 11* 1 15 3 1 3 3 AL Fekete AC Blizzard ATN n ORn SAg 010C tStk-Rt St Ct 100 50 Avge HS Runs NO Inn M BATTING ATN n ORn SAg 010C tStk-Rt St Ct 100 50 Avge HS Runs NO Inn M BATTING RPO Best Avge Wkts Runs Mdns Overs M BOWLING OLN vr dsRn ksAg etRPO Best Avge Wkts Runs Mdns Overs M BOWLING E oevle3------3 WER Somerville E oevle31 60--7.60 - - 0 76 - 10 3 WER Somerville RWto 01. 6 60 -39.51 1-13 56.00 3 168 - 17.4 10 SR Watson 139.08 - 2 - 2 36.78 77 331 1 10 10 8.49 4-11 SR Watson 21.77 13 283 - 33.2 10 SA Abbott AAbt 04-3 390 150.00 - 3 - 148.94 - - 1 141.82 9.00 1 - 23 1 36 - - - 23.33 4 1 28 31.20 70 10 61* - 156 3 SA Abbott 1 4 6 6 SNJ O'Keefe SW Billings N 'ef 1-7 6.55 - - 0 72 - 11 4 SNJ O'Keefe SSnh 4312592.922 8.78 2-28 23.89 9 215 1 24.3 7 GS Sandhu SSnh 11*55 157.14 - 1 - - 5.50 11* 11 1 3 7 GS Sandhu RPtesn88-154 31 106.32 - 3 - - 23.12 48 185 - 8 8 KR Patterson MLo - - 1 ------4 NM Lyon JMdisn1 01216 23 145.50 - 6 - 2 32.33 62 291 1 10 10 NJ Maddinson JMdisn1 40--14.00 - - 0 14 - 5.88 3-18 1 13.43 10 7 NJ Maddinson 94 - 16 4 NM Lyon JGen1 6-2573.622 7.36 2-27 37.86 7 265 - 36 139.68 - 10 104.08 - 8 - - - - CJ Green 14.67 - 20.40 49 88 37 - 102 1 6 6 10 7 CJ Green CJ Ferguson RBahat .0--2-150.00 - 2 - - 9.00 9 9 - 1 4 CR Brathwaite RBahat 44-1861.022 7.36 2-20 18.00 6 108 - 14.4 4 CR Brathwaite EBligr21100 - 33.33 - - 2 1 - - - - - 0.50 0* 1 0 1 110.19 - 1 1 1 3 1 2 6 - 1 DE Bollinger 37.83 DR Sams 66* 227 2 8 8 DP Hughes RSm 23-1872.341 7.91 4-14 25.43 7 178 - 22.3 6 DR Sams EBligr27-6 50 -09.29 1-30 65.00 1 65 - 7 2 DE Bollinger WEwrs11100 ------0* 0 1 1 1 MW Edwards JMCeahn1 92-311 28 -99.18 2-19 32.82 11 361 - 39.2 10 10.33 MJ McClenaghan - - 0 31 - 3 1 MW Edwards JMCeahn1 0933 76.92 - 3 - - 3.33 9 10 1 4 10 MJ McClenaghan CHnius6525 11.0--4-131.71 - 4 - - 18.00 21 54 2 5 6 MC Henriques CHnius64-3 95 -59.75 2-25 19.50 2 39 - 4 6 MC Henriques aa he 04 4 22.233 6.12 3-31 20.42 12 245 1 160.00 40 - 10 3 - - Fawad Ahmed 22.67 48 136 4 10 10 BJ Rohrer aa he 03211 .0--2-11.11 - 71.43 2 - - 2 - - 1.00 - 1* 7.50 1 14 2 30 3 1 10 5 6 Fawad Ahmed RJ Gibson JDasus8434 1 20 144.83 - 1 - - 42.00 21* 42 3 4 8 BJ Dwarshuis JDasus82 0 88 -16.97 2-41 28.86 7 202 - 29 8 BJ Dwarshuis TKaaa33-178 56 145.74 - 1 - 1 45.67 85 137 - 3 3 UT Khawaja MNvl 83 70 101.49 1 6 - - 17.00 33 68 1 5 9 PM Nevill

BBL|07

Statistics TABLE 2017/18 KFCBIGBASHLEAGUEPOINTS per overfromrunsscoredover. Net run-ratewascalculatedbysubtractingrunsconceded CHRIS GREEN SARAH COYTE ebun tr 0284-0.926 -0.437 4 8 8 -0.039 0.331 6 8 8 2 6 4 6 -0.291 10 10 4 10 4 5 0.801 10 10 14 0.154 5 Melbourne Stars 16 3 Brisbane Heat 2 10 Sydney Thunder 7 Sydney Sixers 8 Hobart Hurricanes 10 NRR Pts 10 Renegades Lost Won Melbourne Played Adelaide Strikers Perth Scorchers Team 0641 0.297 12 4 6 10 Rebel WBBL|03 Statistics

2017/18 WOMEN’S BIG BASH LEAGUE POINTS TABLE Team Played Won NR Lost Points NRR Sydney Sixers 14 10 0 4 20 0.890 Sydney Thunder 14 10 0 4 20 0.684 Perth Scorchers 14 8 0 6 16 0.266 Adelaide Strikers 14 8 0 6 16 0.250 Brisbane Heat 14 7 0 7 14 0.147 Melbourne Renegades 14 6 0 8 12 0.092 Melbourne Stars 14 5 0 9 10 -0.634 Hobart Hurricanes 14 2 0 12 4 -1.733 Net run-rate was calculated by subtracting runs conceded per over from runs scored per over. 2017/18 SYDNEY SIXERS WOMEN’S BIG BASH LEAGUE PERFORMANCES BATTING M Inn NO Runs HS Avge 50 100 Ct St Stk-Rt EA Perry 16 16 4 552 91* 46.00 3 - 3 - 98.57 AJ Healy 16 16 - 421 106 26.31 2 1 8 6 136.69 AK Gardner 14 14 1 347 114 26.69 1 1 4 - 138.80 EA Burns 16 15 4 285 54* 25.91 1 - 9 - 118.26 SJ McGlashan 16 13 3 145 44 14.50 - - 3 - 97.97 D van Niekerk 12 11 4 145 44* 20.71 - - 7 - 115.08 AR Reakes 15 9 5 60 13* 15.00 - - 4 - 120.00 M Kapp 12 7 - 50 14 7.14 - - 3 - 76.92 SE Aley 16 6 2 29 13* 7.25 - - - - 116.00 LG Smith 16 4 2 26 13* 13.00 - - 6 - 123.81 AE Jones 4 2 1 19 16* 19.00 - - - - 76.00 KJ Garth 14 4 3 3 3* 3.00 - - 5 - 37.50 SJ Coyte 4 ------1 - - J Hicks 5 ------1 - -

BOWLING M Overs Mdns Runs Wkts Avge Best RPO SE Aley 16 58.5 3 361 23 15.70 4-18 6.14 RACHAEL HAYNES D van Niekerk 12 42 - 234 20 11.70 4-13 5.57 KJ Garth 14 37 - 217 13 16.69 2-14 5.86 M Kapp 12 48 2 227 12 18.92 2-13 4.73 SJ Coyte 4 16 - 81 10 8.10 3-17 5.06 LG Smith 16 30 - 233 7 33.29 2-32 7.77 EA Perry 16 29 - 206 5 41.20 2-15 7.10 AK Gardner 14 37 - 255 5 51.00 1-9 6.89 EA Burns 16 14 - 86 4 21.50 2-26 6.14 AR Reakes 15 3 - 30 0 - - 10.00

2017/18 SYDNEY THUNDER WOMEN’S BIG BASH LEAGUE PERFORMANCES BATTING M Inn NO Runs HS Avge 50 100 Ct St Stk-Rt RL Haynes 15 15 1 426 78* 30.43 4 - 4 - 120.68 AJ Blackwell 15 15 4 338 81* 30.73 2 - 4 - 95.48 RH Priest 15 14 - 264 51 18.86 1 - 4 7 118.92 NE Stalenberg 14 10 1 227 48 25.22 - - 9 - 112.38 SR Taylor 15 14 7 168 33* 24.00 - - 3 - 84.00 NJ Carey 15 10 5 149 47* 29.80 - - 6 - 126.27 H Kaur 9 7 2 107 29 21.40 - - 5 - 95.54 RM Farrell 15 6 4 61 25* 30.50 - - 4 - 141.86 FC Wilson 6 4 1 50 46 16.67 - - 1 - 125.00 SL Bates 14 2 2 7 5* - - - 3 - 140.00 ML Gibson 15 2 2 4 2* - - - 2 - 50.00 L Griffith 6 1 - 2 2 2.00 - - 3 - 33.33 BW Vakarewa 11 ------3 - - BOWLING M Overs Mdns Runs Wkts Avg Best RPO NJ Carey 15 52.1 - 350 17 20.59 3-10 6.71 RM Farrell 15 58.4 1 354 17 20.82 3-19 6.03 SL Bates 14 48.4 1 287 16 17.94 3-12 5.90 SR Taylor 15 37.4 - 234 15 15.60 4-15 6.21 BW Vakarewa 11 29 - 165 11 15.00 3-17 5.69 NIC MADDINSON ML Gibson 15 42 - 277 9 30.78 1-12 6.60 H Kaur 9 6 - 42 3 14.00 3-18 7.00 L Griffith 6 12.1 - 122 0 - - 10.03 NE Stalenberg 14 1 - 14 0 - - 14.00 ISC Cricket NSW Annual Report and Yearbook 2017/18 APPARELVOUCHER E: [email protected]:83244900 CONTACT USTOCLAIMA$500VOUCHERFORYOURTEAM NOW

TEAMWEAR *GST NOTINCLUDED**G S ST

T

APPAREL N OT OT I

I N C LUD UDE E D D TERMS ANDCONDITIONSAPPLYT ER ER M S AND CO NDIT

IOI OFFER NS AP PL Y Toyota Futures League

Seasons highlights included: Having the experience of regionally-born Blues • Opening batsman Dan Solway fi nished contracted players Trent Copeland, Jay Lenton, the season as the team’s leading run Nick Larkin, Nic Maddinson and Jason Sangha scorer with 416 runs at 41.60. His double regularly available enabled the team to stay in of 139 and 90 against ACT/NSW Country matches for long periods. highlighted the advancements he has made Season highlights: to his game. • Nick Larkin’s incredible double in his only • The wonderful all-round performance by match of the season against NSW Metro, 19-year-old in the match scoring 189 and 129no in a wonderful display against South Australia, following up of technique and constructing an innings. an effortless 130 in diffi cult fi rst innings • Jay Lenton with 538 runs for the season conditions, with a match winning spell at 53.80 placed him second on the overall of 4-70 on the last day. This performance leading run scorers list for the season. earned Param his Sheffi eld Shield debut His leadership and temperament got the late in the season. team through several tough periods during • The consistent season of Nick Bertus in the year. scoring 374 runs at 53.42 included scores of • Justin Avendano’s brilliant display of 128 no v ACT/NSW Country and 99 retired ball striking in scoring 205 against South not out v WA, demonstrating his improved Australia in only his second senior adaptability against all types of bowling. representative match. JAY LENTON Round 1: NSW Metro 9/416 dec (Solway 139, Round 1: ACT/NSW Country 9/461 dec Despite some mixed results throughout the Bertus 128no, Mortimer 61) and 7/242 (Larkin 189,Lenton 101, Harriott 50no) and year, 2017/18 provided another exciting and (Solway 90, Clarke 55, Mortimer 49) drew 3/244 dec (Larkin 129no) drew with NSW productive Futures League season with a total with ACT/NSW Country 9/461 dec (Nair 3-96, Metro 9/416 dec (Medhurst 5-85, Pinson 2-88) of 50 players representing NSW Metro (28 Manenti 2-57, Bills 2-71) and 3/244 dec. and 7/242 (Devoy 4-76, Copeland 2-39) players) and ACT/NSW Country (22 players) Round 2: NSW Metro 334 (Bertus 99 retired Round 2: ACT/NSW Country 260 (Lenton 76no, during the year. not out, Uppal 55, Nair 40) and 2/138 Hunt 28) and 213 (McDonald 42, Taylor 39) lost The newly signed MOU between Cricket NSW (Clarke 62no, Gauci 33no) defeated WA 188 to WA 6/416 dec (Pinson 2-68, Kershaw 2-62, and Cricket ACT allowed for those players (O Keefe 3-46, Somerville 3-44, Nair 3-22) and McAndrew 2-103) and 6/316 dec (Kershaw born in regional NSW to now represent ACT/ 281 (Hatcher 3-24, Nair 3-47, Somerville 3-69) 2-45, Suidgeest 2-53) by 259 runs by 8 wickets NSW Country in Futures League matches. Round 3: ACT/NSW Country 198 (Avendano The benefi ts of this new selection model Round 3: NSW Metro 193 (Somerville 51no, 57, Cook 37) and 7/495 dec (Avendano were signifi cant. NSW was able to supply Solway 33) and 112 (Somerville 34no, Gauci 205, Lenton 97, Gilkes 77no) lost to SA 303 two highly competitive teams, whilst at the 26) defeated Tasmania 116 (Copeland 3-11, (Kershaw 5-79, Devoy 2-73) and 9/391 same time increasing the number of four day Hatcher 2-13, Somerville 2-14, Stobo 2-42) and (Cook 2-76, Medhurst 2-83, Kershaw 2-89) playing opportunities for both our current 131 (Somerville 3-25, Hatcher 3-28, Stobo 2-20) Round 4: ACT/NSW Country 177 (Hunt 82) group of quality young players within the NSW by 58 runs and 225 (McDonald 86) lost to Tasmania 87 pathway, as well as rewarding compelling Round 4: NSW Metro 145 (Gibson 38, Premier Cricket performances. (McAndrew 5-30, Kershaw 2-31) and 4/316 Mortimer 25no)and 399 (Adlam 95, Bertus 81, (Pinson 2-33) by 6 wickets Abbott 62, Sams 52) lost to Queensland 7/429 NSW Metro Round 5: ACT/NSW Country 403 (Englebrecht dec (Somerville 3-100, Abbott 2-55) and 2/152 The NSW Metro team played some very good 80, Lenton 77, Gilkes 65, Maddinson 51) and dec (Sams 2-42) by 37 runs cricket at times in their six matches, fi nishing 0/5 defeated Victoria 172 (McAndrew 3-34, the season with three wins, two losses and Round 5: NSW Metro 8/442 dec (Uppal 133, Kershaw 3-34, Englebrecht 2-24) and 235 one draw. It is fair to say that the introduction Gibson 88, Adlam 64, Nair 53) and 5/237 dec (Devoy 4-36, Englebrecht 2-33) by 10 wickets of the Dukes ball in the rounds after Christmas (Solway 93, J Edwards 80) defeated SA 234 Round 6: ACT/NSW Country 306 (Cook 56, saw several of our batters struggle to adapt (Conway 6-30, O Keefe 2-37) and 343 Englebrecht 51, Devoy 45, McAndrew 44) and to the more pronounced movement. In my (Abbott 4-65, Uppal 4-70) by 102 runs opinion, there is a need to look at the balls 8/383 dec (Lenton 109, Englebrecht 49, Cook Round 6: NSW Metro 158 (Sandhu 47no, 35) defeated Queensland 250 (McAndrew used in Premier Cricket to better reproduce the Gibson 36) and 332 (Nair 95no, Gauci 69, fi rst class environment. 5-50, Englebrecht 2-40 and 293 (Cook 4-54, J Edwards 40) lost to Victoria 360 (Stobo 6-90, Pinson 2-61, McAndrew 2-61) by 246 runs. Among the many positives were the Fallins 2-68) and 5/131 (Sandhu 2-17, The State Selection Panel will continue to use performances of those players from outside the Stobo 2-37) by 5 wickets Blues contract list. Consistent Premier Cricket the Futures League competition to stretch our performers Dan Solway, Nic Bertus, Anthony ACT/NSW Country best young talent at the expense of results. Adlam and Damien Mortimer looked more than After years of little success, it was gratifying With so many players of national interest comfortable at Futures League level, whilst the to witness the ACT/NSW Country team both in our Blues Squad and in our Pathway performances of the players still in our Pathway compete strongly in all six matches (2 wins, system, these matches will again be extremely programs Jack Edwards, , Param 3 losses, 1 draw) and fi nish the season with valuable for NSW to maintain its position Uppal and Ryan Hadley gave us a glimpse into comprehensive outright wins against Victoria as the number one producer of talent in their considerable talent. and Queensland. Australian cricket. David Freedman State Talent Manager Cricket NSW Annual Report and Yearbook 2017/18 Metropolitan andACT/NSWCountry sides. which featuredtenplayersfromboth the U/19 World CupsquadtotourNewZealand, Pakistan inlateDecemberandtheAustralian representative teamsforaseriesagainst championships, CricketAustralianamed its At theconclusionofnational fi vewickethauls. Engelbrecht andIainCarlisle,whobothtook with theballwereondisplayfromTom quarter-fi nals.Strongindividualperformances unfortunately losttoWestern Australiainthe in theearlystagesoftournamentbut ACT/NSW Countryplayedstrongcricket the championshipswithhisall-roundskills. and ParamUppal,whowasawardedplayerof batting aggregaterecordforthetournament, Ryan Hackney, whobrokeMatthewWade’s individual achievements.Aspecialmentionto championships, therewerealsoanumberof team collectivelyhavingastrongnational they hadputonadominantdisplay. Withthe fi nalagainsttheCricketAustraliaXIwhere through thetournamentandplayedoffin NSW Metropolitangatheredmomentum Northern Territory Cricketteams. Country and,underanewrelationship, Australia XI,NSWMetropolitan,ACT/NSW with 37NSWplayersselectedintheCricket represented inthesenationalchampionships, Cricket NSWagainhadstrongnumbers early intheNewYear. U/19 World Cup beingplayedinNewZealand There wasadeliberateeyeonreplicatingthe matches inthe50-overformat. championships witheachteamplayingeight Theformatfollowedonfrompreviousnational as Launcestonfrom4-15December. season, withmatchesplayedinHobartaswell changed fromAdelaidetoTasmania this The U/19MaleNationalChampionships FOR THEU/19MALENATIONAL CHAMPIONSHIPS RYAN HACKNEY, WHOSETANEWRUNSRECORD U/19

Male

National NSW METROPOLITAN TEAM (Meppem 3-32,Carlisle 2-18). Leerdam 42)defeated Victoria Metro 169 ACT/NSW Country 4/173(Sangha87notout, (Edwards 3-35,Waugh 2-16). defeated Victoria Country244 NSW Metro7/250(Hackney98,Uppal 62) Round 3: 139 (Ralston4-14,Engelbrecht2-31). Leerdam 27)defeatedNorthernTerritory ACT/NSW Country6/141(Sangha45, (Neil-Smith 3-30,Hadley2-38). 54 notout)defeatedWestern Australia205 NSW Metro5/206(Uppal72notout,Foster Round 2: No playduetoweather. ACT/NSW CountrydrewwithSouthAustralia. (Hadley 2-21,Foster2-31,Neil-Smith2-47). Holt 55,Bariol50notout)tiedTasmania 9/269 NSW MetroXI4/269(Hackney133notout, Round 1: Results Physiotherapist: Assistant Coach: Coach: Coaching staff ACT/NSW COUNTRYTEAM Physiotherapist: Assistant Coach: Coach: Coaching staff 4Asi ag Sutherland Fairfield-Liverpool SydneyUniversity AustinWaugh SydneyUniversity EasternSuburbs ChadSammut 14 Bankstown Blacktown LawrenceNeil-Smith 13 RyanMcElduff 12 Penrith Wallace Marshall 11 NorthernDistrict Manly-Warringah BaxterHolt 10 RyanHadley 9 Manly-Warringah RyanHackney Manly-Warringah 8 GeorgeFurrer 7 Campbelltown-Camden JoelFoster 6 JackEdwards Fairfield-Liverpool 5 AidenBariol 4 NathanBaker 3 ParamUppal(c) 2 1 3SmSel ACTSouthern CentralNorth Illawarra CentralCoast SamSkelly ACTSouthern ACTSouthern Tom13 Scoble JasonRalston 12 CentralNorth RyanO’Beirne 11 BlakeNikitaras ACTSouthern 10 JordieMisic ACTSouthern 9 RyanMeppem Illawarra ACTSouthern 8 DanielLeerdam 7 MatthewGilkes 6 ACTSouthern CharlieDummer 5 Newcastle IainCarlisle 4 Tom Engelbrecht 3 JasonSangha(c) 2 1 Beau Casson Greg McLay

Championships Kieran Thoms Chris Evans Grant Lambert Alex Kemp (Skelly 2-24,Ralston2-30). Sangha 68)defeatedbyVictoria Country ACT/NSW Country9/260(Dummer111, Finals (Matchfor5th&6th): Waugh 2-37). defeated CricketAustraliaXI176(Uppal3-26, NSW Metro6/296(Edwards147,Holt44) Finals (Matchfor1st&2nd): (Sangha 3-47,Ralston3-62). Engelbrecht 50)defeatedQueensland252 ACT/NSW Country283(Gilkes83, Minor Semi-finals: (Waugh 5-27,Neil-Smith 2-21). Bariol 50)defeatedWestern Australia179 NSW Metro6/288(Uppal91,Holt61, Semi-fi nals: 5/210 (Scoble2-34). Dummer 37)defeatedbyWestern Australia ACT/NSW Country8/208(Nikitaras76, Sammut 2-31). defeated Tasmania 111(Neil-Smith5-17, NSW Metro7/251(Uppal71,Waugh 67) Quarter-fi nals: (Carlisle 6-29,Sangha1-27). Nikitaras 47)defeatedTasmania 221 ACT/NSW Country4/224(Sangha62, (Furrer 2-29,Uppal2-36). not out)defeatedbyQueensland7/194 NSW Metro191(Edwards51,McElduff29 Round 5: 142 (Engelbrecht5-54,Ralston3-31). Dummer 35)defeatedCricketAustraliaXI ACT/NSW Country9/171(Engelbrecht71, Territory 127(McElduff3-34,Foster2-12). Hackney 49notout)defeatedNorthern NSW Metro1/128(Uppal61notout, Round 4: • Austin Waugh • Param Uppal • Jason Ralston • Baxter Holt • Ryan Hadley • Jack Edwards JasonSangha(c) • to tourNewZealand Australian U/19World CupSide • Lawrence Neil-Smith • Ryan Hackney • Iain Carlisle versus Pakistan Australian U/19representation

U/18 Female National Championships

ACT/NSW Country 6/136 (Wilson 64, Trenaman 34) defeated South Australia 102 (Lennon 3-6, Dalgarno-Fixter 2-9). Round 5 (T20): Victoria 5/90 (Campbell 1-9) defeated NSW Metropolitan 7/90 (Barry 38, Silver-Holmes 25). Super Over Victoria 1/6 NSW Metropolitan 3/5. Western Australia 7/79 (Trenaman 2-2) defeated by ACT/NSW Country 1/81 (Handono 42, Wilson 25*). Round 6 (T20): UNDER 18 FEMALE CHAMPIONS ACT/NSW COUNTRY South Australia 47 (Johnson 2-4, The U/18 Female National Championships Staff Afaras 2-6, Campbell 2-18) defeated by were held in Canberra from 27 November to 7 NSW Metropolitan 1/48 (Horley 27*). December 2017. NSW was represented in the Head Coach: Stephen Jenkin Tasmania 9/72 (Taylor 4-13, Trenaman 3-11) tournament by two teams: NSW Metropolitan Assistant Coach: Michelle Goszko defeated by ACT/NSW Country 1/73 (Wilson 30). and ACT/NSW Country. Six NSW players were Physiotherapist: Elyse Potter Round 7 (T20): selected to represent the Cricket Australia XI for Queensland 5/116 (Darlington 2-15) developing cricketers. In total, 34 players from ACT/NSW COUNTRY TEAM defeated by NSW Metropolitan 3/117 NSW competed in the carnival. 1 Rachel Trenaman, Captain Wagga Wagga City (Day 46*, Silver-Holmes 28*). 2 Katelyn Beaumont North Coast For the fi rst time, the U/18 Female National ACT/NSW Country 5/116 (Trenaman 41, Championships were broken into two 3 Mckenzie Carr Kinross 4 Ellie Dalgarno-Fixter Wagga Wagga City Lugg 39) defeated Victoria 7/91 National Championships, a T20 and a 50 over 5 Nell Gibson Universities (Beaumont 4-6). competition. The two teams participated in both 6 Dubbo fi nals and shared the spoils of victory. Final (T20): 7 Anita Handono Northern District ACT/NSW Country 3/131 (Wilson 72, NSW Metropolitan were determined to 8 Claire Lennon Inverell Trenaman 25; Penna 2-11) defeated by NSW dominate the tournament after winning the 9 Abby Taylor Newcastle Metropolitan 1/100 (Darke 41*, Darlington 27) previous National Championships held in 10 Matilda Lugg Woolgoolga under D/L method. Hobart. This year’s team was a mix of young and 11 Claire Murray Coro Cougars old players within the U/18 ranks. Hayley Silver- 12 Lily Tassell Hay Round 8 (50 Over): 13 Tahlia Wilson St George- Sutherland Holmes and Angie Genford were still playing in NSW Metropolitan drew with ACT/NSW 14 Naomi Woods Campbelltown-Camden the U/15 team, mixed with Ashley Day, Maddie Country – washed out. Penna and Saskia Horley in their last year of Staff Round 9 (50 Over): U/18. Strong performances from all players ACT/NSW Country drew with Queensland secured a great fi nish in the tournament with a Head Coach: Troy McKeirnan – washed out. T20 championship and a runners-up fi nish in the Assistant Coach: Tommy Anderson NSW Metropolitan drew with South Australia 50 over competition. Physiotherapist: Lisa Mains – washed out. The ACT/NSW Country team approached the Round 1 (T20): Round 10 (50 Over): tournament motivated to improve on their NSW Metropolitan drew with Western ACT/NSW Country 9/239 (Lugg 74, Wilson 71) previous third placing. The Troy McKiernan- Australia – washed out. defeated South Australia 40 (Dalgarno-Fixter coached squad played with fl air and aggression, ACT/NSW Country drew with Queensland 5-13, Taylor 3-0). suggesting they’re a team on the rise. Some – washed out. Queensland 88 (Afaras 3-18, Roebuck 2-6) strong performances by Tahlia Wilson, Matilda defeated by NSW Metropolitan 5/89 Lugg and Ellie Dalgarno-Fixter ensured the girls Round 2 (T20 – rain reduced to 18 overs): (Day 30, Horley 22). fi nished the championships well with a 50 over ACT/ NSW Country 6/85 (Trenaman 22, tournament win following their T20 runners-up. Handono 16; Roebuck 1-7, Darlington 1-7) Final (50 overs): defeated by NSW Metropolitan 4/89 NSW Metropolitan 84 (Barry 19; Dalarno- NSW METROPOLITAN TEAM (Silver-Holmes 22*, Day 19; M Penna 19; Fixter 4-21) defeated by ACT/NSW Country 1 Saskia Horley, Captain Gordon Taylor 2-19). 9/86 (Beaumont 23, Lugg 17; Campbell 3-17, 2 Isabelle Afaras Northern District Round 3 (T20): Darlington 2-4). 3 Mariam Bank St George-Sutherland 4 Kate Barry Bankstown Tasmania 6/79 (Campbell 2-20) defeated 5 Universities by NSW Metropolitan 4/83 (Day 27, U/18 Awards 6 Maddy Darke Universities Darlington 25*). Player of the Series (T20): Ellie Dalgarno-Fixter 7 Campbelltown-Camden ACT/NSW Country 2/141 (Trenaman 64*, 8 Ashley Day Universities Leading wicket taker: Ellie Dalgarno-Fixter 15 Lugg 28*) defeated CA XI 5/120 (Chauhan 24; wickets 9 Angelina Genford Bankstown Beaumont 2-29). 10 Jordann Johnson Newcastle 11 Madeline Penna Bankstown Round 4 (T20): U/18 Team of the Championships 12 Yardley Polsen Campbelltown-Camden NSW Metropolitan 7/104 (M Penna 22, Darke (NSW Players) 13 Prudence Roebuck Bankstown 18) defeated CA XI 6/79 (Turner 20, Afaras 2-8, 14 Hayley Silver-Holmes Parramatta Darlington 2-8). No Squad Chosen Cricket NSW Annual Report and Yearbook 2017/18 out oftheTournament also selectedbutsufferedaninjury ruling him Tanveer Sangha(Campbelltown-Camden) was BrockLarance (Western) • Toby Gray(Newcastle) • HughSherriff(Sydney) • BradSimpson(Bankstown) • MacJenkins(RandwickPetersham) • previous season,withfi veplayersselected: Sports AustraliachampionshipinBrisbanethe performances shownintheU/15School Cricket AustraliaU17sfromthestrong Cricket NSWwaswellrepresentedinthe GlennWinsor(Newcastle) • DomO’Shannessy(ACTSouthern) • WilliamFort(CentralNorth) • Australia U/19s: selected torepresenttheCricket individual performerswiththreeplayers ACT/NSW Countryhadmanyverygood they progressedthroughtothesemi-fi nals. As NSWMetropolitanhadahigherranking, draw thatendedanyhopeofanallNSWfi nal. quarter-fi nalwhichfi nishedinarain-affected fi nalpoolgameforcedaNSWplayoffinthe ACT/NSW Country’s losstoTasmania inthe four winsandthreelosses.Unfortunately, performances tofi nishthetournamentwith ACT/NSW Countryhadupanddown HarryManenti(Sydney)– • LiamMarshall(Bankstown)– • AjaySingh(NorthernDistrict) • OliverDavies(Manly) • were selectedfortheCricketAustraliaU/19s: acknowledged whenfourMetropolitanplayers to theteam’s fortunes.Thispointwas aspect washavingeachplayercontribute course ofthefortnight,butmostpleasing There werenumeroushighlightsoverthe against Queenslandinaclinicalperformance. the tournamentundefeated,winningfi nal The NSWMetropolitansidewentthrough following the50-oversformat. was thesameaslastyear’s, witheachmatch Brisbane. The10-teamcompetition’s structure the SunshineCoastbeforewrappingupin September to5October;kickingoffon The tournamentwasplayedfrom25 produced someexcellentcricket. Championships inQueenslandandbothteams two teamsatthisyear’s U/17National New SouthWales wasrepresentedby U/17 replacement player named theninjured

Male

National (Phillips 3-30,O’Shannessy 2-11) Claridge 46)defeatedVictoria Metro9/221 ACT/NSW Country7/223(Phillips46, R.Singh 3-25) 48) defeatedQueensland185(Hearne 4-37, NSW Metro6/235(Reynolds63,Hearne Round 3: O’Shannessy 2-22) Northern Territory 179(Phillips4-35, ACT/NSW Country5/181(Fort71)defeated Marshall 2-31) defeated Western Australia199(A.Singh3-28, NSW Metro7/201(Manenti75,Scott48) Round 2: South Australia9/280(O’Shannessy3-28) ACT/NSW Country8/279(Fort70)defeatedby Workman 2-27,Marshall2-21) defeated Tasmania 9/171(Manenti3-22, NSW Metro4/172(Davies68*,Sharma47) Round 1: Results Assistant Coach: Head Coach: Staff ACT/NSW COUNTRYTEAM Assistant Coach: Head Coach: Staff NSW METROPOLITAN TEAM 3Bo ad CentralCoast Newcastle Western BrocHardy ACTSouthern ACTSouthern GlennWinsor 13 RaviWikramanayake 12 Newcastle ACTSouthern HenryRailz 12 Riverina Newcastle KalebPhillips 11 ACTSouthern DominicO’Shannessy 10 CentralNorth JoshuaLow-McMahon 9 LewisHextell 8 NorthCoast MaxHarper 7 Newcastle Toby Gray 6 WilliamFort Riverina 5 NicholasClarke 4 JoshuaClaridge 3 JoshuaStaines(c) 2 1 Parramatta NorthernDistrict Penrith JacobWorkman Sydney Blacktown RaajdeepSingh 13 NorthSydney AjaySingh 12 Yuvraj11 Sharma Bankstown LiamScott Mosman 10 Sydney Tim Reynolds 9 LiamMarshall 8 Mosman HarryManenti NorthernDistrict 7 Campbelltown-Camden Tyson Lee 6 LachlanHearne 5 Manly SamFanning 4 LawsonEva 3 OliverDavies(c) 2 1 Anthony Clark Mark Cameron

Championships GavanTwining KylePiper (Hardy 5-33,Winsor2-48) defeated byWestern Australia248 ACT/NSW Country247(Low-McMahon48) Finals (Matchfor5th&6th): (Workman 2-19, Lee 2-22) Sharma 48)defeatedQueensland131 NSW Metro6/271(Davies58,Scott56, Finals (Matchfor1st&2nd): O’Shannessy 3-28) defeated NorthernTerritory 158(Winsor4-30, ACT/NSW Country9/303(Claridge81,Fort59) 152 (Marshall2-18,Manenti2-30) NSW Metro6/153defeatedSouthAustralia Semi-fi nals: with ACT/NSWCountry4/48(Marshall3-25) NSW Metro233(Davies60,Fanning48)drew Quarter-fi nals: Tasmania 264(Harper3-50,Clarke3-39) ACT/NSW Country197(Fort63)defeatedby R.Singh 2-28) defeated NorthernTerritory 205(Manenti3-18, NSW Metro4/165(Reynolds48,Davies45*) Round 5: 2-27, Phillips2-46) defeated byCAX1255(Hextell3-49,Clarke ACT/NSW Country241(Winsor85,Hardy59) R.Singh 2-18,A.Singh2-18) defeated Victoria Country(Marshall2-17, NSW Metro243(Reynolds103,Fanning56) Round 4 OLIVER DAVIES U/15 Female National Championships

New South Wales was again represented NSW METROPOLITAN TEAM Round 3 (T20): by two teams at the U/15 Female National 1 Hayley Silver-Holmes Captain Parramatta DCC South Australia 68 (Greig 5/9, Bassett 2/6) Championships held in Adelaide from 17-23 2 Jade Allen ACT Southern defeated by ACT/NSW Country 1/53 January 2018: NSW Metro and ACT/NSW 3 Ahilya Chandel Sydney Women’s Cricket (Litchfi eld 26*) Country. 4 Lily Dummett Sydney Women’s Cricket NSW Metropolitan 7/173 (Silver-Holmes 60, 5 Jade Errington Bankstown WCC ACT/NSW Country emerged victorious for Genford 45) defeated Tasmania 4/21 6 Hayley Elliott Bankstown WCC the third consecutive year with a dominant 7 Angelina Genford Bankstown WCC (Allen 2/5) nine-wicket victory over South Australia in 8 Molly Godsell Parramatta Round 4 (T20): the fi nal. The home state was dismissed for 9 Claire Moore Penrith ACT/NSW Country drew with Tasmania – 87 in 38 overs. 10 Shivani Mehta Lindfield CC match abandoned due to heat 11 Kate Peterson Parramatta DCC The champions had little trouble in chasing NSW Metropolitan drew with Victoria 12 Zoya Thakur Parramatta DCC down the target. ACT/NSW Country passed Metropolitan – match abandoned due to heat the South Australian total in the 14th of the 13 Sophie Vaughan Parramatta DCC Round 5 (T20): allotted 40 overs, highlighted by an 81-run Staff ACT/NSW Country 5/150 (Litchfi eld 53, opening partnership between Kayla Burton Faux 31) defeated Western Australia 40 (36) and captain Grace Dignam (30). Head Coach: Michelle Goszko (Faux 3/7, Dignam 2/8) It was also the second successive year Assistant Coach: Paul Brockley South Australia 7/99 (Genford 4/3) defeated ACT/NSW Country had fi nished the Physiotherapist: Elyse Potter by NSW Metropolitan 4/101 (Vaughan 48*, tournament undefeated. ACT/NSW COUNTRY TEAM Silver-Holmes 35*) Left-arm swing bowler Hannah Green was Round 6 (T20): named Player of the Final after an exemplary 1 Grace Dignam Captain Newcastle/Central Coast 2 Deni Baker Central North ACT/NSW Country 8/103 (Litchfi eld 48, performance for the champions. She claimed 3 Julia Bassett ACT Southern Davidson 20) defeated Victoria Metropolitan tournament best fi gures of 6-22 to complete 4 Kayla Burton Illawarra 7/71 (Greig 2/5) the competition with 10 wickets at the 5 Jessica Davidson Central North Western Australia 7/92 (Allen 2/18) defeated outstanding average of 7.4. 6 Hannah Faux North Coast by NSW Metropolitan 3/93 (Peterson 36) Sydney Thunder Academy allrounder Hayley 7 Hannah Green Newcastle/Central Coast Silver-Holmes was named Player of the 8 Isabella Greig ACT Southern Round 7 (40 Overs): Championships after her superb performances 9 Western NSW Metropolitan 193 (Silver-Holmes 65, with the bat. The NSW Metro captain was the 10 Maddison McGuigan Newcastle/Central Coast Errington 32, Genford 27; Dignam 2/5, Green 11 Grace Parsons North Coast leading run-scorer for the tournament with 350 2/28) defeated by ACT/ NSW Country 5/194 12 Sophie Shelley Newcastle/Central Coast runs at 87.50. (Dignam 55, Litchfi eld 42, Greig 28*; 13 Clare Webber Newcastle/Central Coast Thakur 2/34) Her team narrowly missed a place in the deciding match after it was defeated by Staff Finals (Match for 1st & 2nd) (40 Overs): South Australia 87 (Green 6/22, McGuigan ACT/NSW Country in the fi nal round-robin Head Coach: Steve Davies fi xture. 2/3) defeated by ACT/ NSW Country 1/88 Assistant Coach: Luke Knight (Burton 36, Dignam 30*) NSW Metro fi nished in third position on the Physiotherapist: Elyse Potter competition table, one point behind runners-up Finals (Match for 3rd & 4th): South Australia. Queensland 6/190 (Genford 2/18) defeated by Results NSW Metropolitan 3/191 (Silver-Holmes 80*, Jade Allen was best of the bowlers for Peterson 59*) NSW Metro throughout the tournament. Round 1 (40 Overs): She claimed 12 wickets at 14.08 and was ACT/NSW Country 5/214 (Faux 64*, Highest Run Scorer Hayley Silver-Holmes the second leading wicket-taker for the Burton 60) defeated Victoria Country 60 (350 runs) competition. Green fi nished equal fourth (Shelley 2/3, Davidson 2/6, Webber 2/6) Player of the Series Hayley Silver-Holmes on that list. Queensland 170 (Allen 5/30) defeated by ACT/NSW Country top order batter Phoebe NSW Metropolitan 3/172 (Silver-Holmes 105, Under 15 CA Squad Litchfi eld was the third leading run-scorer for Mehta 36) NSW Metropolitan: Hayley Silver-Holmes, the tournament with a tally of 181 runs Round 2 (T20): Jade Allen, Molly Godsell, Angelina Genford, at 45.25. Dignam was fourth with 170 runs Queensland 7/78 (Baker 3/20) defeated by Kate Peterson. at 42.5. ACT/NSW Country 1/92 (Dignam 43*, Burton ACT/NSW Country: Deni Baker, Kayla Burton, Dignam also claimed an incredible 12 catches 29) NSW Metropolitan 4/85 (Genford 30) Jessica Davidson, Phoebe Litchfi eld, during the championships which was the defeated Victoria Country 3/49 (Allen 2/11) Hannah Faux, Grace Dignam, Isabella Greig most by any player at the tournament. and Hannah Green. Her nearest rivals were Litchfi eld and Silver-Holmes with four. Cricket NSW Annual Report and Yearbook 2017/18 Physiotherapist: Manager: Head Coach: Staff MALE SQUAD the competitionwith14dismissalsat11.00. second onthelistformostscalpsthroughout for NSWatthetournamentandfi nished Martin Jeffreywastheleadingwicket-taker run-rate. Hescored52from49deliveries. required tokeepNSWaheadofthe the order, whileSmithprovidedtheacceleration Richards made55from114ballsatthetopof run chase. and BrendanSmithwerekeytothesuccessful Valuable half-centuriesbyBrynleyRichards title bythreewickets. last year’s fi nalagainstVictoria toclaimthe The NSWmen’s teamreversedtheresultof bowler forNSW. 12 scalpsat6.17andwasthestandout Captain JulieMuirfi nishedthecarnivalwith an averageof73.33. scorer forthetournamentwith220runsat partnership. Darneywastheleadingrun- Van-Veen shareda120-runopening Together withSaraDarney(55notout), and foursixes. 63 from32balls,includingsixboundaries against Queensland.Shescoredarapid-fi re Roxanne Van-Veen wasdominantinthefi nal undefeated throughoutthechampionships. eleventh consecutivetitleandremained The NSWwomen’s teamclaimedtheir and Women’s teamsbothclaimingtitles. one forNewSouthWales, withtheMen’s Once againthecarnivalwasasuccessful Performance Pathway. talent intotheCricketAustraliaHigh Championships integratesthebestIndigenous The NationalIndigenousCricket National 2BylyRcad Dharawal/ACTSouthern Dhungutti/Bankstown Wiradjuri/Western BrynleyRichards Biripi/Penrith BrendanSmith 12 Biripi/Western BenPatterson 12 Eora/Illawarra Tyran11 Liddiard Wiradjuri/Western BrockLarance Wiradjuri/CentralCoast 10 NathanielJones 9 MartinJeffrey 8 RyanFenning 7 6 Yarran Fair-Townsend Worimi/Eastern Suburbs 5 DamienDuroux Wiradjuri/ACTSouthern 4 SamDoggett DjaliBloomfield 3 2 NathanPrice,Captain 1 JoshLalor(Kamilaroi) Jeff Cook(Kamilaroi) Chris Evans Campbelltown-Camden Kamilaroi-Biripi/ Pritchard Gumbaynggir/Mount Petersham Kamilaroi/Randwick

Indigenous (S Doggett3-20,MJeffrey3-42)by 9 wickets Richards 27*)defeatedWestern Australia145 Round 5: Jeffrey 3-6) 34) defeatedTasmania 48(Bloomfi eld4-10, Round 4: 2-17) by8wickets 4-17, NJones2-3,BLarance2-9,MJeffrey defeated SouthAustralia67(DBloomfi eld Round 3: N Jones3-13)by188runs 66) defeatedQueensland58(BPatterson3-1, Round 3: S Doggett2-20)by86runs 50) defeatedVictoria 154(BPatterson5-18, Round 2: 6-16, MJeffrey2-15)by9wickets 30*) defeatedNorthernTerritory 90(BLarance Round 1: Male Results Physiotherapist: Manager: Head Coach: Staff FEMALE SQUAD NSW MEN’STEAMWHICHWONTHENICCTITLE 2NoiWosKamilaroi/Illawarra Kamilaroi/CentralNorth Naomi Woods Gumbaynggit/CentralNorth 12 Roxanne Van-Veen 11 Alex Patten AnikeLearoyd 10 Kamilaroi/CentralNorth 9 HayleeHoffmeister Wiradjuri/Western Biripi/Illawarra 8 MaddisonGreenhalgh ZoeFleming 7 6 SaraDarney Kamilaroi/Western 5 HannahDarlington Wanarua/Central Coast 4 DharminiChauhan 3 JemmaAstley 2 JulieMuir, Captain 1 NSW8/240(MJeffrey62*,BSmith SteveJenkin NSW 1/146(NAPrice80*,B NSW 7/179(BSmith61,BPatterson NSW 2/68(BPatterson22*) NSW 4/246(NPrice128,BSmith NSW 1/92(BRichards38*,NPrice KerryMarshall ChrisEvans

Championships St George-Sutherland Gundungurra/ Campbelltown-Camden Palawa/ Campbelltown-Camden Wiradjuri/ St George-Sutherland Wiradjuri/ wickets defeated Victoria 7/190(SDoggett2-55)by3 Final: Round 6: H Darlington2-33)by9wickets 55*) defeatedQueensland6/135(JMuir2-25, Final: H Darlington3-2)by9wickets defeated Western Australia36(JMuir5-10, Semi Final: (J Astley3-7,JMuir3-10)by9wickets Darlington 19*)defeatedVictoria 9/93 Round 7: J Astley2-23)by7wickets defeated Queensland6/97(HDarlington3-5, Round 6: by 137runs (D Parton1-7,NWoods 1-7,RVan-Veen 1-12) Darney 75)defeatedSouthAustralia3/52 Round 5: Round 4: (Z Fleming2-6,HDarlington2-10)by10wickets Veen 12*)defeatedNorthernTerritory 6/44 Round 3: Round 2: (J Astley4-14,ZFleming3-8)by99runs S Darney22)defeatedWestern Australia46 Round 1: Female • Jemma Astley • Hannah Darlington • Julie Muir • Dharmini Chauhan • Sara Darney 2017 Women’s BlackCapsSquad DjaliBloomfi eld • • Brendan Smith • Ben Patterson • Brock Larance • Marty Jeffrey • Nathan Price 2017 Men’s BlackCapsSquad NSW7/191(BRichards55,BSmith52) NSW 1/136(RVan-Veen 63,SDarney NSW0/45(SDarney28*,RVan- BYE NSW 1/94(SDarney52*,H NSW 3/86(DChauhan30*) NSW 1/189(DChauhan82*,S BYE BYE NSW 5/145(HDarlington61*, NSW 1/37(ALearoyd17*) McDonald s NSW Premier Cricket – Men’s Competition

The NSW Premier Cricket competition again Final Thunder Conference. The competition also comprised 20 clubs, with 15 rounds scheduled Parramatta 334 (N Bertus 85, S Abbott 62, A included teams representing ACT Cricket for First Grade and 15 rounds for each lower Turrell 55, L Dempsey 25, B Cherry 25, Association, Central Coast Cricket Association, grade. Those grades, together with the W Affl eck 20, L Neil-Smith 4-49, H Kerr 3-57, Illawarra Cricket Association and Newcastle Poidevin-Gray Shield and AW Green Shield, B Joy 2-88) defeated Sydney University 216 District Cricket Association. contributed to the Club Championship. The (H Kerr 39, T Ley 38, E Cowan 35, L Robertson Leading Batsman: Scott Rodgie (Mosman) - 2017/18 season’s Kingsgrove Sports T20 Cup 31, L Neil-Smith 21, S Copperfi eld 6-69, 259 runs competition, consisting of four preliminary S Abbott 3-47) at . Leading Bowlers: Michael Castle (Penrith) - round matches, was a stand-alone competition Benaud Medal for Player of the Final: 14 wickets that did not count towards the Club Scott Copperfi eld (Parramatta). Championship or First Grade competition. Leading Wicketkeeper: Ryan Mizzi (Hawkesbury) - 8 dismissals First Grade Limited-Overs Cup Club Championship - Table: The Sydney Smith Cup Sydney University won the First Grade Limited- Sydney Sixers Conference: Mosman 24; Overs Cup, for the fi rst time since 2010/11 Gordon 18; Sydney 18; Sutherland 18; Manly-Warringah won the Club Championship and for the second time overall, by defeating Eastern Suburbs 12; Newcastle 12; Randwick for the eighth time overall and for the fi rst Parramatta in the fi nal at Old Kings Oval. Petersham 12; St George 12; UNSW 6; Manly- time since 2014/15, by a margin of eighty-fi ve Leading Batsman: Daniel Solway (Bankstown) Warringah 6; Illawarra 6; North Sydney 0. points over Parramatta, with Northern District - 365 runs Sydney Thunder Conference: Hawkesbury 24; in third place. Leading Bowler: Tim Ley (Sydney University) - Parramatta 24; Penrith 24; Northern District Table: Manly-Warringah 1,435; Parramatta 21 wickets 18; Bankstown 12; Sydney University 12; 1,350; Northern District 1,318; Sydney 1,278; Leading Wicketkeeper: Michael Stretton Western Suburbs 6; ACT 6; Campbelltown- Sydney University 1,242; Gordon 1,226; Penrith (Bankstown) - 16 dismissals Camden 6; Fairfi eld-Liverpool 6; Blacktown 6; 1,173; Hawkesbury 1,122; Eastern Suburbs Central Coast 0. 1,109; Randwick Petersham 1,055; Bankstown Table: Campbelltown-Camden 24; Parramatta Semi-fi nals 1,020; Mosman 971; Western Suburbs 967; 20; Bankstown 19; Sydney 19; Sydney Campbelltown-Camden 912; St George 817; University 18; Sutherland 18; Manly- Sydney Sixers Conference: Sutherland 2/156 Sutherland 720; UNSW 718; North Sydney Warringah 13; Eastern Suburbs 12; St George defeated Mosman 8/150 at Allan Border Oval; 714; Blacktown 649; Fairfi eld-Liverpool 539. 12; Mosman 12; Fairfi eld-Liverpool 12; Sydney 143 and 1/18 defeated Gordon 143 Western Suburbs 12; Northern District 12; and 2/6 on Super Over at . First Grade - The Belvidere Cup Randwick Petersham 12; Gordon 6; UNSW 6; Sydney Thunder Conference: Hawkesbury Hawkesbury 6; Penrith 6; Blacktown 6; 4/117 defeated Northern District 116 at Parramatta won the Belvidere Cup for the fi rst North Sydney 0. Owen Earle Oval; Penrith 6/182 defeated time since 1964/65 after defeating Sydney Quarter Finals Parramatta 9/160 at Old Kings Oval. University in the fi nal at Bankstown Oval. Eastern Suburbs 5/265 defeated Campbelltown- Conference Finals Leading Batsman: Daniel Solway (Bankstown) Camden 8/264 at Raby 1; Parramatta 7/195 - 1,268 runs defeated Manly-Warringah 194 at Old Kings Sydney Sixers Conference: Sydney 5/147 Oval; Bankstown 5/296 defeated Sutherland defeated Sutherland 9/115 at Sydney Leading Bowler: Tim Ley (Sydney University) - Cricket Ground. 59 wickets 137 at Bankstown Oval; Sydney University 282 defeated Sydney 170 at . Sydney Thunder Conference: Penrith 3-99 Leading Wicketkeeper: Tim Cummins defeated Hawkesbury 96 at Sydney Cricket (Sydney University) - 48 dismissals Semi-fi nals Parramatta 2/169 defeated Eastern Suburbs Ground. Table: Campbelltown-Camden 58; Parramatta 165 at Old Kings Oval; Sydney University 289 Final: Sydney 7/158 (D Rawlins 57, 58; Sydney University 57; Sutherland 55; defeated Bankstown 250 at Bankstown Oval. B McClintock 41*, B Williams 2-19, M Castle Gordon 52; Sydney 52; Bankstown 52; Final 2-27, L Hodges 2-29) defeated Penrith 122 Manly-Warringah 51; Randwick Petersham 51; (R Gibson 30, R Smith 24*, B Manenti 2-17, St George 49; Eastern Suburbs 44; Sydney University 7/277 (T Cummins 121*, D Mortimer 71, H Kerr 25, J White 4-58) N Sowter 2-17, N Bills 2-22) at Sydney Western Suburbs 43; Penrith 38; Hawkesbury Cricket Ground. 38; Fairfi eld-Liverpool 30; Northern District defeated Parramatta 8/272 (B Cherry 75, 27; Mosman 26; UNSW 22; North Sydney 15; N Bertus 68, W Affl eck 33, T Ward 25, Kingsgrove Sports Player of the Final: Blacktown 13. T Crittenden 20, T Ley 3-48, D Malone 2-47) (Sydney). at Old Kings Oval. Qualifying Finals Sydney 7 (dec) 307 defeated Campbelltown- Michael Bevan Medal for Player of the Final: Camden 198 at Raby 1; Parramatta 4-230 drew Tim Cummins (Sydney University). with Gordon 8 (dec) 331 at Old Kings Oval; Sydney University 4/320 drew with Sutherland Kingsgrove Sports T20 Cup 5 (dec) 428 at Sydney University Oval. Sydney won the Kingsgrove Sports T20 Cup Semi-fi nals and $12,000 prize money by defeating Penrith Parramatta 3/257 drew with Campbelltown- in the fi nal at the Sydney Cricket Ground. Camden at Old Kings Oval; Sydney University Penrith received $4,000 as runner-up. The 431 defeated Sydney 127 competition was made up of two Conferences, at Sydney University Oval. with participating teams aligned with the BILL O’REILLY MEDALLIST JONATHAN COOK Sydney Sixers Conference and the Sydney (WESTERN SUBURBS) Cricket NSW Annual Report and Yearbook 2017/18 (Blacktown) -38dismissals - 55wickets in thefi nalatSydneyUniversityOval. and forfi fthtimeoverall,bydefeatingSydney University forthefi rsttimesince2015/16 The MitchellCuphasbeenwonbySydney Third Grade–TheMitchellCup Aaron Flaherty(NorthernDistrict). Jack MoranMedalforPlayerofthe Final: Table: Leading Wicketkeeper: Leading Bowler: Leading Batsman: in thefi nalatMarkTaylor Oval. time overall,bydefeatingManly-Warringah fi rsttimesince2005/06andfortheeighth Northern DistrictwontheAlbertCupfor Second Grade–TheAlbertCup s McDonald A Singh2-85)atMarkTaylor Oval. T Kaye21,JMiller4-52,Felton2-53, 90, AVirdi 53,JGraham30,ABariol28, defeated Manly-Warringah 256(SGainsford Badings 82*,CWaters 26*,JCarden3-47) Northern District5/258(AFlaherty95,N Final at OwenEarleOval. defeated Hawkesbury139 at MarkTaylor Oval;Manly-Warringah 194 Northern District6/217defeatedMosman215 Semi-fi nals Manly Oval. Manly-Warringah 308defeatedMosman69at Sydney University304atOwenEarleOval; Mark Taylor Oval;Hawkesbury400defeated Northern District9/388drewwithSydneyat Qualifying Finals St George19;Fairfield-Liverpool 8;Sutherland0. Bankstown 34;Western Suburbs31;Gordon30; North Sydney44;Parramatta38;UNSW36; Randwick Petersham55;Blacktown48; Suburbs 55;Campbelltown-Camden University 65;Sydney62;Penrith59;Eastern Manly-Warringah 67;MosmanSydney - 892runs FIRST GRADEPREMIERS,BELVIDERE CUPWINNERSPARRAMATTA Northern District 90; Hawkesbury 73; Northern District90;Hawkesbury73; Tony Clark(Blacktown) KerrodGordon(Hawkesbury) ThomasKeast

NSW

Premier 37 wickets (Western Suburbs)-54wickets - 28dismissals 660 runs (Northern District) -505runs University Oval. 3-31, JLawson3-41,SWood 2-43)atSydney Sydney 170(LScott51,MSharma43,KTate Sherriff 5-41,HManenti2-31)defeated Cowan 63,MRobinson31,EArnott24,H Sydney University274(CLitchfi eld99,A Final Drummoyne Oval. 204 and7/144defeatedEasternSuburbs78at Parramatta 135atPetershamOval;Sydney Sydney University141and5/124defeated Semi-fi nals Petersham Oval. University 269defeatedMosman137at 103 and5(dec)172atAsquithOval;Sydney 190 and3/52defeatedNorthernDistrict Parramatta 122atMerrylandsOval;Sydney Eastern Suburbs195and8/146defeated Qualifying Finals Sutherland 14. Blacktown 19;Campbelltown-Camden 31; NorthSydney21;Fairfi eld-Liverpool19; 43; StGeorge38;Hawkesbury33;UNSW Western Suburbs 50;Penrith44;Bankstown Warringah 51;Randwick Petersham50; 57; EasternSuburbs56;Gordon53;Manly- Sydney University67;Mosman57; Leading Bowler: Leading Batsman: Suburbs inthefi nalatManlyOval. second timeoverall,bydefeatingWestern for thefi rsttimesince1972/73andforthe The ReidCupwaswonbyManly-Warringah Fourth Grade– TheReidCup Ash Cowan(SydneyUniversity). Mick FavellMedalforPlayeroftheFinal: Table: Leading Wicketkeeper: Leading Bowler: Leading Batsman:

Cricket Parramatta 72;NorthernDistrict69; AnandVerma (Parramatta)- Rowan Carthey MayankSharma(Sydney)- HamishGreen

–

Mens Kieran Shone(Penrith)

Competition (Penrith) -33dismissals 40 wickets (UNSW) -45dismissals (Bankstown) -632runs J Crombie2-4)atManlyOval. B Gaunt28,SAlexander4-22,ABain3-40, defeated Western Suburbs132(CHotham33, 3-35) and3-51(JWalter 30*,RCarthey2-25) Brewster 47,EParmakellis5-30,RCarthey Manly-Warringah 159(AGummer54,M Final Asquith Oval. (dec) 244defeatedNorthernDistrict156at at LMGrahamReserve;Western Suburbs7 Manly-Warringah 213defeatedGordon194 Semi-fi nals defeated Gordon155atPrattenPark. at DrummoyneOval;Western Suburbs5/182 District 128and2/114defeatedSydney94 University 172atLMGrahamReserve;Northern Manly-Warringah 7/174defeatedSydney Qualifying Finals Liverpool 13;Campbelltown-Camden12. St George24;UNSW20;Mosman14;Fairfi eld- Sydney 42;Sutherland30;Blacktown25; 50; EasternSuburbs48;BankstownNorth Petersham 59;Parramatta51;Hawkesbury 62; SydneyUniversity59;PenrithRandwick 81; Western Suburbs78;Gordon63;Sydney defeated Sutherland 68and117atManlyOval. Merrylands Oval;Manly-Warringah 123and3/66 Parramatta 5/153defeated Gordon149at Semi-fi nals Phillips South. Parramatta 257defeatedUNSW202 atDavid 7/277 defeatedPenrith134atManly Oval; 96 atChatswoodOval;Manly-Warringah Sutherland 120and6/173defeated Gordon Qualifying Finals Northern District13;RandwickPetersham8. Suburbs 24;Campbelltown-Camden19; 34; Sydney32;Fairfi eld-Liverpool31;Western Sydney 41;University36;Hawkesbury 48; EasternSuburbs45;StGeorge44;North 62; Bankstown54;Mosman52;Blacktown Parramatta 71;Manly-Warringah 63;Sutherland Table: Leading Wicketkeeper: Table: Leading Wicketkeeper: Leading Bowler: Leading Batsman: Parramatta inthefi nalatOldKingsOval. and forthesecondtimeoverall,bydefeating Warringah forthe fi rsttimesince2010/11 The DavidSherwoodCupwaswonbyManly- Fifth Grade– TheSherwoodCup Adam Gummer(Manly-Warringah). David GivneyMedalforPlayeroftheFinal: Manly-Warringah 84;NorthernDistrict Gordon 80; Penrith 78; UNSW 73; Gordon 80;Penrith78;UNSW73; GurnoorSingh(UNSW)- AlexKouventaris Timothy Whiticker Andrew Coleman Final Warringah) and Hugh Sherriff (Sydney) - 22 Cook fi nished the season with 19 votes, two Manly-Warringah 179 (D Wheeler 87*, wickets clear of his nearest rival St George all-rounder G Isaacs 46, L Gillies 5-19, J Greig 2-24, Leading Wicketkeeper: Ethan Debono (Sydney) Nick Stapleton. Veteran all-rounder and A Graham 2-37) and 0/55 (B Mendel 26*, – 17 dismissals Campbelltown-Camden captain Jarrad Burke N Cohen 23*) defeated Parramatta 134 fi nished in outright third with 16 votes. Table: Parramatta 39; Gordon 37; Manly- (A Maitra 40, C Blue 20, D Marshall 5-25, Warringah 32; Sydney 30; Northern District Leading players: Jonathan Cook (Western J Graham 2-10, G Archer 2-45) and 5 (dec) 119 27; Bankstown 26; Hawkesbury 25; North Suburbs) 19 votes; Nick Stapleton (St George) (L Gillies 41*, J Clinton 39, B Falconer 2-32, Sydney 24; Sutherland 24; Eastern Suburbs 20; 17; Jarrad Burke (Campbelltown-Camden) 16; G Archer 2-36) at Old Kings Oval. Randwick Petersham 19; Sydney University 18; Daniel Solway (Bankstown), Jamie Brown James Rodgers Medal for Player of the Final: Mosman 18; Fairfi eld-Liverpool 18; Blacktown (Sutherland) and Scott Rodgie (Mosman) 14; Dylan Marshall (Manly-Warringah). 14; Campbelltown-Camden 13; Penrith 13; Nick Larkin (Sydney University), UNSW 12; St George 12; Western Suburbs 0. (Randwick Petersham), Ben Manenti (Sydney) Poidevin-Gray Shield (U/21) Quarter-fi nals and Axel Cahlin (Gordon) 13. Penrith won the Poidevin-Gray Shield for the Parramatta 9/202 defeated North Sydney 121 Under the rules of the competition, any fi rst time since 2009/10 and for the fourth time at Old Kings Oval; Gordon 8/201 defeated player found guilty of a breach of the Code overall, by defeating Gordon in the fi nal at Hawkesbury 200 at Killara Oval; Manly- of Conduct during the season is ineligible to Howell Oval. Warringah 8/203 defeated Bankstown 156 at receive the O’Reilly Medal. Leading Batsman: Ryan Hackney (Penrith) - LM Graham Reserve; Northern District 8/209 432 runs defeated Sydney 207 at Drummoyne Oval. Kingsgrove Sports Merit XII – Leading Bowler: Harmon Sandhu Semi-fi nals First Grade Team Of The Year (Fairfi eld-Liverpool) - 24 wickets Parramatta 9/200 defeated Northern District 174 at Merrylands Oval; Manly-Warringah The Kingsgrove Sports First Grade Merit XII Leading Wicketkeeper: Joshua Bass (Sydney) 7/130 defeated Gordon was fi rst introduced in 2012/13 to recognise - 21 dismissals. 129 at Killara Oval. the leading players in the First Grade Competition. Selection is based on statistics in Table: Manly-Warringah 29; Parramatta 28; Final First Grade preliminary-round matches during Hawkesbury 26; Penrith 25.5; Campbelltown- Parramatta 6/167 (H King 63, R Johns 50, the season. The team includes the six highest Camden 25; Gordon 23; Sydney 22; Fairfi eld- B Overton 24*, J Hobson 3-26, J Park 2-30) run-scorers, the four leading wicket-takers, Liverpool 22; Northern District 20; St George defeated Manly-Warringah 9/165 (B Mendel the leading wicketkeeper and the O’Reilly 20; Western Suburbs 18; Mosman 13; Eastern 59, A Bennett 40, T Hargreaves 5-25, H King Medallist as captain. Players with an equal Suburbs 13; Sutherland 12; Blacktown 10.5; 2-24) at Merrylands Oval. UNSW 10; North Sydney 10; Bankstown 9; number of runs or wickets are separated by Randwick Petersham 6; Sydney University 1. Kevin Cunningham Medal for Player of the superior average and, for wicket-keepers, Final: Tyrone Hargreaves (Parramatta). by most runs. Quarter-fi nals Commemorative caps were generously donated Fairfi eld-Liverpool 99 defeated Manly- O’Reilly Medal – First Grade Player Warringah 87 at Manly Oval; Sydney 6/233 by Harry Solomons of Kingsgrove Sports. defeated Parramatta 177 at Old Kings Oval; Of The Year Captain: Jonathan Cook (Western Suburbs): Gordon 6/143 defeated Hawkesbury 140 at The O’Reilly Medal for the First Grade Player of 56 wickets Owen Earle Oval; Penrith 4/228 defeated the Year is named after former Australian and Batsmen: Daniel Solway (Bankstown): 1,090 Campbelltown-Camden 113 at Howell Oval. NSW leg-spinner and journalist, Bill O’Reilly. runs, Joshua Clarke (Hawkesbury): 1,082 runs Semi-fi nals Leg-spinner Jonathan Cook has become the Scott Rodgie (Mosman): 978 runs Penrith 1/66 drew with Fairfi eld-Liverpool at fi rst Western Suburbs player in forty-fi ve years Jamie Brown (Sutherland): 947 runs Howell Oval; Gordon 8/200 drew with Sydney to claim the O’Reilly Medal, judged by umpires Nicholas Selman (UNSW): 904 runs at Chatswood Oval. who award votes on a 3-2-1 basis at the end Jake Fawcett (Blacktown): 899 runs Final of each match. Wicketkeeper Beau McClintock (Sydney): 35 Penrith 7/229 (J Wholohan 65*, C Weir 46, In just his third season with Western Suburbs dismissals & 335 runs T Weir 33, B Atherton 26, M Wright 3-22) and his second as captain, Cook collected 56 Bowlers Jarrad Burke defeated Gordon 145 (M Wright 30*, L Windel wickets at an excellent average of 15.5 and (Campbelltown-Camden): 47 wickets 25, A Hazard 3-22, R Singh 2-14, R Fletcher received votes in eleven of fi fteen matches Ben Manenti (Sydney): 47 wickets 2-29) at Howell Oval. including being named Player of the Match on Tim Ley (Sydney University): 44 wickets Shane Lee Medal for Player of the Final: two occasions. Nick Stapleton (St George): 41 wickets Jake Wholohan (Penrith).

AW Green Shield (U/16) Parramatta won the AW Green Shield for the fi rst time since 2007/08 and for the sixth time overall, by defeating Manly-Warringah in the fi nal at Merrylands Oval. Leading Batsman: Zeeshaan Ahmed (Bankstown) - 345 runs

Leading Bowlers: Alex Deller (Randwick FIRST GRADE LIMITED-OVERS CUP WINNERS SYDNEY UNIVERSITY Petersham), Lachlan Molyneux (Manly- Cricket NSW Annual Report and Yearbook 2017/18 (North Sydney)–Groundsman BernieVince - GroundsmanSeanGlashoff Randwick Petersham7.98. Gordon 8.02;SydneyUniversity7.99; average; Sutherland8.16;StGeorge8.04; University) & MarkMorley(EasternSuburbs) Lower GradeGround oftheYear: First Grade: Grounds OfTheYear Premier Cricketasaplayerandcoach. made asignifi cant contributiontoNSW cricket formorethanfourdecades,andhas Bob Simpsonwasakeyfi gureinAustralian players intheirrespectiveclubs. development oftheteamsandindividual contribution ofcoachestowardsthe The Award isdesignedtorecognisethe Simpson Award forCoachoftheYear. Parramatta’s JasonColemanwontheBob Of TheYear Bob SimpsonAward – Coach Leading Clubs: each match. the PreambletoLawsofCricket,during support fortheSpiritofCricket,assetoutin Offi ciatingumpiresassessedeachteam’s time since2009/10andforthirdoverall. Northern Districtwonthisawardforthefi rst Spirit OfCricket Fifth Grade: Fourth Grade: Third Grade: Second Grade: First Grade: management andcommunicationskills. captaincy skills,personalperformance,team the conclusionofeachmatchforon-fi eld Each captainisassessedbytheumpiresat Captains OfTheYear KINGSGROVE SPORTST20CUPWINNERSSYDNEY s McDonald Joe McAleerReserve(Blacktown) Nick Larkin(SydneyUniversity) Warwick Hayes (St George) Ben Fisher(NorthernDistrict) AlasdairGrant(Sydney NorthernDistrict8.23points Tony Clark(Blacktown)

NSW Tunks Park

Premier milestone of10,000runsand 600wickets. in 125yearsofthe competitiontoreachthe Noble andAnthony Clarkastheonlymen wickets. Burkejoined GrantLambert,Monty achieve thedoubleof10,000runsand 600 in thehistoryofSydneyFirstGradecricket to Jarrad Burkebecameonlythefourth player sixes inaSydneyFirstGradeT20match. Sutherland, settinganewrecordfor most Watson scored114notoutfrom53ballsfor IntheSixersconferencesemi-fi nal,Shane Bertus 206(225balls)highlightedround5. A superbdoublecenturyfromParramatta’s Nick 1918 andtheendofFirstWorld War. 11am tomarkthearmisticeof11November with allclubsholdingabriefceremonyat Round 5wasnamedRemembranceDay second at17years251daysinMarch2007. Grade centuriessinceSteveSmithmadehis youngest playertohavescoredtwoFirst in round5.His100notoutmadehimthe Sangha continuehisrisetoprominence named inhishonour. round 4ofMcDonald’s NSWPremierCricket World War Onewascommemoratedwith fast bowlerAlbert`Tibby’ Cotter’s deathin The 100thanniversaryofNSWandAustralian runs whenmakingtheirdebuthundred. not out),noyoungerplayerhasscoredmore By postinghismaidenFirstGradecentury(162 McDonald’s NSWPremierCricketcompetition. one ofthemostpromisingyoungbatsmenin Jason Sanghaconfi rmed hisdevelopmentas batsman inanygradeagainstStGeorge. smashed 184,thehighestscorebyaSutherland rounder andcurrentSydneyThundercaptain Shane Watson, the formerAustralianall- Kain whoumpiredhis600thmatch. Round 2wasaspecialoccasionforLindsay of 1-42andtwocatches. wicket inthetopgrade,fi nishingwithfi gures missed outwiththebatbuttookhismaiden captain Steve.PlayingforSutherland,Waugh of AustinWaugh, sonoflegendaryAustralian Round 1wasnotablefortheFirstGradedebut Season Highlights

Cricket

Mens

Competition and Parramattaskipper NickBertus(1,018). (1,070), MosmancaptainScottRodgie (1,050) Sutherland top-orderbatsmanJamie Brown Sydney UniversitycaptainNickLarkin (1,097), University batsmanDamienMortimer (1,115), Josh Clarke(1,123),promisingyoung Sydney Solway (1,268),Hawkesburyall-rounder the markwereBankstownopenerDaniel record setin2002/03.Thosethatreached the 2017/18season,whichequalled Seven playersscoredover1,000runsduring eight inningsduring1897/98. Australian batsmanscored1,021runsinjust as thefastesttoreachmark.Thegreat The illustriousVictor Trumper holdstherecord 1967/68 campaign. scored 1,138runsinhisfi rst12inningsofthe former Australianbatsman,BobSimpson,who player toreach1,000runsinaseason,joining Nick Larkinbecametheequalsecond-fastest to fi nishthe2017/18 seasonasMinorPremiers. on thefi rstgrade tableattheendoflastseason Campbelltown-Camden rosefromlastposition First Gradecentury. Only eightyoungerplayershavescoreda born inthe21stcenturytoscoreacentury. followed suitbybecomingthefi rstplayer in aninnings,17-year-old LachlanHearne became thefi rstmillennialtotakefi vewickets Just aweekafterPenrithbowlerTrent Weir Grade cricketbeforetheir20thbirthday. have scoredfourcenturiesinSydneyFirst (6), aswellBobSimpson(5),mento greats RonKissell,ArthurMorrisandSmith NSW batsmanArchieJackson(8)andfellow He sitsalongsidelegendaryAustralianand score fourcenturiesbeforetheir20thbirthday. and pastplayers,includingSteveSmith,to Australia’s andNewSouthWales’ bestcurrent Nineteen-year-old AxelCahlinjoinedsomeof Greg Mail(15,242runs). NSW BluesandSydneyUniversitybatsman, pass 13,000FirstGraderunsbehindformer became onlythesecondplayerinhistoryto In round13,EasternSuburbs’IanMoran wickets inaninnings. player inaFirstGradematchtoclaim8 Oval inround12.Hebecametheyoungest innings victoryoverBankstownat for Manly-Warringah inacomprehensivefi rst Eighteen-year-old JoelFoster(8-23)waslethal incredible 321forSutherlandin2007. opening batsmanPhilJaquesscoredan since formerAustralianandNewSouthWales The inningswasthehighestFirstGradescore Mosman inround10atAllanBorderOval. outstanding 246from276ballsagainst University captain,NickLarkin,postedan NSW BluesopeningbatsmanandSydney McDonald s NSW Premier Cricket – Women’s Competition

Club Championship – First and Second Grade Table: Parramatta 82 points; St George- Sutherland 79; Universities 63; Northern The Ann Mitchell Shield Combined T20 District 53; Campbelltown-Camden 36; St George-Sutherland won the Club In its second season as a combined fi rst Bankstown Sports 27; Gordon 13; Sydney 6. Championship for the ninth time in their and second grade competition, the T20 history. They had a total of four teams premiership was won by Bankstown Sports, Semi-Finals competing in the SCAWC, appearing in every defeating St George-Sutherland in the fi nal at Northern District 6/173 (Anika Learoyd 66*, limited overs and T20 fi nal bar one throughout Hurstville Oval. Kate Peterson 2-38) def by Parramatta 5/176 (Kelsey Miller 83, Wui-Kwan Wong 3-18) by 5 the season. Combined T20 Player of the Year: Laura Wright wickets at Bruce Purser Reserve. Table: St George-Sutherland 1235.7 points; (Bankstown Sports) St George-Sutherland 8/161 (Mariam Bank Bankstown Sports 1118.6; Gordon 999.9; Leading Batter: Laura Wright 51, Taylor Ling 2-19) def by Universities 6/162 Universities 954.9; Northern District 706.3; (Bankstown Sports) – 347 runs Campbelltown-Camden 658.7; Sydney 596.4; (Shebani Bhaskar 61*, Taylah Knight 2-22) by Leading Bowlers: Qanita Jalil, Rebecca Green Parramatta 472.6; Penrith 438.8; Manly- 4 wickets at Harold Fraser Reserve. and Teresa Graves (Universities), Warringah 59.1; North West Sydney 0.4. Emily Mifsud (St George-Sutherland) and Final Universities 9/163 (Jade Christie 41, First Grade – Kristen McCormack (Parramatta) – 8 wickets Leading Wicketkeeper: Laura Wright Kelsey Miller 3-21) def by Parramatta 0/164 The Ruth Preddy Trophy (Bankstown Sports) – 9 dismissals (Kelsey Miller 124*) by 10 wickets at Grahame Thomas Oval. Universities, who fi nished the regular season Table: Universities Gold 40 points; Bankstown in second place, secured the First Grade Sports 33; Sydney 33; St George-Sutherland Player of the Final: Kelsey Miller (Parramatta) Limited Overs title against fourth placed St 31; Gordon 26; Penrith 19; Northern District George-Sutherland at Blacktown International 16; Universities Blue 13; Parramatta 9; Third Grade Sports Park 2. Campbelltown-Camden 7. In the 40-over competition, which was held Kingsgrove Sports First Grade before Christmas, Bankstown Sports won Semi-Finals Player of the Year: Rhiannon Dick their fi rst Third Grade title since 1990/91 by Universities Gold 77 (Maddy Darke 17, Sophie (Bankstown Sports) defeating St George-Sutherland in the Final, Heath 3-10) def by St George-Sutherland 1/78 breaking their stranglehold on the premiership. Leading Batter: Rhiannon Dick (Tahlia Wilson 34*, Teresa Graves 1-13) by 9 (Bankstown Sports) – 485 runs wickets at Hurstville Oval. Third Grade Player of the Year: Erica James (Universities) Leading Bowler: Emily Mifsud Bankstown Sports 2/128 (Rhiannon Dick 48*, (St George-Sutherland) – 24 wickets Gizelle Plummer 1-34) def Sydney 87 Leading Batter: Erica James (Universities) – Leading Wicketkeeper – The Christina (Naomi McDonald 20, Denbigh Morris 5-8) 634 runss Matthews Shield: Laura Wright (Bankstown by 41 runs at Olds Park. Leading Bowler: Litara Aoina – 29 wickets Sports) – 15 dismissals Leading Wicketkeeper: Georgina Rae – Final Table: Bankstown Sports 70 points; 10 dismissals Bankstown Sports 5/118 (Rhiannon Dick 36, Universities 62; Gordon 57; St George- Sophie Heath 3-28) def St George-Sutherland Table: Bankstown Sports 48.7 points; Sutherland 50; Penrith 39; Northern District 8/95 (Joanne Kelly 17, Samantha Devlin 3-15) St George-Sutherland 43.9; Universities Black 35; Sydney 34; Campbelltown-Camden 22. by 23 runs at Hurstville Oval. 38.6; Gordon 37.7; Campbelltown-Camden 33; Universities Blue 17.3; North West Sydney 4.9. Semi-Finals Player of the Final: Samantha Devlin Bankstown Sports 8/191 (Laura Wright 60, (Bankstown Sports) Semi-Finals Cailyn Fountain 2-25) def by St George- Bankstown Sports 8/135 (Hayley Elliott 52*, Sutherland 5/192 (Tahlia Wilson 75*, Second Grade Emily Spring 2-25) def Gordon 67 (Kristen Erin Burns 3-22) by 5 wickets at Dorsch 15, Zoha Siddiqi 4-10) by 68 runs at Bankstown Memorial Oval. Parramatta won the Second Grade Limited Overs Premiership in a rain-delayed fi nal Grahame Thomas Oval. Gordon 9/132 (Hannah Trollip 49, Maisy against Universities at Grahame Thomas St George-Sutherland 7/194 (Alana Gillett 53*, Gibson 5-16) def by Universities 2/133 Oval. It was Parramatta’s fi rst Second Grade Jade Christie 4-23) def Universities Black 191 (Georgia Redmayne 64, Shannon Heath 1-17) premiership. (Shebani Bhaskar 50*, Susan Shaw 2-29) by 3 by 8 wickets at Alan Davidson Oval. Kingsgrove Sports Second Grade runs at Gifford Park. Player of the Year: Kelsey Miller (Parramatta) Final Final Universities 5/289 (Georgia Redmayne 141*, Leading Batter: Kelsey Miller (Parramatta) Bankstown Sports 146 (Angelina Genford Rene Farrell 2-53) def St George-Sutherland – 650 runs 51*, Stephanie Gillett 4-21) def St George- 152 (Clare Crewdson 35, Qanita Jalil 3-5) by Leading Bowler: Taylah Knight (St George- Sutherland 124 (Margaret Harpham 40, 137 runs at BISP 2. Sutherland) –28 wickets Angelina Genford 5-14) by 22 runs at Player of the Final: Georgia Redmayne Leading Wicketkeepers: Michelle Rigney O’Neil Park. (Universities) (St George-Sutherland) and Sarah Abdulwahab Player of the Final: Angelina Genford (Sydney) – 11 dismissals (Bankstown Sports) Cricket NSW Annual Report and Yearbook 2017/18 (St George-Sutherland) THE RUTHPREDDYTROPHY LIMITEDOVERSPREMIERSUNIVERSITIES Player oftheFinal: Table: Reserve. Bankstown Sportsinthefi nalatMarco crowned premiersafterdefeatingthird-placed after ChristmaswithStGeorge-Sutherland The ThirdGradeT20competitionwasheld Third GradeT20 s McDonald 9 wicketsatMarcoReserve. Sutherland 1/96(AlanaGillett34*)by 30*, LisaMcIntyre2-16)defbyStGeorge- Bankstown Sports7/94(HayleyElliott Final 34 runsatForsythPark. (Georgina Smith33*,HayleyElliott2-14)by 32*, EmilySpring2-19)defGordon6/107 Bankstown Sports5/141(AngelinaGenford 30*) by9wicketsatBeverleyHillsPark. St George-Sutherland1/77(StephanieGillett Universities Gold75(LeannePond3-12)defby Semi-Finals Sydney -4.7. Campbelltown-Camden 34.2;NorthWest Universities Gold45;Blue44.7; Gordon 74.7;BankstownSports73.5; St George-Sutherland82.7points; Lisa McIntyre

NSW

Premier Sutherland) –18wickets Langsford Trophy: – 11Dismissals by 7wicketsatJensenOval. Powell 35*,NatalieMcMaster1-7) Lauren Kua4-4)defbyGordon3/97(Abigail St George-Sutherland9/96(IsabellaSavelli34, Final Semi-Finals abandonedduetopoorweather. Semi-Finals Universities 11.9;Manly-Warringah 11.1. Parramatta 40.4;Sydney39.9;Penrith21.2; Northern District47.4;BankstownSports41; Sutherland 51.4;Campbelltown-Camden48.4; – 379runs Player oftheFinal: Table: Leading Wicketkeeper: Leading Bowler: Leading Batter: Brewer ShieldPlayeroftheYear at JensenOval. defeating StGeorge-SutherlandintheFinal their fi rstBrewerShieldtitlein10yearsby The 40-overcompetitionsawGordonwin Brewer Shield(U/17)

Cricket Gordon 55.6points;StGeorge- KinjalKumari(Gordon) AliceWhelan(StGeorge-

Kinjal Kumari(Gordon) Lauren Kua(Gordon) Womens Kinjal Kumari(Gordon)

– TheTrish

Competition Gordon 6.2;Universities3.8. 25.6; Sydney25.3;StGeorge-Sutherland13.7; Northern DistrictGold38.6;BankstownSports Northern DistrictBlue42.2;Parramatta39.6; Award Bob CurtinMemorialUmpires Award forseason 2017/18. Manly-Warringah wontheSpiritofCricket to theLawsofCricket. Spirit ofCricket,assetoutinthePreamble who assesseachteam’s adherencetothe This awardisjudgedbyoffi ciatingumpires Spirit ofCricketAward Table: of thetable. the Premiershipbyorderoffi nishingtop top ofthetableafter6roundstoclaim In theT20competition,Gordonfi nished The RegTulk Shield Brewer ShieldT20– across allgrades. from Universities,whopolledthemostpoints This awardwaswonbyShebaniBhaskar points ona3-2-1basiseachmatch. The awardisjudgedbyumpireswhoallocate Campbelltown-Camden 42.8points; McDonald s Sydney Shires

Fourteen clubs contested the Shires Peter Toohey Medal for Player of the Final: Southern Districts 39; Pennant Hills 38; North competitions. The four grades, together with Adam Coyte (Mt Pritchard-Southern Districts). West Sydney 25; Roseville 16; Lane Cove the Frank Gray Shield, comprised the Club 13; Macquarie University 12; Balmain South Championship. Second Grade – The SJ Mayne Sydney 3. Trophy Qualifying Finals Club Championship – The David Georges River 219 defeated Auburn 101 at Tribolet Trophy Warringah won the SJ Mayne Trophy for Lance Hutchinson Oval; Burwood Briars 142 fi rst time since 2015/16 and the eighth time and 216 defeated Warringah 118 and 8/102 Burwood Briars won the Shires Club overall, by defeating Burwood Briars in the at Ron Routley Oval; Epping 2/207 defeated Championship for the sixth consecutive season fi nal at Kanebridge Oval. Strathfi eld 137 at Epping Oval. and for the 21st time overall, by a margin of Leading Batsman: Shaun Bridges (Mt Semi-fi nals 315.5 points over Epping with Warringah in Pritchard-Southern Districts) - 661 runs Georges River 189 defeated Strathfi eld 126 third position. Leading Bowler: Bradley Morgan (Epping) - at Lance Hutchinson Oval; Epping 112 and Table: Burwood Briars 1487.50; Epping 42 wickets 2/85 defeated Burwood Briars 92 and 8 (dec) 1172; Warringah 1157; Georges River 1127; Leading Wicketkeeper: Tom Moffi tt (Burwood 133 at George Parry Oval. Strathfi eld 1071; Auburn 1022; Lindfi eld 865.2; Briars) - 42 dismissals Final Mount Pritchard-Southern Districts 771; Lane Georges River 3/152 (J Mazurkiewicz 77*, Cove 670; Roseville 536; Pennant Hills 449.6; Table: Burwood Briars 85.7; Epping 76; N Condylios 29, B McCarthy 2-29) defeated Balmain South Sydney 448; North West Warringah 74; Auburn 59; Lindfi eld 54; Epping 151 (D Shaw 29, S Henry 26, B Ford 24, Sydney 347; Macquarie University 258. Georges River 36; Balmain South Sydney 36; Strathfi eld 34; Lane Cove 28; Roseville 24; B Napier 4-48, D Rapson 2-13, J Bowler 2-42) at Lance Hutchinson Oval. First Grade - The RB Clark Cup Macquarie University 24; North West Sydney 23; Pennant Hills 18; Mt Pritchard-Southern SCA Medal for Player of the Final: Jarrod For the second consecutive season, the RB Districts 12. Mazurkiewicz (Georges River). Clark Cup was won by Mt Pritchard-Southern Qualifying Finals Districts after defeating Burwood Briars in the Burwood Briars 198 defeated Georges River Fourth Grade – The Harry Culbert fi nal at Joe McAleer Reserve. 184 at Airey Park; Epping 136 and 1/82 Trophy Leading Batsman: Brad Maguire (Mt Pritchard- defeated Lindfi eld 116 at North Epping Oval; Southern Districts) - 989 runs Warringah 245 defeated Auburn 151 at The Harry Culbert Trophy was won by Burwood Leading Bowler: Adam Coyte (Mt Pritchard- Weldon Oval. Briars for the fourth consecutive season and for the tenth time overall, after defeating Southern Districts) - 60 wickets Semi-fi nals Georges River in the fi nal at Hurstville Oval. Leading Wicketkeeper: Max Dodds Burwood Briars 417 defeated Auburn 85 at (Lane Cove) - 44 dismissals Ron Routley Oval; Warringah 8/147 defeated Leading Batsman: Luwis Anthony (Mt Pritchard-Southern Districts) - 510 runs Table: Burwood Briars 64; Mt Pritchard- Epping 144 at North Epping Oval. Southern Districts 63; Lane Cove 57; Final Leading Bowler: Oliver Vinter (Warringah) - Strathfi eld 52; Georges River 51; Auburn Warringah 137 (N Heath 94*, S Davis 5-31, 47 wickets 50; Epping 48; Warringah 34; Roseville 34; S Tregeagle 3-45, A Vendrasco 2-40) and 2/87 Leading Wicketkeeper: Murray Stanton Balmain South Sydney 31; Lindfi eld 25; (L Charles 31, R Ali 23*) defeated Burwood (Georges River) - 24 dismissals Pennant Hills 23.6; Macquarie University 6; Briars 116 (R Nandi 22, C O’Connor 21, G Table: Georges River 87; Burwood Briars 81; North West Sydney 0. Davies 4-24, H Brown 2-17, B Wigney 2-33) Warringah 77; Strathfi eld 67; Auburn 65; Qualifying Finals and 6 (dec) 105 (C Iaquinto 36*, C O’Connor Lindfi eld 54; Epping 44; North West Sydney 36; Burwood Briars 175 and 1/111 defeated 26, G Davies 4-53) at Kanebridge Oval. Roseville 24; Mt Pritchard-Southern Districts Auburn 98 and 187 at Rothwell Park; Mt SCA Medal for Player of the Final: Nathan 23; Lane Cove 20; Macquarie University 18; Pritchard-Southern Districts 2/190 defeated Heath (Warringah). Pennant Hills 6; Balmain South Sydney 6. Georges River 187 at Greenway Oval 1; Lane Qualifying Finals Cove 158 defeated Strathfi eld 118 and 8/113 Third Grade – The JB Hollander Georges River 142 and 3/89 defeated Lindfi eld at Tantallon Oval. Trophy 138 and 119 at Bland Oval; Burwood Briars Semi-fi nals 153 and 1/110 defeated Auburn 55 at George Burwood Briars 235 defeated Strathfi eld 81 at Georges River won the J B Hollander Trophy Parry Oval; Strathfi eld 141 and 227 defeated Rothwell Park; Mt Pritchard-Southern Districts for the fi rst time since 2008/09 and for the Warringah 123 at Frank Gray Oval. 398 defeated Lane Cove 184 at Greenway second time overall, by defeating Epping in 1. fi nal at Lance Hutchinson Oval. Semi-fi nals Georges River 219 and 2/30 defeated Final Leading Batsman: Jason Bowler (Georges River) - 663 runs Warringah 188 at Bland Oval; Burwood Briars Mt Pritchard-Southern Districts 81 (W Bull 32, 237 defeated Strathfi eld 113 at Airey Park. J Kovacic 5-18, D Heels 3-8, M Seymour 2-39) Leading Bowler: Dave Jiffkins (Georges River) and 194 (B Wright 50, D Duroux 40, R Lucey 27, - 45 wickets Final B Maguire 24, T Marlin 20*, M Seymour 4-47, Leading Wicketkeeper: Jarrod Mazurkiewicz Burwood Briars 3/151 (H Peters 52*, M Cohen B Van den Nieuwenhof 2-31) defeated Burwood (Georges River) - 33 dismissals 31, B Sculley 24, L Andrews 22*) defeated Briars 118 (M Squire 46, S Nardo 22, A Coyte Table: Georges River 76; Burwood Briars Georges River 148 (M Stanton 58, R Liley 26, 8-67, R Lucey 2-32) and 89 (M Seymour 31, 75; Epping 74; Strathfi eld 64; Warringah A Salgueira 24, M Roper 3-3, G Metcalfe 3-20, A Coyte 8-47) at Joe McAleer Oval. 56; Auburn 52; Lindfi eld 43.8; Mt Pritchard- E Ralph 2-32) at Hurstville Oval. Cricket NSW Annual Report and Yearbook 2017/18 coads McDonald Roper (Burwood). at RothwellPark. (T Moffat4-11,J4-17,WDenny2-23) J Kovacic3-38)defeatedBurwoodBriars60 A Palmer3-12,BVan denNieuwenhof3-14, Warringah 111(T Moffat28,AMahn20, Final Lindfi eld116atRothwellPark. Weldon Oval;Burwood Briars188defeated Warringah 7/233 defeatedStrathfi eld94at Semi-fi nals Sydney 13;Auburn6;NorthWest Sydney6. Districts 27;GeorgesRiver19;BalmainSouth 33; Strathfi eld33;MtPritchard-Southern University 0. Roseville 19;PennantHills12;Macquarie Lindfi eld27;Epping19;LaneCove Inkster (Strathfi eld)-15dismissals. 16 wickets 317 runs average of10.4. an averageof49.1andtook49wicketsat with 16votes.Seymourscored688runsat Burwood Briars’MarcSeymourwontheaward preliminary rounds. basis ineachFirstGradematchduringthe Votes areawardedbytheUmpiresona3-2-1 Shires PlayerOfTheYear Tully Moffat(Warringah). David GilbertMedalforPlayeroftheFinal: Sydney ThunderConference: Sydney SixersConference: Tables: Leading Wicketkeeper: Leading Bowler: Leading Batsman: fi nalatRothwellPark. overall, afterdefeatingBurwoodBriarsinthe fi rsttimesince2013/14andforeighth Warringah wontheFrankGrayShieldfor Frank GrayShield(U/24) SCA MedalforPlayeroftheFinal: Kiran Dindayal(LaneCove)- Tahmid Islam(Strathfi eld)- Lachlan Bennetts-

Sydney Warringah 32; BurwoodBriars Matthew

Shires received thisaward. of Conductduringtheseasonisineligibleto player foundguiltyofabreachtheCode Under therulesofcompetition,any (Mt Pritchard-SouthernDistricts). Andrew Donovan(Strathfi eld)&RickLucey Maguire (MtPritchard-SouthernDistricts)12; (Lane Cove)&NasirJalil(Auburn)13;Brad 15; Tahmid Islam(Strathfi eld)14;LiamO’Hare Briars) 16votes;JoshuaBlake(PennantHills) Max Dodds(LaneCove):39dismissals Wicketkeeper & 32wickets Marc Seymour(BurwoodBriars):603runs All-rounder andCaptain Tahmid Islam(Strathfi eld):490runs Arfan Haider(BalmainSouthSydney):524runs Alastair Fitzpatrick(Roseville):575runs Joshua Blake(PennantHills):629runs Districts): 824runs Brad Maguire(MountPritchard-Southern Batsmen the players. Commemorative capswerepresentedto by mostruns. average and,inthecaseofwicket-keepers, runs orwicketsareseparatedbysuperior Any playerstiedonthesamenumberof Shires PlayeroftheYear, namedascaptain. takers, theleadingwicketkeeper, withthe the leadingall-rounder, thefourleadingwicket selected includingthefi vehighestrun-scorers, preliminary roundsonly. Elevenplayersare the teamisbasedonstatisticsinFirstGrade in theFirstGradeCompetition.Selectioninto The MeritXIrecognisestheleadingplayers The Year XI –ShiresFirstGradeTeam Of Sydney CricketAssociationMerit Leading players: Marc Seymour(Burwood (Warringah) &Zen Malik(LaneCove)6. 8; CharlesFernandes(Roseville),RahibAli Sydney) &AlexPalmer(BurwoodBriars) (Strathfi eld),HarryThomas(BalmainSouth Timbrell (Lindfi eld)9;Tanzeelur Rahman 11 votes;BenO’Connell(Epping)10;Nathan 38 wickets Adam Coyte(MtPritchard-SouthernDistricts): 40 wickets Rick Lucey(MtPritchard-SouthernDistricts): Andrew Donovan(Strathfi eld):43wickets Liam O’Hare(LaneCove):48wickets Bowlers Howes Epping) Leading players: during thecompetition. Strathfi eld’s Tahmid Islamwhopolled11votes a 3-2-1basis.In2017/18,thisawardwasby the Year isassessedbyoffi ciatingumpireson Each season,theFrankGrayShieldPlayerof The Year Frank GrayShieldPlayerOf Groundsman JeffWheatley. Rothwell Park(BurwoodBriars)– Shires GroundOfTheYear This awardwaswonbySimonDodwell. Shires UmpireOfTheYear Sydney 7.17. Cove 7.36;Warringah 7.30;BalmainSouth North West Sydney 7.52;Roseville7.43;Lane Macquarie University7.53pointsaverage; Leading Clubs fi rsttime. Macquarie Universitywonthisawardforthe Spirit OfCricketAward Fourth Grade: Third Grade: Second Grade: First Grade: Shires CaptainsOfTheYear AndrewDonovan(Strathfi eld) IanBassett(Warringah) &James Ben Worger (Georges River) MoDewji(Auburn) Tahmid Islam(Strathfi eld) Cricket Performance

CRICKET PERFORMANCE STAFF 2017/18

The 2017/18 season was another successful the Women’s One-Day International series U/18 Female National Championships one for Cricket Performance, with NSW against India in March. Nicola was then (50 overs) Pathway teams fi nishing fi rst or second in rewarded for her season with an Australian ACT/NSW Country 1st; NSW Metro 2nd each Cricket Australia National Pathway contract for season 2018/19. Championship available and the Lendlease Daniel Hughes was named the Steve Waugh U/19 Male National Championships Breakers winning the WNCL title for the Medallist for 2017/18, after a strong season NSW Metro 1st; ACT/NSW Country 6th 19th time. averaging 41.31 in the Sheffi eld Shield and The CNSW youth high performance pathway The Lendlease Breakers successfully defended 63.17 in the JLT One-Day Cup with the bat played an outstanding role in producing their WNCL title, defeating Western Australia at the top of the order. Trent Copeland was Australian youth representatives this season. at Blacktown International Sports Park in a awarded the JLT Sheffi eld Shield MVP after Seven of the fi fteen selected players for the dominant display from Alyssa Healy, Ellyse taking 34 wickets at an average of 25.38 for U/19 Cricket World Cup, held in New Zealand, Perry and Sarah Aley. Healy was awarded the season. were NSW pathway players. Jason Sangha ‘Player of the Match’ for her outstanding Ellyse Perry won the Belinda Clark Medal from ACT/NSW Country was the captain. innings of 122. for a second time after topping the WNCL Also, seven of the fi fteen players selected Unfortunately for the NSW Blues, they run scoring with 372 runs at an average of for the Australian U/19 tour of South Africa fell short of a fi nals appearance in the JLT 74.40 and 552 runs at an average of 46.00 in were from the NSW Women’s pathway. The One-Day Cup after an abandoned match and the WBBL for the Sydney Sixers. The acting captain of that team was Rachel Trenaman disappointing performances cost them a spot Australian Captain Rachael Haynes was from Riverina. in the semi-fi nal. In the JLT Sheffi eld Shield, named Lendlease Breakers WNCL MVP after the Blues had a strong start to the season; scoring 363 runs at 90.75 with a high score of This season, both our men’s and women’s however, after Christmas, they fell away and 103 not out. NSW AIME Indigenous teams competed in the fi nals of the National Indigenous Cricket fi nished fi fth. The NSW Youth teams improved their already Championships, with both male and female Despite some excellent individual impressive record at National Championships, teams claiming the title. performances and promotion of young talent, the highlights of which are as follows: both NSW Metropolitan and ACT/NSW This year, we farewelled Alex Blackwell, Doug Country fi nished fi fth and sixth respectively on SSA 15 & Under Male National Bollinger and Ed Cowan as they announced the points table in the Toyota Futures League. Championships their retirement. Each player has made a signifi cant contribution to Cricket NSW and The WBBL was again launched in NSW with NSW Magenta 2nd, NSW Green 3rd we thank them for their service to the game. each team competing at North Sydney Oval. U/15 Female National Championships The Sydney Thunder fi nished the season Finally, I wish to express my thanks to our strongly; however they fell short in the semi- ACT/NSW Country 1st; NSW Metro 3rd Cricket Performance staff, part time support fi nal against the Perth Scorchers. The Sydney staff, coaches and offi cials for their much U/17 Male National Championships Sixers went on to win the tournament and valued efforts over another successful season. became the fi rst team to successfully defend NSW Metro 1st; ACT/NSW Country 6th David Moore the title. General Manager - Cricket Performance U/18 Female National Championships (T20) Following strong form in both the WNCL and WBBL, Nicola Carey debuted for Australia in NSW Metro 1st; ACT/NSW Country 2nd Cricket NSW Annual Report and Yearbook 2017/18 SchoolSportAustralia15Years andUnder • Under15FemaleNationalChampionships • Under18FemaleNationalChampionships • Under18FemaleNationalChampionships • Under17MaleNationalChampionships • Under19MaleNationalChampionships • Highlights a T20component. the CricketNSWAcademyCurriculumhaving saw itincludemoreplayersandcoaches,with continued expansionoftheacademyprogram ages U/15,U/16,U/17,U/18andU/19.The with whiteballsandcolouredpadsfor rounds intheU/13andU/14wereintroduced, Country Thunder. InDubbo,twoT20pinkball Metropolitan Thunder, Country6ersand all agegroupsalignedasMetropolitan6ers, Under 19.StateChallengessawteamsacross Challenge competitionsfromUnder13to Cricket NSWcontinuedtoconductState for bothmalesandfemales. pathway acrosstheirdesignated‘mega-region’ implementation anddeliveryoftheplayer accountable forthealignment,promotion, The CoachingandTalent Specialistsare the CoachingandTalent Specialistrollout. This seasonsawtheimplementationof Years andUnderNationalChampionships. and thirdintheSchoolSportAustralia15 Australia Tournaments andfi nishingsecond the underagepathways,winningallCricket Cricket NSWhadanotherdominantyearin ACT/NSW Country. Championships asNSWMetropolitanand at allCricketAustraliaUnderageNational players fromNSWandACTtocompete ACT andCricketAustralia,whichallows MOU signedbetweenCricketNSW, Cricket Cricket NSWentereditsfourthseasonofthe Cricket second; NSWGreenthird. National Championships–NSWMagenta Metropolitan third. – ACT/NSWCountryfi rst;NSW Metropolitan second. (One-day) –ACT/NSWCountryfi rst;NSW Country second. (T20) –NSWMetropolitanfi rst;ACT/NSW Country sixth. – NSWMetropolitanfi rst;ACT/NSW Country sixth. – NSWMetropolitanfi rst;ACT/NSW

NSW

Pathways Under19,fourteamscompetedatRaby. • Under17,fourteamscompetedinCoffs • Under16,fourteamscompetedatRaby. • Under14,eightteamscompetedinDubbo. • Under13,eightteamscompetedinDubbo. • NSW StateChallengeswereheldasfollows: Male Country NSW. super zonesacrossMetropolitanSydneyand high performancecarnivalwiththecreationof umpires withtheopportunitytoexperiencea State Challengesprovideplayers,coachesand State Challenges STATE CHALLENGE Harbour. Senior Manager–Pathways James Henry metropolitan andregionalacademies. as wellspecialistcoachvisitsto both training sessionsfortoptieredathletes included increasedoneoninseason to theCricketNSWAcademyprogram NSW MaleAcademyprogram.Improvements and eightmetropolitansquadscomprisingthe Female Academyprogram,withtenregional seven metropolitansquadsmadeuptheNSW In the2017/18season,nineregionaland Academy Curriculum. following theintroductionofaCricketNSW mental, tactical,technicalandphysical, gathering skillsacrosskeyareasincluding development oftheindividual,withathletes wide programthatfocusesontheholistic The CricketNSWAcademyisastate CNSW Academy Under18,fi veteamscompetedatRaby. • Under15,fourteamscompetedatRaby. • NSW StateChallengeswereheldasfollows: Female Coach Education and Development

This season, Cricket Australia, in conjunction with the states and territories, delivered the fi rst ever Premier Cricket Coaches Summit. The Premier Cricket Coaches Summit concept is to add value to the current support that State and Territory associations are providing their Premier Cricket coaches, to further support, develop and connect Premier Cricket coaches and recognise their role as an integral part of the Australian Cricket Pathway. The summit was held on 15-16 July 2017 at the Bupa National Cricket Centre in Brisbane, allowing coaches access to staff and programs to develop technical skill, people management and system leadership.

Talent Identifi cation And PHIL JAQUES COACHING THE BLUES Development This year has been very successful regarding Representative Coaching Course Cricket NSW’s continued focus during coach accreditation, education, identifi cation (Level Two) 2017/18 was to identify talented coaches and development. A total of 77 representative coaches were and provide them with the opportunity to In conjunction with Cricket Australia, accredited across three Representative coach teams at a ‘level above’. This saw Cricket NSW employed eight Coaching Courses held in NSW. All courses were held at selected coaches given opportunities to coach and Talent Specialists across NSW. The the “What’s Your Plan B?” SCG Indoor Centre. within State Challenges, Underage National roles were agreed as part of the One Team Championships, WBBL, BBL and NSW Futures High Performance Coaching Course High Performance and Game and Market League. Development model concepts presented to (Level Three) It is important to note that all appointed the Steering Committee in January 2017. Two candidates from the Cricket NSW Cricket NSW Coaching and Talent Specialists Learnings from the pilot project have been Academy, ACA and Pathway Programs have came from the Cricket NSW Coaching factored into the approach outlined below. been selected by Cricket Australia to attend Pathway. The areas that worked in the pilot were the the Cricket Australia High Performance consistent activities, sharing knowledge and Coaching Course in Brisbane June 2018. Within the Cricket NSW High Performance Coaching Department, the following coaches the leverage of central support and systems. The candidates are: had development opportunities through Cricket The Coaching and Talent Specialist is • Rachael Haynes Australia and the ICC: accountable for the alignment, promotion, • Michelle Goszko implementation and delivery of the player and • Mark Cameron was named Assistant coach pathway across their designated ‘mega- Coach of the U/16 Cricket Australia XI for region’ for both males and females. This Education the series against Pakistan. includes the delivery of coach development As part of the Coaching and Talent Specialists’ • Beau Casson and Anthony Clark attended activities (e.g. Community and Representative role, a bi-monthly interactive coaching spin-week in Brisbane. coach education, coach workshops and newsletter was produced. It was made • Beau Casson headed to USA as part of the seminars). available to a selective list of accredited High Performance Coach Study Tour. Emphasis has been placed on the accreditation coaches within each region and the content • Cricket NSW had Dr Wade Gilbert (author process with Cricket Australia and Cricket includes interviews with coaches, upcoming of ‘Coaching Better Every Season’) present NSW agreeing to make all Community Coach courses, articles of the month and coaching four sessions to staff in May 2018. (Level One) Courses for the 2017/18 season resources. • Mark McInnes and Troy McKiernan free of charge. This has seen Cricket NSW The Coaching and Talent Specialists delivered accredit 1295 new community coaches. attended the U/18 Female National Talent 42 Coach Education Seminars and Workshops Camp in Brisbane. Cricket NSW has placed an emphasis on across the state with the following topics education, identifi cation and development of addressed: Over the past two summers, Cricket NSW has developed a ‘coach mentor’ program working coaches working within club cricket and the • Workloads and Cricket NSW Player Pathway. with National Championship Coaches. The • Batting program has been successful with the mentees Accreditation • ‘Attributes of an Effective Coach’ developing confi dence, additional skills and • a strong working relationship with their mentor over the period allowing for growth, Community Coaching Course (Level One) • Talent and Pathway promotions and more effective coaching. Cricket NSW conducted 79 Community Coach • Paddy Upton ‘Coaching Effectiveness’ James Henry Accreditation Courses in both metropolitan Senior Manager – Pathways and regional NSW during 2017/18, with 1295 coaches accredited as a result. Cricket NSW Annual Report and Yearbook 2017/18 highest levelsincluding: scholars haverepresentedAustraliaatthe Throughout thehistoryofprogram,16 two-year cricketequipmentsponsorship. ,eachscholarisoffereda Through theongoingandgeneroussupportof Holders 2017/18 BasilSellersScholarship social skills. their education,training,employmentand lifestyle andaimstoassistallscholarswith cricketers whomayneedtoadjustacity It providessupporttothoseregionalandrural on theirfamilies. elite cricketcareerwhilereducingtheburden exciting youngcricketersinNSWtopursuean The programhasallowedsomeofthemost between 16and19. and femalecricketersfromacrossNSW, aged The scholarshipisawardedtopromisingmale powerhouse ofAustraliancricket. the process,ensuredNSWcontinuestobe sports peopleinthegameofcricketand, record ofretainingthemosttalentedyoung Since 2006,theprogramhasanimpressive season 2017/18. Scholarship Programmarkedits12thyearin Director, BasilSellersAM,the of philanthropistandformerNSWCricket Thanks tothegenerosityandleadership and former BluespacemanTimm Van der as wereSouthAustralian batsmanTom Cooper Robson, wasalsoa graduateoftheprogram, Former Test openingbatsmanforEngland, Sam The sa hwj 5Adam Zampa Mitchell Starc 15 14 Naomi Stalenberg 13 StevenSmith UsmanKhawaja 12 Gurinder Sandhu 8 PhillipHughes 12 EllysePerry 7 AlyssaHealy ErinOsborne 11 NicMaddinson 10 6 JoshHazlewood 9 5 AshleighGardner 4 PatrickCummins 3 LaurenCheatle 2 SeanAbbott 1 4MatildaLugg–wicketkeeperbatterSawtell 14 EmmaHughes–fastbowlerDubboMacquarie 13 AshleyDay–allrounderUniversities 12 12 MaddyDarke–wicketkeeperbatterUniversities 11 StellaCampbell–fastbowlerUniversities 10 AustinWaugh –allrounderSutherland 9 ThomasSowden–allrounderBankstown 8 7 6 BaxterHolt–wicketkeeperbatterEasternSuburbs 5 RyanHadley–fastbowlerBlacktown 4 RyanHackney–openingbatterPenrith 3 JackEdwards– allrounder –Manly-Warringah 2 AidenBariol–wicketkeeperbatterManly-Warringah 1 Camden Hannah Darlington–allrounderCampbelltown- University Lawrence Neil-Smith–fastbowlerSydney Districts, ACT –wicketkeeperbatterWestern

Basil

Sellers Taryn Heddo, JeremyMaher, Jake Doran,Stefanie Daffara,DanielFallins, Lauren Smith. , MikaylaHinkley, Jonte Pattison,BayleyMcGill,Tom Jagot, Amy Edgar, MikaylaHinkley. Brendan Smith,MacWright,Lauren Cheatle, Liam Hatcher, ArjunNair, LewinMaladay, Carly Leeson,Tahlia Wilson,HannahTrethewy. Mikayla Hinkley, RachelTrenaman, Matthew Gilkes,JordanGauci, Ryan Hackney, AustinWaugh, LewinMaladay, Jason Sangha,ThomasSowden, 2013/14: 2014/15: 2015/16: 2016/17: Past Recipients Darlington,CampbellandDarkealsomade • HannahDarlingtonearnedherfi rstWBBL • Edwards,Holt,Waugh, RyanHackney, • Fourofthemalescholars–JackEdwards, • Highlights for AustraliawasAshleighGardner. The mostrecentBasilSellersScholartodebut Gilchrist in2004. Australian wicketkeeperbatsmanAdam with greatAustralian,NSWandWestern scheme wasmastermindedbyMrSellers total numberofscholarsto108sincethe The intakeforthe2017/18seasontakes at theInternationallevelofgame. Gugten, whohaverepresentedtheNetherlands Africa EmergingWomen. England Women’s Academy andSouth Women Tri-Series whichinvolvedthe Under 19levelinAprilduringtheEmerging their fi rstappearancesforAustraliaatthe Campbell wasthirdonthatlist. 18 FemaleNationalChampionships.Stella wicket takersduringthe2017/18Under season. Shewasamongthetop10leading contract withtheSydneyThunderthis wicket-takers. was equalsecondonthelistforleading scorer atthetournament,whileNeil-Smith Hackney wasthesecondleadingrun- 19 MaleNationalChampionshipstitle. Australia XItoclaimthe2017/18Under Metro teamthatdefeatedtheCricket were allapartofthevictoriousNSW Lawrence Neil-SmithandAidenBariol by eightwickets. Australia lostthedecidingmatchtoIndia the tournamentwith216runsat43.20. second leadingrun-scorerforAustraliaat Final inNewZealand.Edwardswasthe that madethe2018Under19World Cup Waugh –featuredintheAustraliansquad Ryan Hadley, BaxterHoltandAustin

Scholarship HenryThornton,JamesPsarakis, Riley Ayre, SoumilChhibber, Jordan Gauci,MatthewGilkes, Param Uppal,RyanHadley,

Program Damien Mortimer, Tom Skelly. Alyssa Healy, SamanthaHinton,EllysePerry Sandy Rogers,BenSmith,AdamZampa, Nic Maddinson,DavidMiller, JamesMcNeil, Luke Doran,DavidFarrell,BlakeHutchison, Kara Sutherland,EllysePerry Alyssa Healy, SamanthaHinton,ErinOsborne, Timm vanderGugten,AdamZampa, Nic Maddinson,SandyRogers,BenSmith, Adam Coyte,AndrewHarriott,BlakeHutchison, Sammy-Jo Johnson Keeghan Tucker, LisaGriffi th, Brendan Reynolds,Taylor Scott, Aaron Flaherty, AndrewHarriott, Scott Heaney, PatrickCummins, Katie Mack,HannahTrollip. Keeghan Tucker, EmilyLeys,NicolaCarey, David Garness,NathanPrice,Tom Skelly, Gurinder Sandhu,Taylor Scott,SamReading, Celeste Raack. Tom Skelly, AshleyJames,NaomiStalenberg, Jake Doran,ShaneCassel,SamReading, Usman Khawaja. James Phathanak,DanielBurns, Jordan Magro,KaineHarmsworth, Tom Cooper, MarcusHainsworth,PhilipWells, Steven Smith,MitchellStarc James Phathanak,SamRobson,SandyRogers, Simon Keen,RyanMedley, DavidMurphy, David Farrell,JoshHazlewood,PhillipHughes, 2008/09: 2009/10: 2010/11: 2011/12: 2012/13: support of thecarnival. We thank MrSellersforhis magnanimous 137 runsat45.67. deserved recipient thisyearafterheamassed North CoastbatsmanCharlesMitchell wasa carnival intermsofperformanceand conduct. most outstandingcountryplayerduring the The Warren SmithMedalisawardedtothe undefeated. Thunder whowentthroughthecompetition This yearthetitlewastakenoutbyCountry Boys’ CoachingClass. program withinCricketNSW, theCountry and integratedtheoldestdevelopment at theRabySportsComplexinCampbelltown The carnivalwasheldoverthreedaysinApril and countryacrossthestate. impressive Under16talentsfromboththecity within CricketNSWandmatchesthemost a proudhistoryofyouthdevelopment The BasilSellersStateChallengecontinues 16 StateChallenge The 2017/18BasilSellersUnder 2006/07: 2007/08: Tim Armstrong,AdamCoyte, NathanBrain,SeanAbbott, BradChard,KurtisPatterson, Sean Abbott,Tim Armstrong, Harry Conway, GurinderSandhu, ,MatthewDay, Adam Coyte,MatthewDay, NSW Districts Cricket Association

In a time of great change in cricket, it was an Inter-Association Shield Winners honour to be elected Chairman of the NSW Districts Cricket Association. This season, the After a total of over 400 matches spanning from October 2017 – March 2018, we congratulate Executive Committee has worked tirelessly to the winners of the eleven competitions. continue developing the pathway for aspiring AGE SHIELD WINNERS PLAYER OF THE SERIES ASSOCIATION young cricketers across NSW. Under 10 WG Foster North Shore James O’Sullivan St George The DCA Inter-District Shield competitions Under 11 JH Creak Manly-Warringah Ethan Buchanan Manly-Warringah provide representative opportunities for junior Under 12 Cawsey North Shore Archie Gowthorp North Shore and senior cricketers of member associations Under 13 WS Gee Blacktown Harjas Singh Bankstown and form a crucial cog in the development Under 13 (Girls) Mollie Dive Bankstown Eva Ragg Canterbury Wests pathway for cricketers within NSW. Under 14 Harold Moore North Shore William Salzmann Camden Under 15 EG Weblin Newcastle Matthew Garnero Illawarra It would be remiss of me not to thank the Under 15 (Girls) Margaret Peden Bankstown Hayley Elliott Bankstown outgoing Chairman, Craig Menzies, for Under 16 CS Watson North Shore Toby Gray Newcastle his tenure and to the Association’s former Under 23 Telegraph Blacktown Not Applicable Executive Offi cer, Jason Lawless, for his years Open Martin Camden Not Applicable of service. However, we welcomed onboard Brett Holliday, Steven Crane and Peter Payne Executive Members: Appreciation who all brought a well-rounded knowledge of cricket administration and competition • Morris Iemma (Chairman) The NSWDCA would like to thank the management. • Michael Ross (Deputy Chairman) following: In April 2018 we were saddened to learn • Brett Holliday (Executive Offi cer) • The Cricket NSW Board for their continued support. of the passing of Peter Payne. Peter was a • David Toose (Treasurer) great administrator who did everything as an • Harry Solomons and Kingsgrove Sports • Peter Payne administrator in the Blacktown area. He was Centre for their generous and continued a life member of the BC&DCA and Plumpton- • William Howard support of the DCA. Kingsgrove provide gift Glendenning CC. Pete was a man who put • Steven Crane vouchers to the ‘Cricketer of the Year’ in everything he owned into cricket and, on • Gregory Liggins each Junior Shield. behalf of the Executive Committee and myself, • Eric Myatt • Local Councils for their provision of we would like to thank and acknowledge grounds and facilities for cricketers playing • Bruce Parker Peter’s contribution to cricket across NSW. community cricket. • Nick Theodorakopoulos • Kookaburra Sport for contra Season Highlights • Luke Miner (Administration Offi cer) provided to competing associations who In an exciting season for Australian cricket, enter in the Inter-District Shields. the NSW Districts Cricket Association was Club Championship Shields • Parents, umpires, scorers and volunteers proud to introduce Cricket Australia endorsed The Shell Company of Australia Shield, who contribute to the success of each Junior Formats for Foster, Cawsey and Mollie for the most successful association across Inter-District Shield competition. Dive Shields. This entailed providing playing junior competitions – North Shore conditions for these Shields which put skill James Searle Shield, for the most successful The Future development for players to the forefront. association across senior competitions – In 2018/19, the NSW Districts Cricket Season 2017/18 also saw continued growth Blacktown Association will continue the implementation within female cricket via the Under 15 Rae & Alan Ward Shield, for the most of Junior Format Representative Competitions Margaret Peden Shield and Under 13 Mollie successful association across girls as recommended by Cricket Australia. In Dive Shield after their re-introduction back competitions – Bankstown addition, in line with Cricket NSW strategy, into DCA competitions in recent years. the DCA will continue to explore ways to Additionally, this season saw the fi nals of introduce T20 formats into Inter-District the Watson and Weblin Shields contested on Shield competitions. adjacent fi elds at Bland and Hutchison Ovals Morris Iemma respectively. The carnival-like atmosphere Chairman was well supported and I would like to extend my thanks to Canterbury Wests for the use of the playing venues and for Georges River St George for hosting a canteen on the day. This is an initiative the committee are going to build on for the coming season. Winners of the respective Shields can be found below:

Sydney Cricket Association

Membership of the Association Committee Of Management The Committee thanks those persons for their assistance, when required, in considering At its 31st Annual General Meeting on 21 Delegates alleged breaches of the Code of Conduct. August 2017, the SCA elected a Committee During the season, the Commissioners B Freedman, M Klumpp (Bankstown); of Management comprising Messrs A Falk considered 79 alleged breaches of the A Day, S Foster (Blacktown); M Richardson, (Chairman), C Hambleton (Deputy Chairman), Code. The Commissioners offered 71 M Iemma (Campbelltown-Camden); E Atkins, A Frank, B Freedman and persons a penalty, ranging from a caution M van Vugt, A Tham (Eastern Suburbs); R Timbs. The SCA subsequently approved to four matches. On two occasions, the R Cook, A Smith (Fairfi eld-Liverpool); the Committee’s nomination of Messrs Commissioners determined to take no action. A Falk, M Rosen (Gordon); H McKay, R Timbs T Cruickshank and J Lalor to serve as (Hawkesbury); A Gummer, J Warn Appointed Members of the Committee. The Judiciary Committee found six persons (Manly-Warringah), I Finlay, A Frank guilty of breaching the Code and imposed (Mosman); D Graham, B White (North New And Retiring Members penalties ranging from a censure to 12.5 Sydney), C Hambleton, M Langford (Northern matches. District); G Monaghan, R Wright (Parramatta); New Delegate Members were Messrs P Goldsmith, P Hazard (Penrith); C Sullivan, M Richardson, M van Vugt, G Phillips, Cricket Australia P Wright (Randwick Petersham); G Phillips, N Govers, J Toyer, M Swan, C Munro, P Clift K Greene, (St George); E Atkins, T Iceton and N Theodorokopolous. They replaced Cricket Australia again demonstrated its direct (Sutherland); N Govers, P Rashleigh (Sydney); Messrs A Connolly, J Maxwell, S Green, commitment to club cricket by allocating D Bryant, J Toyer (Sydney University); J Penrose, G Mail, D Thompson, D Rose, $307,280 and $74,800 to Cricket NSW for D Bowcock, P Serov (University of NSW); S Fairlie and C McKenzie respectively. The the development of NSW Premier Cricket M Swan, R Wayde (Western Suburbs); SCA wishes to record its appreciation of the and Women’s Premier Cricket respectively. C Munro (Auburn); G Workman (Balmain efforts of all retiring Members and to welcome The Board distributed that grant among all South Sydney); T Murphy (Burwood Briars); all new Members. clubs, to facilitate projects such as ground G Baird (Epping); R Buchanan (Georges River); improvements and coaching programs. B Scott (Lane Cove); G Cook (Lindfi eld); Shires Competition Sub-Committee P Clift (Macquarie University); J Miller Functions The Committee of Management formally (Mount Pritchard-Southern Districts); P Dodd delegated specifi c duties to the above sub- The SCA conducted separate Premiers’ (North West Sydney); M Rasotra (Pennant committee, comprising persons elected by Dinners during April and May 2017 for the Hills); J Biviano (Roseville); D Chappelow Shires clubs, as follows: Messrs J Biviano Premier Cricket, Shires and Women’s Premier (Strathfi eld); A Caruso (Warringah); E Smith (Chairman), A Boorer, A Clarke, J Miller, Cricket competitions, with over 730 guests (City and Suburban Cricket Association); D Chappelow, M Wood and G Workman. attending. The three functions were a fi tting L Borg (NSW Cricket Umpires’ and Scorers’ The Committee thanks those persons for their way in which to end a very successful season Association); N Theodorokopolous, G Liggins, contribution to the successful conduct of the and to congratulate all premiership teams and E Myatt (NSW Districts Cricket Association); Shires competition. award winners. R Smith (NSW Women’s Premier Cricket).

Appointed Members, Women’s Competition Sub- Media Committee of Management Committee During the season, the SCA’s competitions T Cruickshank, J Lalor. enjoyed regular media coverage, in particular The Committee of Management formally from metropolitan newspapers, suburban delegated administration of Women’s Premier Life Members newspapers and the SCA’s social media Cricket to the above sub-committee, as J Aitken (2011), J Barrett (2007), M Bonnell channels. In addition, the NSW Premier follows: Mr S Hamman (Chair), Ms J Henry, (2016), R Browne (2005), P Burkhart (2007), Cricket competition website provided live Ms K Hinkley, Ms T Bates, Messrs R Smith, D Chappelow (2004), A (Tony) Clark (2009), ball-by-ball coverage of a range of preliminary K McKay, S Reibelt, G Healy and G Forliano. R Cook (2016), I Field (2014), D Givney (2004), rounds and fi nals series matches, including all The Committee thanks those persons for their K Hall (2002), G Hartshorne (2005), fi nals matches, together with live streaming of contribution to the successful conduct of the W Hayes (2009), J Henry (2015), T Jay (2002), the Kingsgrove Sports T20 Cup fi nals and First Women’s Premier Cricket. C Jefferies (2012), A Kershler (2011), Grade fi nal. G Lambert (2014), N Laming (2001), G Lill Code Of Conduct Commissioners Community Radio 2HHH-FM 100.1 provided (2016), G Mail (2017), C Matthews (2004), successful calls of the Kingsgrove Sports T20 J McGruther (2015), J Robson (2002), And Judiciary Committee Cup with live broadcasts of selected matches, J Rodgers (2004), A Watson (2002), The Board appointed Mr J McGruther as the including the fi nals from the Sydney Cricket B White (2012), M Wood (2008). SCA’s Code of Conduct Commissioner and Ground. Messrs G Abood, G Gorrie and G Salier as the The SCA again offered the Phil Tresidder Management (NSWCA Assistant Code of Conduct Commissioners. Award, in memory of the late sports journalist, Administration): The Judiciary Committee for the season Randwick CC member and NSWCA Life Member. Entries for Best Season Coverage NSW Premier Cricket Manager: R Formica comprised Messrs R Browne & T Buddin (Chairmen), G Bensley, R Chee Quee, R Collins, were of a high standard, emphasising the Secretary: B Whitehouse R Green, C Hynes, E Myatt and P Toohey. support that NSW Premier Cricket receives from suburban print media. The award-winner was Stew Moses of the Nepean News. Cricket NSW Annual Report and Yearbook 2017/18 16 dismissals). Jack Davis-Rice(Gordon,254runsat42.33). 55.20); RyleySmith(Penrith,265runsat37.86); Zeeshaan Ahmed(Bankstown,276runsat (Campbelltown-Camden, 286runsat47.67); Warringah, 302runs at43.14);Tanveer Sangha 327 runsat65.40);JakeOsborne(Manly- Wicket keeper: Batsmen (6): leading wicketkeeperselectedasfollows. top sixbatsmen,thefi vebowlersandthe from thepreliminaryroundsonly, withthe the SCAnamedaMeritXIIbasedonstatistics At thecompletionofAW GreenShieldFinal, AW GreenShieldMeritXII Umpires: Result: wickets. Central CoastdefeatedParramattaby6 competition. Ina50overs-a-sidematch, the Premiersofeachassociation’s U/16 respectively, intheannualmatchbetween to representtheSCAandNSWCCA Parramatta CCandCentralCoastCAqualifi ed Raby OvalNo1,11February2018 U/16 City–CountryChallenge appointments. Cricket Umpires’Associationtomakesimilar Association andtheSydneyWomen’s assisted theSydneyShiresCricketUmpires’ Cricket matches.TheNSWCUSAalso accredited umpirestooffi ciateinPremier (NSWCUSA), whichagainappointed Cricket Umpires’andScorers’Association Appreciation isofferedtotheNSW Umpires Poidevin (Riverina). R Johns25,BHardy3-21,LCork2-28). defeated ParramattaCC161(HKing65, J Liddle47,KDaley44*,AKaul2-16) 2017/18 A.W. GREENSHIELDCHAMPIONS –PARRAMATTA CRICKETCLUB Sydney CentralCoastCA4/163(BHardy59, KedarOza(SCA)andStephen Jack Attenborough(UNSW;

Ethan Debono (Bankstown, Ethan Debono(Bankstown, Cricket

Association selection. commemorative capinrecognitionoftheir All playerswerepresentedwitha Ties wereseparatedbysuperioraverage. 14 wicketsat14.50). 14 wicketsat12.79);HughSherriff(Sydney, 15 wicketsat12.20);Tom BellBird(UNSW, Venkatachalam Viswanathan (Hawkesbury, (Sydney University, 16wicketsat15.25); Petersham, 17wicketsat10.53);JazzRinka Transport forNSW-SCACommunity • KookaburraAustralia PtyLtd-offi cialcricket • KingsgroveSports-majorsponsorofthe • AsahiPremium Beverages-offi cialBeerand • McDonald’s -majorsponsorofSCA • success ofits2017/18season: of thefollowingpersonsandbodiesto record itsappreciationofthecontribution The SydneyCricketAssociationwishesto Appreciation and theBlacktownDistrictCricketAssociation. young cricketersforboththeBlacktownclub improving facilitiesandgivingopportunitiesto Peter Paynewasatirelesscampaignerfor both Coltsand2ndXIlevels. 2,086 runsat15.92.HerepresentedNSW at 20.14intotalfortheclub.Healsoscored wickets infi rstgradeduringthattime,and450 1963/64 until1979/80.Hetookover400 Parramatta (CentralCumberland)clubfrom Bill Lothianwasalong-termservantofthe the passingofBillLothianandPeterPayne. The SCAlosttwoofitsfi nestservantswith Obituary Bowlers (5): Sponsor. ball oftheSCA. Kingsgrove SportsT20Cup. Cider PartneroftheSCA. competitions. Alexander Deller (Randwick AlexanderDeller(Randwick • Ground staff and ground authorities of Groundstaffandgroundauthoritiesof • ManagersandcoachesofallAW Green • FirstGradescorers-fortheirvaluable • Tom Iceton-forproofreadingoftheSCA’s • MrAdamMorehouse,SCAStatistician. • MessrsColinClowes,BobBrennerand • TheSydneyWomen’s CricketUmpires’ • TheSydneyShiresCricketUmpires’ • TheNSWCricketUmpires’andScorers’ • AustralianAssociatedPress(AAP)-forits • AustralianCricketers’Association, • CricketAustralia-foritsPremier, Shiresand • fi nalsandrepresentativematches. particularly thosethathostedcompetition the SydneyCricketGroundandallclubs, Shield competitionteams. scorecards. contribution inprovidingtimelyonlinematch competition handbook. milestones andstatistics. the provisionandmaintenanceofrecords, Jefferies (HonoraryLibrarians,NSWCA)-for Association andalloffi ciating umpires. its Committeeandallofficiating umpires. (President) andStephenBlomfi eld (Secretary), Association, especiallyDavidGoodman Board andalloffi ciating umpiresandscorers. (Umpire Educator, FemaleEngagement),its (Administration Offi cer) andClairePolosak (Administration Manager),NicBills & DevelopmentManager),Troy Penman Goodger (ExecutiveOffi cer andEducation Association, especiallyMessrsDarren promotion oftheSCA’s competitions. mentoring roles. to beengagedinplaying,coachingor current andformerfi rst-classcricketers funding toPremierclubsfornon-contracted Program, aprogramwhichprovides initiative increatingthePremierCricket & GameDevelopmentManager)-forits especially BrendanDrew(Membership Women’s PremierClubFundingProgram. Game Development

GAME DEVELOPMENT STAFF 2017/18

The Cricket NSW Game Development team Participation Results entered the 2017/18 season tasked with Participation had an increase of 4.96% in the 2017/18 season to 414,265 participants. implementing the biggest opportunity for

junior cricket in generations, rolling out the 450,000 414,265 Australian Cricket Recommended Junior 400,000 Formats. 393,082 394,075 With our primary aim to “increase 350,000 354,243 315,760 participation substantially and inspire the 300,000 next generation of players and fans,” it was a 269,000 challenge the team relished and attacked with 250,000 225,153 positivity and vigour. 200,000 170,206 170,492 174,772 230,451 Work also continued on the Australian 192,433 150,000 182,142 Cricket Service Model Uplift, ensuring 2005/ 2006/ 2007/ 2008/ 2009/ 2010/ 2011/ 2012/ 2013/ 2014/ 2015/ 2016/ 2017/ Game Development across Australia was 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 satisfactorily staffed and equipped to FIGURE 1: PARTICIPATION RATES FROM 2005/06 TO 2017/18 service and grow grassroots cricket, and that inequities within Australian Cricket Game This season is the fi rst year Cricket Australia growth of cricket long term. BBL-aligned Development staffi ng were addressed and have automated the Australian Cricket programs remain popular and the introduction rectifi ed. The work clearly identifi ed NSW Participation Census based on MyCricket of the ‘Mascots Challenge’ (a BBL mascot was desperately under resourced and the fi rst and TheCROWD reporting and data. This is a branded skills program for K-2) has been well injection of funding was received during the welcomed progression for Game Development; received within the school sector, allowing season, allowing small growth in fi eld staff however it created a need to re-evaluate and children to learn small ball skills through to service the cricket communities. Positions standardise the manner in which all categories this teacher delivered program. With States in Hunter, Liverpool and Bankstown were are assessed, counted and recorded across all once again assuming control of the Sporting created and added during the year. States and Territories throughout Australia. Schools program from Cricket Australia, a Focus on growing girls cricket and school NSW has been a strong advocate for the rebound occurred and larger numbers of sampling continued, as did work within the change and has had a number of staff heavily schools selected cricket as their sport of multicultural, indigenous and all abilities involved in its establishment. choice within the government program. communities with great results, all which Overall, school participation and sampling Much of the growth from schools has been led to a record year for NSW/ACT of continues to grow and expose more children driven by our increased focus on the School 414,265 participants. to the game. This remains a vital cog in the Ambassador program, educating and leading Cricket NSW Annual Report and Yearbook 2017/18 cricket communities. us toincreaseour service andsupportthe potential byinvestinginNSW/ACT, allowing quickly toensureAustralianCricket hits its Cricket Australianeedtoactdecisively and are important,butheadcountiskey and This againrefl ectssystemsandprocesses as theyarepartoftherequiredGDuplift. Currently NSW/ACThave0SchoolsOffi cers, Offi cerseducatinganddriving thissector. driven bytheeffortsof16newSchools Schools participationby50,000participants, behind Victoria. CricketVictoria increasedits relegated tosecondhighestparticipationState outcome byCricketNSW, wehavebeen Despite arecord-breakingparticipation having competitionsheldduringtheseason. Harbour, Penrith,CanberraandCastle Hillall with Newcastle,CentralCoast,Illawarra,Coffs competitions grewthisyeartoover50teams, Sixers andThunderSocialWomen’s Cricket cricket inamorecasualenvironment.Our cricket offeringsforapublickeentoplay an equallydeterminedfocustodrivesocial and associationstoimproveparticipation, remains adeterminedfocustoworkwithclubs into trueclubrecruitmentandretention,there As weestablishbettertransparencyandvision side, butwerecalculatedat15. and manyagegroupsmayhaveonlyhad8a associations playedamodifi edformofcricket at 15(11+4reserves).Previously, many irrespective offormats,werecalculated 3 reserves)whereaspreviously, theseteams, teams werecalculatedat10perteam(ie7+ Formats Stage1,thenumberofparticipating participation outcome.Forexample,inJunior been implementedtobestrepresentatruer way participationnumbersarecountedhas advent ofJuniorFormats,acorrectioninthe however itshouldbenotedthatwiththe Club cricketappearstohavecontracted; professionally equippedtodelivercricket. the standardcurriculumasteachersbecome once againdeliveredwithinschoolsaspartof Cricket NSW’s abilitytoensurecricketis Professional Development.Thiswillaccelerate undertake andhaveitcounttowardstheir course isnowfreeforallNSWteachersto Development ‘Training toDeliverCricket’ Development. Athree-hourProfessional as aproviderforTeacher Professional Standards Authority(NESA)forendorsement Cricket NSW’s applicationtoNSWEducation Manager) wassuccessfulinsubmitting During theyear, CorrinaBaldock(Participation school engagement. moving forwardaswedriveforevengreater This willformalargepartofourstrategy not relyonpermanentorcasualCNSWstaff. teachers todrivecricketwithinschoolsand as theseasonprogressed andawarenessof to Associationsnot involvedinthepilot,but promote theConferenceAdministration Pilot Game Developmentstaffdidnotactively (Manager Association&ClubDevelopment). competitions, reportingtoBrettHolliday managing theirrespectivejuniorassociation three womencommencedworkingwith and our fi rstthreeConference Administrators.All JCA) andSharynBeck(Newcastleas (St GeorgeJCA),JanetGrieve(ClarenceRiver Cricket NSWhasemployedCynthiaDavies operations. competition managementandbestpractice administrational servicestoAssociationsin with professionalstaffengagedtoprovide Conference AdministrationPilotwassetup, how cricketisadministeredwithinNSW. A alleviate theirburdenbyprofessionalising on apilotprogramtoassistvolunteersand During theseason,CricketNSWembarked Conference AdministrationPilot involved. it isimprovingtheskillsetofallplayers the enjoymentamongstyoungercricketers, but overalltheadoptionisnotonlyincreasing platforms andappsforcoachesparents, coaching andskillvideosavailableonvarious pitches used.Work iscontinuingtorefi ne comments regardingtheconditionofturf successful. Localcuratorsofferedpositive NSW, QLDandSAwereconsideredhighly Stage 2wereconductedduringJanuaryin Trials oftheRepresentativeJuniorFormats too fastforthescorers! their frustration.Basically, thegameismoving cricket scoringandafastgamecontributingto to overcome,withvolunteersunfamiliar beyond. Scoringremainsthebiggestchallenge 2 withintheirAssociationsfor2018/19and a continuedrolloutofJuniorFormatsStage positive andmanycommencedplanningfor coaches andparentswereoverwhelmingly Surveys conductedwithadministrators, who adoptedJuniorFormatsduring2017/18. half ofthetotalnumberJuniorAssociations the adoptionofJuniorFormats,providing 2017/18. NSW/ACTclearlyledthenationwith and runningaJuniorFormatscompetitionin of NSW/ACTJuniorAssociationsadopting a welcomedandroaringsuccess,with85% The implementationacrossNSWandACTwas 2016/17 season. Formats afterasuccessfulpilotthroughoutthe the recommendedAustralianCricketJunior embraced, vigorouslyendorsedandpromoted for juniorcricketingenerations,NSW In thegreatestandmostpositivechange Australian CricketJuniorFormats of thepilotexpands. few seasonsasawarenessandunderstanding growing prioritiesforCricketNSWinthenext Administration willbeoneofthefastest continues tofall.IbelieveConference Association Committeemembervolunteerism give theirvaluabletimetoClubs,but volunteers arekeenandcommittedto It hasbecomeevidentthatamajorityof 2018/19 season. the ConferenceAdministrationPilotfor signed aServiceLevelAgreementtojoin Associations expressedadesiretojoinor with MetroSydneyandover12JuniorCountry season’s end,13of16JuniorAssociations interested andkeentobeinvolvedgrew. By the pilotgrew, thenumberofAssociations General Manager –GameDevelopment Ivan Spyrdz cricket community. supporting andservicingthewonderful NSW for theireffortsandcontributioninleading, member oftheGameDevelopmentteam I wouldliketocommendeachandevery very brightcricketfutureinNSW. and CricketBlast,willlaythefoundationofa Junior Formats,ConferenceAdministration Much ofwhatwasimplemented,suchas most successfulseasonsinrecenthistory. Development staff,ithasprovenoneofthe and passionoftheCricketNSWGame season andduetothetalent,commitment number ofmassivechallengesduringthe Overall, GameDevelopmentundertooka in theimmediateseasonsahead. provide aboosttojuniornumberswithinNSW change forallpartiesandwebelievewill Junior Pathways.Thisisamajorpositive the majorpartnerforCricketBlastand Woolworths has joinedAustralianCricketas from 1July2018.Itwasalsoannouncedthat Program offeringacrossAustralianCricket ‘Cricket Blast’wouldbethenewEntryLevel This hasresultedintheannouncementthat was undertaken. allow betterreturnstoAssociationsandClubs with afullfi nancialreviewoftheprogramsto review oftheparticipantofferings,coupled of ‘CricketBlast’wouldbeundertaken.Afull MILO T20Blastprogramstoanewsinglebrand rebranding ofthecurrentMILOIN2Cricketand As aresultofthereview, itwasdetermineda participation foryoungerchildren. ultimately increasepre-competitioncricket uptake, continuedalignmenttotheW/BBLand undertaken toincreaseAssociationandClub Australian CricketEntryLevelprogramswas Over thepasttwoyears,areviewof Cricket Blast Plan B Regional Bash

PLAN B REGIONAL BASH CHAMPIONS THE NEWCASTLE BLASTERS

Newcastle broadened its domination of NSW The NSW Indigenous and NSW Country Sixers Conference Final Country Cricket in 2017/18 by defeating skipper followed his half-century against the Orana Outlaws to claim its fi rst Plan B Northern Rivers with 49 from just 28 balls. Newcastle Blasters 7/183 (NA Price 58, Regional Bash T20 title. Price hit eight fours and one six during his J Durrheim 43, DJ Hunter 24, JJ Julius 3-35, C Ziebell 2-24) defeated Northern Rivers Rock The Blasters defeated the reigning champions dynamic knock at the top of the order. Dylan 9/118 (A Crawford 21, A Callan 20, M Willett by 16 runs in the fi nal at the SCG on 10 Hunter also smashed 54 from 31 balls. 2-9, JL Price 2-18, T Allen 1-22). December. Price was also named player of the Player of the Match: Nathan Price It was the second prestigious regional title for tournament after some excellent performances (Newcastle Blasters) Newcastle during the season after claiming with bat in hand. He was the leading run- the McDonald’s NSW Country Championships scorer with 158 runs at 39.5. limited-overs crown for a 15th time. Despite a 51-run opening partnership between Thunder Conference Final It was the fi rst time a team from the Sixers Dubbo teenager Brock Larance (33) and Wes Orana Outlaws 9/127 (GI Buckley 27, conference, that covers the northern half of Giddings (16), wickets lost at regular intervals W Lindsay 22, S Perry 3-15, M Harper 3-20) NSW, has won the competition in its three meant the Orana chase never gained traction. defeated the Wagga Wagga Sloggers 8/124 year history. (M Berkrey 27, MJ Mitchell 22, MR Jeffrey The previous two titles were both claimed by Sixers Conference 3-26, B Strachan 2-21). Thunder Conference teams – the Outlaws and Central Coast Rush, Coffs Coast Chargers, Player of the Match: Ben Strachan Albury Border Bullets. Hunter Hitmen, Illawarra Flames, Macquarie (Orana Outlaws) The Blasters comprehensively overcame Coast Stingers, Newcastle Blasters, Northern Northern Rivers Rock in the Sixers Conference Inland Bolters and Northern Rivers Rock. Plan B Regional Bash Final Final to make it through to the title play-off. Newcastle Blasters 169 (DJ Hunter 54, NA The Outlaws survived a low-scoring thriller Thunder Conference Price 49, W Lindsay 3-13, M Bower 3-16) against the Wagga Wagga Sloggers. ACT Aces, Border Bullets, Central West defeated Orana Outlaws 153 (B Larance 33, After an impressive display in the Sixers Wranglers, Murrumbidgee Rangers, Orana GI Buckley 22, JL Price 2-18, DJ Hunter 2-21, Conference Final, Blasters captain Nathan Outlaws, South Coast Crew, Southern Riverina R Cooper 2-24). Price led from the front again in the decider. Vipers and Wagga Wagga Sloggers. Player of the Match: Dylan Hunter (Newcastle Blasters) Cricket NSW Annual Report and Yearbook 2017/18 Commercial COMMERCIAL STAFF 2017/18:JIMROBSON,ANDREWKELLY, STEPHANIECLARKE&TRAVIS GLEN Partner. Amart Furnitureonboard astheirOffi cial In addition,theSydney Thunderwelcomed provided totheSydneyThunderuntil 2020. season andtheircommitmenthasbeen respective partnershipsforthe2017/18 continued toprovidesupportviatheir Partner MazdaandMajorHomeWorld Sydney ThunderBBLandWBBLPrincipal Nature’s GiftbecameMajorPartner. Priceline remainedasPrincipalPartnerand For thevictoriousSydneySixersWBBLside, until theconclusionof2019/20BBLseason. further twoseasonstakingthepartnershipup however thathassincebeenextendedfora Toyo Tires initiallysignedaone-yeardeal; Tires astheSydneySixersBBLMajorPartner. We werealsoveryexcitedtoannounceToyo 2019/20 BBLseason. as iiNetandwillcontinueuntiltheendof Sydney SixersBBLPrincipalPartnerremained $700,000 from2016/17. season, whichwasanincreaseofmorethan in BBLsponsorshiprevenuegeneratedthis corporate supportwithjustshyof$3.7million The BigBashLeagueagaingainedstrong Maximise revenuefromBBLassets Key Priorities sponsorship budget. revenue neededtobesecuredachievethe a signifi cantproportionofcommercial up forrenewalaheadofthe2017/18season, WBBL principalandmajorpartnerproperties With almostallofCricketNSW’s BBLand fans, participantsandsponsors. by understandingandmeetingtheneedsof and CricketNSW’s othercommercialsources sponsorship, hospitality, BBLlocalrevenues in NSWcricketbymaximisingtotalvaluefrom department istosignifi cantlygrowinvestment department. ThefocusoftheCommercial strong yearfortheCricketNSWCommercial The 2017/18seasonprovedtobeanother community daysacross allteamsandareas Water wasactivewithusatmatch and Sixers andSydney ThunderteamsandSydney the NSWBlues,LendleaseBreakers, Sydney drinks. Ouruniquepartnershipspans across rather thanbottledwaterorother fi nancialandmore–ofdrinkingtapwater the manybenefi ts–environmental,health, campaign toeducateSydneysidersabout Sydney Water continuedtheirsuccessful cricket equipmentforfamiliesandclubs. secondly, tohelpalleviatesomeofthecost international standardsforhelmets,and in thesportandupcomingadoptionof to fi rstly, highlighttheimportanceofsafety throughout NSW. Thisactivitywasdesigned Legacy Juniorhelmetstojuniorcricketclubs Masuri, CricketNSWdonated1,500Masuri McDonald’s andOffi cial HelmetPartner Community Partner. Working closelywith McDonald’s continuedasourMajor HaveaPlanBifyou’redrinkingtogetyou • Getyourhandoffmobilephonewhen • Stop,revive,survive • Wear aseatbelt • Sticktothespeedlimit • messages remainforeveryone: behind thewheeltoreducetoll.Thekey challenge remainstochangedriverbehaviour Despite thesuccessofourpartnership, of thepartnership. drink drivingcampaignagainthefoundation entered the16thyear, withthePlanBanti- contributor viaourpartnershipwhichhasnow Transport forNSWcontinuestobeakey when combinedwithBBLrevenue. the overallcommercialportfolioof$5.7million contributing toa14%year-on-year increasein sponsorship revenueduring2017/18, Cricket NSWearned$1.4millionin assets Maximise revenuefromCricketNSW home safely driving and General Manager–Commercial Travis Glen TheRoyalAgriculturalSociety • PenrithCityCouncil • AlburyCityCouncil • Wagga Wagga CityCouncil • Wollongong CityCouncil • CoffsHarbourCityCouncil • • SCG Trust CityofCanadaBayCouncil • GeorgesRiverCouncil • BankstownCricketClub • NorthSydneyCouncil • BlacktownCityCouncil • Cricket NSWthisseason: and councilstakeholdersthatpartneredwith I wouldalsoliketoacknowledgeourvenue roots andelitecricketers. cricket programsacrosstheStateforourgrass to assistCricketNSWdeliverthebest partners andsuppliers.Your supportcontinues Thank youtoallofourothercommercial Association. Sydney ThunderandtheCricket Partnership withCricketNSW, SydneySixers, Cricketers ArmscontinuedtheirOffi cialBeer NSW AcademyandCricketstaff. the NSWBlues,LendleaseBreakers,Cricket Partner ofCricketNSW, providinguniformsto ISC Teamwear becametheOffi cialApparel the 2018/19cricketseason. be continuingtheirpartnershipagainduring of SydneyandWollongong. SydneyWater will Match Operations and Experience Team

MATCH OPERATIONS AND EXPERIENCE TEAM STAFF (L TO R) MICHAEL DALTON, EMMA MACMILLAN, JENNY SYMONS, ROHANNA BURROW, KIRIN LINDOP, SATYEN ASHAR, ABSENT, CLARE CREWDSON

Leading into the 2017/18 season, the Cricket The team delivered across a diverse • Kingsgrove Sports T20 Cup Final Operations and Events Teams were merged to range of functional areas including match • Regional Bash Final become the Match Operations and Experience management, event presentation, event • SCA Premier Men’s and Women’s Cricket Team (MOET). Kirin Lindop was hired in management, cricket operations, scheduling, Dinners August 2017 to lead the new team, having venue readiness, ground selection, process previously worked with the Cronulla Sharks in and policy implementation, team logistics, • Season Launch a match operations leadership role. She was stakeholder management and management of • Test Match, ODI & T20 International also joined by Rohanna Burrow and former all associated training sessions. Chairman’s Lunches employee Satyen Ashar. Hosting the iconic Ashes series for both Men • 16th Annual Cricket NSW Awards evening The priorities for the Match Operations and and Women and the growing BBL and WBBL In total, the team staged 112 matches, Experience Team for the 2017/18 season were: competitions while also facilitating the elite including trial and tour fi xtures across 18 • To deliver world leading Cricket Match and pathway teams’ training requirements, different grounds, while supporting Cricket Operations and Event Presentation match operations were in full swing with the Australia with all International content in cricket season starting in August and ending • To deliver an outstanding season of cricket New South Wales. The MOET also hosted in early April. and corporate events with a newly formed 12 CNSW events in and around Sydney and team The department also hosted several Cricket would like to thank all our major venues, NSW events throughout the summer including: councils and each Grade and Shires Club that • To take the corporate event products to a assisted in a hosting capacity this season: new level • Basil Sellers Scholarship Program • Albury City Council • To provide excellent service to CNSW, • CNSW Christmas Party BBL Clubs, CA and other stakeholders as • Doug Walters Club Membership and Test • Blacktown Venue Management and required Match Lunch Blacktown City Council • NSW Governor’s XI v Cricket ADF • Campbelltown City Council Cricket NSW Annual Report and Yearbook 2017/18 Match CHAIRMAN’S LUNCH Wollongong CityCouncil • Wagga Wagga CityCouncil • • Sydney University SydneyCricketClubandCityofCanada • SydneyCricketandSportsGroundTrust • • Scots College SydneyChurchofEnglandGrammar • RoyalAgriculturalSociety • PenrithCityCouncil • NorthSydneyCouncil • L’Aqua –DocksideGroup • InnerWest Council • HyattRegency, Sydney • GeorgesRiverCouncil • CricketACT(ManukaOval) • CoffsHarbourCityCouncil • CityofCanterburyBankstownand • Bay Council School (Shore) (SpotlessStadium) Bankstown CricketClub

Operations

and

Experience Cricket NSWemployeesacrossthebusiness. without thesupportandvaluedinputof The MOETwouldnothavebeensosuccessful Women’s AshesSeries • • WNCL • T20 International • Tour Matches Sheffi eldShield • OneDayInternational • JLT OneDayCup • • Futures League BBL&WBBL-SydneySixers • AshesTest Match • number ofdifferentcompetitionsincluding: to anextremelysuccessfulseasonacrossa Symons allplayedmajorrolesandcontributed Clare Crewdson,EmmaMacMillanandJenny McKenna, SatyenAshar, RohannaBurrow, The teamwaswellledbyKirinLindop.Daniel event wasconductedtoaveryhighstandard. departments toensurethateachmatchand The teamworkedcloselywithinternal and SydneyThunder

Team

• • operations projectswereundertaken: and venueoperations,thefollowing In additiontothedeliveryofmatch,training a matchbybasis. and MattWilliamsalsoplayedkeyroleson Gary Koschel,NeilMerrick,DougWilliams David Gardiner, JohnHayes,DennisJohnson, Room AttendantsJohnDunn,BrettEvans, best forhisPolicecareerahead. greatly missed.CNSWwishesDMacallthe throughout theremainderofseasonand CNSW andSydneySixers.DMacwasmissed enormous contributiontoCricketAustralia, Operations staffmemberwhomadean McKenna (DMac),aninvaluableCricket In mid-December, CNSWfarewelledDaniel 2018/19 season. in capacitythatwillbeavailableforthe an additional9pitches,a50%increase training netstoturf– Reconstruction ofBISPsynthetic fi eldallocationandcapacity usage – Blacktown InternationalSportsPark Reviewofusage,turfnetand thisdelivered Communications

The ratings were remarkable, with the Sydney Thunder v Melbourne Renegades match averaging 278,500 viewers with a peak audience of 426,000. The Sydney Sixers v Melbourne Stars match had an average audience of 422,500 with a peak of 629,000, the biggest WBBL broadcast ratings ever, and #WBBL03 trended at #1 on Twitter nationally.

The digital age For the fi rst time, total worldwide digital expenditure passed total worldwide television expenditure and the gap is ever increasing. The theme for state and national communications departments during the development of Cricket Australia’s new fi ve- year strategy was to tell our story better and more often. The ideal way to do this is with digital and social media, delivering our unfettered message to an ever-growing digital audience. Thanks to the arrival of Cricket NSW Digital and Social Media Coordinator Tom Frederico, we have seen a 65% growth in Facebook CRICKET NSW COMMUNICATIONS TEAM: DAVID GAVIN, MALCOLM CONN AND TOM FREDERICO video views, while on twitter and instagram During a year of challenges, the strength of NSW coverage as a percentage compared to we have seen our followers increase by more cricket and its central place in Australian other states continued to trend up to a high than 10% across all accounts. society prevailed. of 34.37. Tom was well supported by Communications The depth of community feeling following Assistant David Gavin when he took on an the ball tampering scandal in South Africa Women’s Ashes expanded role later in the season. highlights how much people care about With the central focus of the new Cricket Australia’s truly national sport. Australia and, by extension, Cricket NSW Streaming Cricket is littered with scandals and setbacks strategy on women and girls cricket, the While streaming has become a part of from its very beginning as the Australian game Women’s Ashes could not have been a today’s consciousness thanks to multinational decades before Federation, with Bodyline the better launching pad for the season. conglomerates such as Netfl ix, it is also most famous and the There was enormous interest, with more an increasingly cost-effective way for most disruptive for Australia. than four million views on the live stream organisations, particularly sporting bodies, The sport has not only survived but thrived. after Channel Nine chose not to televise it. to showcase their premium products. On the back of the remarkable explosion of the That is more than almost all men’s Cricket NSW continued to invest heavily in Big Bash and Women’s Big Bash, cricket has Tests manage to attract. streaming home Sheffi eld Shield matches never been played by more people in Australia, The media coverage was outstanding, with and, for the fi rst time in the competition’s with an exponential increase in the number of front page of the Sydney Morning Herald history, Cricket NSW also streamed Breakers’ women and girls taking the fi eld. and back page of the Daily Telegraph leading Women’s National Cricket League matches. Nor has cricket ever been watched by more into the match, then a great follow-up of There was a 31 percent increase on last people either as spectators at the ground or Ellyse Perry’s double century. season’s NSW Sheffi eld Shield viewing viewers on television. With admission being charged for the fi rst numbers to more than 50,000 a match. All this combined with an Ashes series and time at a stand-alone women’s game, the While the numbers were modest across the expanded BBL to prompt a signifi cant rebound crowd at North Sydney Oval across the fi ve two Breakers matches played in Sydney, 14,000 in Cricket’s Share of Voice. days of the Test and T20 was more than views was encouraging as a starting point. The trend was up October to January on 17,000. Thanks previous years at 28.67 per cent compared to The historic and intimate North Sydney Jeanne Fourie left Cricket NSW after almost other sports before the South African saga, Oval again proved itself ideal for staging two years as PR and Media Manager. Jeanne with an overall October to March fi gure of women’s cricket. worked closely with the Breakers and was 30.57. This all but matched the previous high This was reinforced by the opening of the a great support to Cricket Australia during from 2014/15 of 30.6 in a World Cup summer. Women’s Big Bash League, which attracted International matches. Following the World Cup, Share of Voice fell almost 9,000 fans over the two days. Malcolm Conn more than seven percent the next season to Senior Manager - External 23.56. Last season it rose to 25.07. Communications, NSW Cricket NSW Annual Report and Yearbook 2017/18 administration options. time canvassingshort termtrainingand term facilitiesneeds,whilstatthesame and SCGTrust onasuitableplanforourlong We areworkingwiththeStateGovernment centre annually. impact onthe35,000communityusers ofthe kind inAustralia,willhavealargefl ow-on centre, openedin1997andthelargestofits amplifi ed.Thedemolition oftheindoorcricket needs. Thischronicshortagehasnowbeen of trainingfacilitiesforourhighperformance been experiencinggrowthpainsandalack distressing news,atatimewhenwehave This wasextremelydisappointing,and of anewAllianzstadium. This isduetothedemolitionandconstruction will bedemolished,nolaterthanAugust2019. existing administrationandtrainingfacilities we wereadvisedbytheSCGTrust thatour signifi canceinearlyFebruary2018when options forCricketNSW, tookonfargreater Project Castle,exploringthelongerterm staff inalargerteam. while providingmoredefi nedcareerpathsfor protection andinvestmentintechnologytools, better toolsforusers,enhancedsecurity for theprovisionofastandardplatformand has beenaresoundingsuccess.Itallowed The nationalisationoftheTechnology team Cricket Australia. the teameventhoughtheyareemployedby technology teamin2016,remainaspartof which transitionedtheirrolesintoanational Relations &StateInfrastructure.TheITteam, Facilities andAdministration,Government BAS comprises–People&Culture,Finance, the needsofagrowingorganisation. the structureandroleshaveevolvedtomeet support isprovidedtoallstaff.Overthattime, the organisationandtoensureprofessional in 2013,followingthecontinuedgrowthof The businessadvisoryteamwasformed Business BUSINESS ADVISORY SERVICESSTAFF 2017/18

Advisory Key highlightsincluded: and excellenceinmakingarealdifference. for theirwonderfulcontribution,commitment 2017/18. IwouldliketothankalltheBASstaff The teamhasprovidedmanyhighlightsin the organisation’s strategyacrossallpillars. exists toservetheorganisationandfacilitate making toachievestrategicoutcomes.BAS driving continuousimprovementanddecision service andsupportfunctioninAustraliaby The visionoftheBASteamistobebest announce thoseplansinthenearfuture. We hopetobeinapositionfi naliseand and Ethics. Engagement, Enjoyment,Energy, Excellence on theorganisationalvaluesof5Es – accountability andhighperformance based effectiveness andembeddingaculture of to furtherbuildcapability, driveleadership Culture function.Thisyear, ourfocushasbeen foundational aspectsofthePeopleand We continuetoconsolidateandrefi ne the Culture ManagerfortheWorld T20. Australian CrickettotheroleofPeopleand hiring keytalent.Allywaspromotedwithin people initiativesacrossthebusinessand Advisor, whowasinstrumentalindriving key departure ofAllyDirkis,PeopleandCulture Development projects.We sadlysawthe part-time capacityonkeyOrganisational Wende continuingtoassisttheteamina and CultureAdvisor, totheteam,withVanessa Markovic, welcomedCaitlinMurphy, People The team,ledbyGeneralManagerMarina skills andexperience. team ofprofessionalswiththebestavailable by buildingandretainingahighlymotivated deliver theCricketNSWstrategy. We dothis create ahighperformingworkforcethatcan The PeopleandCultureteam’s purposeisto People &Culture

Services and culture. on enhancingemployeeengagement, values development, strategyandsessions focussed provided employeeswithamixofpersonal delivery oftheAllStaffConference, which The yearwasroundedoutwiththesuccessful and undertakecareerplanning. roles, assessperformance,identifypotential project whichwillunderpinhowwedefi ne Culture teamledanationalCareerFramework and accountability. TheCNSWPeopleand to supportemployeegrowthanddriveresults regular ongoingperformanceconversations management continued,withanemphasison talent retentionstrategiesandperformance planning, talentreviewsandassessment,key want toseeinourorganisation.Succession workshop todefi nethe ideal behaviourswe the year, allstaffparticipatedina values With cultureandvaluesakeyfocusfor leadership survey. team asmeasuredthroughtheannual in employees’perceptionoftheleadership we haveseenasignifi cantimprovement our leadershipbehavioursandpleasingly together torolemodelandfurtherimprove This year, theleadershipteamworked throughout theyear. open roleswithinternalCNSWemployees was evidencedintheabilitytofi ll29%of learning andcareerdevelopmentopportunities potential women.Thesuccessinproviding to commenceaprogramforselecthigh Sports Commissionandwehavebeenable Leaders inSportGrantthroughtheAustralian were alsosuccessfulinobtainingaWomen and learncalendarforallemployees.We and coaching,aswellanongoinglunch potential programincluding360assessment development program,atargetedhigh development withtheongoingleadership continued focusonemployeelearningand This hadbeenachievedinpartthrougha Business Advisory Services

Led by Cricket Australia, a complete overhaul of the Cricket NSW intranet page was completed in November 2017. The roll- out of our new intranet has signifi cantly improved the way our staff access up to date, useful information on a day-to-day basis, and provides many channels to assist with collaboration across all states and territories. In September 2017, the roll-out of Internet Protocol Television (IPTV) was completed across the Moore Park offi ce, to televise all live streamed, web-based cricket content. Whilst televising all web-based content, the IPTV system also provides live news feeds and important information for staff (centrally managed and continuously updated by the Facilities & Admin team). The 2017/18 Chairman’s Room Ashes Series 16TH ANNUAL CRICKET NSW AWARDS and International events were a great success, with thanks to many signifi cant improvements Information Technology Facilities and Asset Management across our events management and technology systems. Each event attracted many high The Australian Cricket Technology team The focus for the Facilities & Administration profi le delegates, life members, government members based in NSW have contributed team this year was to continue to maintain, offi cials and sponsors, as well as international to another year of the technology uplift and improve and streamline the administration male and female past players and junior modernisation program. The project workload facilities across all Cricket NSW offi ces format volunteers. was ambitious, with 65 projects planned, (regional and metropolitan). with an average duration of 3.1 months. Following the restructure of the role of Finance The projects included: Receptionist in July 2017, a number of • Intranet Project: A single national intranet administration functions across CNSW have The Finance team continued to provide for sharing and collaboration. been automated. valuable support to the business, Chief Executive and me. • Data Storage Project: Implementation of We introduced the automated visitor cloud-replicated host and fi le storage at all management check-in system (SINE) at The team has been involved in some key major offi ce locations. our front desk, whilst all inbound phone calls projects with CA – including the “GR20 project”, which aims to fi nd savings across • Information Security Governance: Adoption have now switched to a fully automated Australian Cricket to reinvest into grassroots. of an information security management telephone line, removing the requirement Other projects include Finance, Activity & system for policy and process governance. for a switchboard operator. Funding, which is reviewing the basis of how The SCG Indoor Cricket Centre underwent • National Telephony Project: much funding fl ows to each State & Territory. Implementation of Skype for Business a signifi cant upgrade in August 2017. The The Finance team has also implemented a number across all locations, removing all on- upgrade included the resurfacing of the 11 of process improvements, which have contributed premise phone systems. synthetic training pitches, with new soft netting and safety valencia throughout to the best debtors results we have seen in many • Directory Consolidation Project: the centre. The project also included a full years. Other savings and effi ciencies were also Decommissioning of all State Active restoration of the steel framing, windows and highlighted via analysis and the team’s general Directories, consolidation into a single ceiling fabric, as well as improved drainage mindset of “question everything”. directory and identity management system. to address the ongoing fl ooding and safety A robust budget and four-year fi nancial • Print Project: Rollout of a new Fuji Xerox issues. In addition, water fi ltration points were plan was refreshed, which has highlighted printer fl eet, including consolidated print installed by Sydney Water in both the Indoor the signifi cant additional investment in the management and reporting. Centre and outdoor training wickets. Game Development and Cricket Performance • Mobile Device Management Project: In conjunction with the Indoor Centre departments in particular. Migration of all business-owned devices upgrade, the SCG players gym also underwent Our four-year Funding Agreement with CA to a Microsoft InTune managed platform. a signifi cant fl ooring upgrade, with the expired on 30 June 2017. Given uncertainty As part of the long term strategy, the installation of new gym tiling, sled track, new about outstanding media rights, our agreement technology team was restructured late in the gym equipment and a fresh coat of paint. was rolled over for 2017/18 and again for fi nancial year to better align teams with the The Blacktown International Sports Centre 2018/19, both years + CPI. It is expected a national strategy. The focus continues to be on also underwent a number of improvements in longer-term deal will be struck with CA and business operations service support and the August 2017, with a full upgrade of the kitchen the States for 2019/20 and beyond, given enhancement of fan and participant solutions. amenities inside the centre and updated media rights certainty and the fact that we signage and player imagery throughout. The are close to fi nalisation of priorities across installation of our ambulant bathroom and Australian Cricket. shower facilities are to be completed by Michael Dalton October 2018. Chief Financial Offi cer & Company Secretary Cricket NSW Annual Report and Yearbook 2017/18 Government our long-termfacilities needsandengage work withgovernment, aswelooktosecure 2018/19 willbeabigyearforCNSW andour and consideration. programs toparliamentariansfortheir support programs andproposedcricketfacilities and have highlightednumerousgovernment grant Additionally, lobbyingefforts bycricketstaff partnership inthisimportantarea. Government andlooksforwardtocontinued the supportofPremierandNSW to northernNSW. CricketNSWacknowledges Sixers’ regionfromsouthernSydneythrough at girlsaged12-14,acrossSchoolsinthe will enabletheSixerstohostsessions,aimed of NSW, theHon GladysBerejiklian.Funding support fromtheirWBBLpatron,thePremier program wasfortunatetoreceivefi nancial #BETHEBESTME femaleempowerment In February2018,TheSydneySixer’s women’s T20doubleheaderinDecember. another successful‘BorderBash’men’s and councils. AlburyandWodonga councilshosted summer, aswellrepresentativesoflocal the Oppositionallattendedmatchesover Premier, SportsMinisterandtheLeaderof and MrsHurley, alongwiththeDeputy W/BBL season.HisExcellencytheGovernor across internationalcricketmatchesandthe host parliamentaryandpoliticalstakeholders A busy2017/18seasonalsosawcricket staff andplayersfromourW/BBLfranchises. attended byanumberofMPsandmembers, Indoor CricketCentreattheSCGandwaswell 2017/18 SeasonLauncheventwasheldinthe The ParliamentaryFriendsofCricketgroup pathways. the Thunder, aswellourstateteamsand western ‘hubs’tocaterforboththeSixersand redevelopment, acrossbotheasternand from theSCGprecinct,andpost-stadium both short-termwiththedisplacement replacement facilitieswillbeprovided, with theNSWGovernmenttoensuresuitable premises byAugust2019.Work iscontinuing Stadium. Cricketwouldneedtovacatethe the redevelopmentofSydneyFootball facilities wouldbedemolishedaspartof the currenttrainingandadministration from theSydneyCricketGroundTrust that This escalatedinFebruary2018withadvice Sydney OlympicPark. in anewwesternfacility, likelytobeat outgrown andoutdated,alongwithinvestment standard oftheeasternfacility, whichis strategy togovernment;increasethe presenting the‘twoclubs,twohubs’facilities The focusforthisyearwastoassistwith Relations Public PolicyandGovernment

and half of2019. and FederalParliamentaryelectionsinthefi rst widely withallpartiesintheleaduptoNSW • Port Macquarie-Hastings • Port Stephens • Penrith • Parramatta • North Sydney • Northern Beaches • Newcastle • Dubbo • Maitland • Ku-ring-gai • Inner West • Cumberland • Coffs Harbour CityofSydney • • Canada Bay • Canterbury-Bankstown • Blacktown • Bega • Bayside BotanicalGardensandCentennialParklands • • Albury recreation planninginNSW: cricket infrastructureandopenspace government andstateauthoritiestodevelop in discussionswiththefollowinglocal The CNSWInfrastructureteamhasbeen Orange inlate2018. pilot regionalC&CCfacilityatWade Park, Construction isexpectedtocommenceonthe space isexpectedtobecompletedinQ12019. associated amenitiesandadministration lane indoorand10outdoorfacilitywith Centre (C&CC)atPenshurstPark.Thesix pilot metropolitanCricketandCommunity Onsite workcommencedinApril2018onthe Major projects interest acrossthestate. Fund arealsoexpectedtocreatesimilar Sports FacilityFundandWorld T20Legacy across regionalNSW. TheGreaterSydney Fund andStrongerCountryCommunities Government’s RegionalSportsInfrastructure signifi cantnumberofprojectsundertheNSW Government. CNSWhassupporteda infrastructure acrossthestatebyNSW of investmentinsportingfacilitiesand There hasbeenanunprecedentedlevel announcements NSW Governmentfunding Infrastructure

Infrastructure government. community andcollaborate withalllevelsof team wellpositioned tosupportthecricket The workachievedin2017/18hasthe Collaboratewith otherStateSporting • Identifypotentialpartnershipopportunities • Capitalworksprogramdiscussionsand • to undertakethefollowingactivities: CNSW hasutilisedthefi ndingsfromtheAudit Facility AuditProject(‘theAudit’)in2017, Following thecompletionofNational Cricket AustraliaNationalFacilityAudit Indoorcricketandcommunitytraining • RedevelopmentofOakesOvalinLismore • Centre Program: Australia) throughtheCricketandCommunity following projects(inpartnershipwithCricket CNSW isproudtohaveinvestedinthe to helpdevelopandfostercricketinNSW. providing qualityplayingandpracticefacilities of governmentfortheircontinuedsupportin and thankthecricketcommunityalllevels successful. CNSWwishestoacknowledge The program,initssixthyear, hasbeenhighly as groundimprovementsorclubamenities. practice nets,syntheticorturfpitches,aswell funding forthedevelopmentorupgradeto and 31communitycricketclubsreceived NSW. From50applicationsreceived,sixgrade of communityfacilitydevelopmentsacross CNSW commit$600,000towards$5.2million The 2017/18FacilityGrantsProgramsaw CNSW FacilityGrantsProgram infrastructure acrossNSW. the developmentofcricketfacilitiesand authorities fortheircontinuedsupportin to acknowledgetheabovelocalandstate The CNSWInfrastructureteamwouldlike • Wingecarribee • Willoughby • Wagga Wagga • Upper Hunter TheHillsDistrict • • Tamworth • Shoalhaven • Shellharbour • Randwick priority facilities/infrastructureprojects. ACT andNSWRugby)toidentifykey Organisations (FootballNSW, AFLNSW/ infrastructure development. Government stakeholdersforfacilities/ with cricketassociations/clubsand Government stakeholders. strategy workwithLocal/State open spaceandrecreationplanning/ facility atBiralleePark NSW Country Cricket Association

Membership of the Association 1. Country Cricket Programs 512,386 Ryan Fenning (Central Coast), Simon Keen 2. Academy Coaching Grants & Staffing 598,721 (Central Coast - Captain), Tom O’Neill (Central Delegates 3. General Grants 324,840 Northern) and Caleb Ziebell (North Coastal). P Deaves, G Tunn (resigned Dec 2017), 4. Youth Pathway Programs 573,400 Caleb Ziebell enjoyed a fantastic 5. Regional Community Cricket Field Force 1,546,440 G Rowlands (appointed Dec 2017) (Central Championships, being the leading overall 6. Facilities Grant Programs 250,000 Coast CA); B Middlebrook, T Psarakis (Central run scorer (combined Twenty20 and One 7. Other Administration costs 252,636 Day matches), scoring 395 runs, with Jordan Northern Zone); I Hogg, M Waldock (Illawarra TOTAL 4,058,423 CA); P Marjoribanks, A Nichols (Newcastle Moran (278 runs) and Joe Price (277 runs) Cricket Zone); P Dilley, K Robinson (North Country Cricket Program Breakdown: providing support. Cameron Suidgeest topped Coastal Zone); T Clayton, M Erdeljac (Riverina the wicket takers, grabbing 20 wickets, while Zone); G Creighton, R Cavalier AO (Southern 1. McDonald’s Country Colts 69,986 Joe Price also did very well, taking 18 wickets. 2. McDonald’s Women’s Country With the gloves, Tom Groth was in superb Zone); D Cox, C Wood (Western Zone). 68,698 Championships form with 13 catches and 3 stumpings. Life Members 3. McDonald’s Country Championships 69,835 For his efforts, Price was awarded the Player 4. Commonwealth Bank Australian Country 102,517 G Bennett (2003), D Broad OAM (1993), Cricket Championships of the Championships, and was selected in G Browne (2004), M Cornish OAM (2016), 5. Bradman Cup 64,759 the Australian Country Merit Team, along M Curry (2003), B Gainsford OAM (2001), 6. Kookaburra Cup 67,891 with team mates Tom Groth, Cameron J McMahon OAM (2006), S Moore (2013), 7. Plan B Regional Bash 68,700 Suidgeest and Caleb Ziebell. J Moriarty OAM (2017), J O’Dwyer OAM TOTAL 512,386 (1995), M Silver OAM (2008). Twenty20 Competition Management (NSWCA Administration) CBA Australian Country Round 1 v. Western Australia – B Whitehouse (Country Programs Manager/ Championships Public Offi cer), H Shan (Treasurer). 5th January 2018 New South Wales 3/172 (J Price 88, J Moran Men’s Division Management (NSWCA 39) defeated Western Australia 97 (C Ziebell 3-5, T Engelbrecht 3-18, B Mitchell 2-17) Administration): FINAL TABLE POINTS New South Wales 22 (1.19) Round 2 v. Victoria – 5th January 2018 Country Programs Manager/Public Offi cer: Victoria 22 (1.07) New South Wales 9/105 (T Groth 20 not out) Bruce Whitehouse Queensland 19 defeated Victoria 8/101 (S Burkinshaw 2-6, Treasurer: H Shan East Asia Pacific 18 C Ziebell 2-9, N Foster 2-37) Western Australia 11 Round 3 v. East Asia Pacifi c – 6th January South Australia 10 Committee Of Management 2018 This year’s Championships were played in At its 31st Annual General Meeting on Geraldton, Western Australia, between New South Wales 8/102 (J Moran 32, S Keen 12 August 2017, the NSWCCA elected a 5th and 13th January 2018. 20) defeated East Asia Pacifi c 67 (C Suidgeest Committee of Management comprising Messrs 3-12, S Keen 2-9, J Price 2-11) The Championships involved three P Marjoribanks (Chairman), T Psarakis (Deputy competitions: Round 4 v. South Australia – 6th January Chairman), T Clayton, D Cox, G Creighton, 2018 P Dilley, I Hogg and G Tunn. Mr G Tunn • Limited Overs Competition New South Wales 5/166 (C Ziebell 56, S Keen subsequently resigned in December 2017 and • Twenty20 Competition 49, J Price 37) defeated South Australia 96 Mr G Rowlands was appointed in his place. • Overall Competition Shield (C Suidgeest 4-14, T O’Neill 2-23) The Committee of Management met on four The Bush Blues were successful in taking Round 5 v. Queensland – 7th January 2018 occasions from 4th September 2017 to 4th June out their fi rst title since 2012/13 and their New South Wales 8/151 (C Ziebell 33, S Keen 2018 (both dates inclusive). Attendance was as twelfth overall. follows: 29) defeated Queensland 102 (J Price 3-9, The side dominated the Twenty20 division, T Engelbrecht 3-14, C Suidgeest 2-32) P Marjoribanks (Chairman) 4, T Clayton 2, remaining undefeated and easily accounting FINAL v. Queensland – 7th January 2018 D Cox 4, G Creighton 4, P Dilley 4, M Erdeljac for Queensland in the fi nal, in a performance (as proxy for T Clayton) 2, I Hogg 4, T Psarakis 4, highlighted by a brutal 110 not out from New South Wales 3/190 (C Ziebell 110 not out, G Rowlands 2, G Tunn 2. Caleb Ziebell from only 60 balls. Ziebell was J Moran 50) defeated Queensland 151 awarded both the Player of the Final as well (S Keen 4-19, C Suidgeest 2-22, B Mitchell 2-31) Financial as the Player of the Twenty20 competition. Limited Overs Competition Country Cricket again received generous A poor start to the Limited Overs competition fi nancial assistance from the NSW Cricket saw the Bush Blues lose their fi rst three Round 6 v. East Asia Pacifi c – 9th January Association with $4,058,423 in allocations matches. This meant that they required double 2018 being made available. The following programs bonus point wins in their fi nal two matches, East Asia Pacifi c 250 (C Ziebell 2-14, J Price received the majority of funding: as well as other results to go their way, to see 2-27, S Keen 2-40) defeated New South Wales them take out the overall title. 192 (R Fenning 32, J Price 32) In a tense fi nal day, all fell into place for the Round 7 v. Victoria – 10th January 2018 Bush Blues, to see them edge out Victoria on quotient to take out the Championships. Victoria 9/141 (J Price 4-28, T O’Neill 3-36) defeated New South Wales 138 (C Ziebell 31, There were a number of debutants in the team R Fenning 24 not out) this year: Tom Engelbrecht (ACT Southern), Cricket NSW Annual Report and Yearbook 2017/18 (New SouthWales) • Women’s Division (New SouthWales) Chris Stanger(Queensland), (Queensland), CamWilliams(Victoria), Sam Lowry(Queensland),JoeSpargo Tom Buchanan(Western Australia), (Queensland), (Queensland), Michael Salerno(Queensland),JasonSeng over therole. Breakers, theexperienced KateJacksontook loss oflastyear’s captainLisaGriffi thto the and KirstenSmith(CentralNorthern). Withthe Coastal), NaomiMcDonald(NorthCoastal) Sophie Heath(Illawarra),JessicaMarks (North (Central Coast),NellGibson Northern), included sixdebutants:IsabellaFitzgibbon Breakers inthisyear’s Championships, which A newlooksidetookthefi eldfortheBush Jeff Cook(NewSouthWales –Coach) Caleb Ziebell(NewSouthWales) Australian CountryMeritXII: • Men’s DivisionChampionshipAwards 3-25) with2bonuspoints (J Price3-12,SBurkinshaw3-18,CSuidgeest 21 notout)defeatedSouthAustralia95 New SouthWales 4/96(JMoran45,JNicoll January 2018 Round 10v. SouthAustralia–13th 9/213 (SBurkinshaw4-48)with2bonuspoints 48, CZiebell43)defeatedWestern Australia New SouthWales 7/216(JPrice64,JMoran 12th January2018 Round 9v. Western Australia– (J Nicoll82,CZiebell48) 2-20) defeatedNewSouthWales 8/196 Queensland 8/199(CSuidgeest4-32,JPrice 11th January2018 Round 8v. Queensland– NSW • • • • otenTrioy0 2 6 4 12 8 10 Northern Territory POINTS Western Australia East AsiaPacific Queensland New SouthWales South Australia Victoria FINAL TABLE Caleb Ziebell(NewSouthWales) Ian HealyWicketKeeperAward: Bill O’ReillyTrophy: Player oftheTwenty20 Competition: Player oftheSeries: Twenty20 Shield: Championship Shield: Tom Groth(NewSouthWales) – 20wicketsat10.40 Cameron Suidgeest(NewSouthWales) (New SouthWales)

Country Joe Price(NewSouthWales) Cameron Suidgeest , BenBoyd(Victoria), , JelanyChia(EAP), NewSouthWales BowlingAggregate– JoePrice NewSouthWales

Tom Groth Mitchel English Cricket ,

.

,

Association (Victoria), Kelly Armstrong (Queensland), Brenda Tau (East AsiaPacifi c), (New SouthWales), StephanieBaldwin (New SouthWales), RebeccaCady (South Australia),NaomiMcDonald defeated NewSouthWales 6/110(RCady31) South Australia5/118(NGibson1-10) 12th January2018 Semi-Finals v. SouthAustralia– Pacifi c9/106(N Gibson2-14,KJackson2-15) K Beaumont26notout)defeatedEastAsia New SouthWales 5/117(RCady32, 11th January2018 Round 7v. EastAsiaPacific – New SouthWales 8/89(MLugg27) South Australia5/91(NGibson2-16)defeated 2018 Round 6v. SouthAustralia–10thJanuary (N McDonald31) 2-20) defeatedNewSouthWales 8/109 Victoria 6/110(K Beaumont3-17,MNorup Round 5v. Victoria –9thJanuary2018 6/83 (MNorup2-9,NGibson2-11) out, JMarks23notout)defeatedQueensland New SouthWales 1/86(NMcDonald53not Round 4v. Queensland–9thJanuary2018 9/42 (RVan Veen 2-1) N McDonald22)defeatedWestern Australia New SouthWales 7/134(RCady42, 8th January2018 Round 3v. Western Australia– Round 2-BYE defeated NorthernTerritory 56(IFitzgibbon2-5) New SouthWales 0/62(RCady35notout) 7th January2018 Round 1v. NorthernTerritory – team being selectedintheChampionshipMerit and NaomiMcDonaldbothreceivedcapsafter Rebecca Cady, forthesecondyearinarow, with thebat. Cady wassharpwiththeglovesandexcellent wickets. Aswasthecaselastyear, Rebecca another debutant,NellGibsonwithnine Best withtheballforBushBreakerswas the leadingrunscorerforNewSouthWales. fi nishingwith165runsat41.25,andwas Naomi McDonaldenjoyedastrongcarnival, runs. after edgingoutQueenslandinthefi nalby13 Australia, whowentontowintheirfi rsttitle NSW wasdefeatedinthesemi-fi nalsbySouth the competitioninthirdplace. fi nalroundwinoverEastAsiaPacifi c,tofi nish The BushBreakersgotbackontrackwitha tight lossestoVictoria andSouthAustralia. their fi rstthreematches,beforeconsecutive The sidegotawaytoagreatstart,winning Australian CountryMeritXII: Brittany Perry Amy Wiseman(Manager-SouthAustralia) Kevin Frick(Coach-SouthAustralia), (Victoria), AmyEdgar(Western Australia), (Western Australia),StephanieTownsend Teagan Parker(Victoria), GeorgieMiddleton (South Australia),ChelseaMoscript(Victoria), J Durrheim2-27,BCockley2-49) R Lilburne3-24,MHarper3-38) 56, CArcher2-29)defeated A Heath3-14,KDaley3-19)defeated their supportoftherespectivepoolmatches. Zone andSouthCoastDCA(southernpool),for Inverell ShireCouncil(northernpool),Southern as CentralNorthernZone,InverellDCAand competition sponsorMcDonald’s, aswell Country CricketNSWwishestoacknowledge of theFinal. inaugural MarkCurryMedalforthePlayer fi fteenthtitle.Littlewoodwasawardedthe Coast bythreewicketstotakeouttheir Littlewood, NewcastleedgedoutCentral a superbcaptain’s knockof59fromMark In averyhighqualitymatchandledby Oval, Bowral. was playedon26November2017atBradman Central Coastqualifi edforthefi nalwhich in InverellandShellharbour, Newcastleand After toppingtheirrespectivepoolsplayed McDonald’s CountryChampionship Central Coast121: Riverina 146: of theMcDonald’s CountryColtsCarnival. Tamworth RegionalCouncilfortheirsupport Central NorthernZone,Tamworth DCAand competition sponsorMcDonald’s aswell Country CricketNSWwishestoacknowledge was namedPlayeroftheFinalforhisefforts. (3-24) didthedamagewithball.Lilburne bowlers MaxHarper(3-38)andRupertLilburne the batforRiverinawithanexcellent52,while by 25runs.AngusMcLaywasthepickwith defeating CentralCoastinalowscoringfi nal Riverina securedtheirfi rsttitlesince1988/89, leading sidesofeachpool. four, withafi nalbeingcontestedbetweenthe days, withsidesdividedintotwopoolsof Colts competitionwascontestedoverfour For thefi rsttime,theMcDonald’s Country McDonald’s CountryColts Central Coast8/234: Newcastle 7/235: (AMcLay52,JStaines20, (ZPeters33,BBush26, (M Littlewood59,DHunter (SKeen42,RFenning35, WINNERS OF THE 2017/18 AUSTRALIAN COUNTRY CHAMPIONSHIPS, THE NSW BUSH BLUES Bradman Cup (Under 16) Under 16 City v. Country Challenge The Kookaburra Cup was held in Armidale in January 2018. This season, the Bradman Cup was held in After winning the Bradman Cup, Central Coast Western Zone won their fi rst Kookaburra Cup, Bathurst. The format returned to two pools, played the winners of the Sydney Cricket after remaining undefeated for the duration with the leading sides after three rounds in Association AW Green Shield competition, of the event. Thomas Coady was superb with each pool playing in the fi nal. Parramatta, in the Under 16 City v Country the bat for Western, scoring 197 runs at the Challenge. Central Coast and Western qualifi ed for amazing average of 98.50. the fi nal, which was played at Bathurst The match was played on 18 February 2018 at The leading run scorer for the Kookaburra Sportsground. A solid all round team effort by Raby No. 1 Oval. Cup was Mitchell Ryan (Central Coast) with Central Coast saw them secure a comfortable Central Coast cruised to a very easy six wicket 228 runs, while the leading bowler was Hugh 70 run win. Jake Holmes (Central Coast) win over Parramatta, with Broc Hardy named Ridley (Western) with nine wickets. was named Player of the Final following an Player of the Match after scoring 50 and Following the completion of the Kookaburra excellent innings of 58. taking 3-21. Cup, four combined “super zone” sides The leading run scorer for the Bradman Cup Country Cricket NSW would like to were selected to play in the Under 14 State was Brock Larance (Western) with 149 runs, acknowledge the support of Campbelltown- Challenge which was played in Dubbo from while Jack Heuston (Central Coast) and Caelan Camden CC in hosting the day. 22nd to 25th January 2018. Maladay (North Coastal) were best with the Central Coast 4/163 (B Hardy 50, J Liddle 47, ball, each taking nine wickets. Country Cricket NSW wishes to acknowledge A Kaul 2-16) defeated Parramatta 161 (H King Armidale DCA, Armidale Sports Council, Country Cricket NSW wishes to acknowledge 65, R Johns 25, B Hardy 3-21, L Cork 2-28) Armidale Regional Council, Central Northern Western Zone, Bathurst Council and Bathurst Zone, as well as the competition sponsor DCA for their support of the Bradman Cup. Kookaburra Cup (Under 14) Kookaburra, for their support of the event. Central Coast 8/202 (J Holmes 58, N Hay 39 not out, B Wheeler 2-16, B Brien 2-18) FINAL TABLE POINTS defeated Western 132 (S Hall 43, B Mitchell Western 26 43, T Owen 3-16, J Heuston 3-20) Central Northern 22 Central Coast 19 (0.85) Riverina 19 (0.59) Newcastle 13 ACT Southern 6 North Coastal 0 (-1.85) Illawarra 0 (-2.18) Cricket NSW Annual Report and Yearbook 2017/18 E Cameron2-13) Illawarra 7/87(TWilson22,ALearoyd2-12, North Coastal5/89(MLugg49)defeated Country Championships. hosting theUnder18McDonald’s Women’s Central NorthernZonefortheirassistancein Terrace CC,PortPythonsCricketCCand McDonald’s, PortStephensCouncil,Raymond the supportofcompetitionsponsors Country CricketNSWwishestoacknowledge seven wickets. Gibson (CentralNorthern)eachmanaged Katelyn Beaumont(NorthCoastal)andNell was LilyTassell (Riverina)with98runs,while The leadingbatterforthechampionships and astumpingwasnamedPlayeroftheFinal. Matilda Lugg(NorthCoastal)with49,acatch win overapluckyIllawarracombination. fi fthtitleinsuccessionwithanarrowtwo-run In agrippingfi nal,NorthCoastalgrabbedtheir the fi nalaftertoppingtheirrespectivepools. North CoastalandIllawarraqualifi edfor Under 18Championships Eight sideswerefi eldedineachdivision. held inRaymondTerrace inOctober2017. 18 andUnder15CountryChampionshipswere This season,theMcDonald’s Women’s Under Championships McDonald’s Women’s Country M Webster 3-23) Shore JCA113(WShortis35,JRyan3-18, 36 notout,DMalalage2-36)defeatedNorth Western 8/220(CBrien124,MMcNamara each takingthreewickets. Western, withMacWebster and JacobRyan due toadisciplinedbowlingperformancefrom In reply, NorthShorecouldonlymanage113, Cooper Brien. the backofabrilliantinnings124from Western endedtheir50oversat8/220on After beinginallsortsoftroubleat4/43, in a50overssidefi xture. Moore Shieldcompetition,NorthShoreJCA, the NSWDistrictsCricketAssociationHarold 2018, withWestern playingthewinnerof played atRabyOvalNo2,on18February The Under14CityvCountryChallengewas Under 14Cityv. CountryChallenge y (Newcastle) (North Coastal) Josh Callinan(NewcastleHerald) NSW CountryCricketMediaAward: Josh Woodcock (BradmanOval,Bowral) NSW CountryGroundsmanoftheYear: Graeme Glazebrook(Western) NSW CountryUmpireoftheYear: Country Championships: NSW FemaleCountryPlayerofCBAAustralian Country Championships: NSW MaleCountryPlayerofCBAAustralian Glenn Rowlands(CentralCoast) NSW CountryCoachoftheYear: Will Fort(CentralNorthern) Kookaburra JuniorPlayeroftheYear: Rachel Trenaman (Riverina) of theYear (KateBlackwellMedal): NSW FemaleCountryCricketer (Josh HazlewoodMedal): NSW MaleCountryCricketeroftheYear NSWCCA AnnualAwards Illawarra 14. 27, CentralNorthern25,ACTSouthern24, 37, Riverina31,NorthCoastal28,Newcastle The fi naltablereadCentralCoast38,Western season on38points. for theZoneChampionship,fi nishingthe Central CoasttookouttheHoggSilverShield Zone Championship S Shelley2-19) Central Northern4/85(AFord33notout, C Webber 26,EKavanagh 2-15)defeated New Coasters5/108(GDignam29, Championships. Under 15McDonald’s Women’s Country and CentralNorthernZoneinhostingthe Pythons CC,PortStephensRegionalCouncil McDonald’s, RaymondTerrace CC,Port the supportofcompetitionsponsors Country CricketNSWwishestoacknowledge taking sevenwickets. (Central Northern)wasthebestwithball, run scorerwith171runs,whileClaireMcGuirk Isabella Greig(ACTSouthern)wastheleading of theFinal. a solid26andwicket,tookoutthePlayer Northern. NewCoasters’ClareWebber, with ever titlewitha23-runvictoryoverCentral pools, withNewCoasterssecuringtheirfi rst for thefi nalaftertoppingtheirrespective Central NorthernandNewCoastersqualifi ed Under 15Championships Naomi McDonald Joe Price(Newcastle) JoePrice RachelTrenaman (Captain–Riverina), • JasonSangha(Captain)andRalston • JasonSangha(Captain–Newcastle), • WillFort,DominicO’ShannessyandGlenn • JoshuaStaines(Captain-Riverina), • Tom Groth(CentralNorthern),JoePrice • CalebZiebell(NorthCoastal)onbeing • JoePrice(Newcastle)onbeingawarded • RebeccaCady(Western) andNaomi • The Associationextendsitscongratulationsto: Congratulations Abbey Taylor (CentralCoast),LilyTassell (North Coastal),Claire Murray(Riverina), Lennon (CentralNorthern), MatildaLugg Coastal), EmmaHughes(Western), Claire Fixter (Riverina),AnitaHandono(North Mckenzie Carr(Western), EllieDalgarno- Katelyn Beaumont(NorthCoastal), 19 sidefortheWorld Cup on theirselectionintheAustralianUnder Country MaleUnder19team. Coach), fortheirselectionintheACT/NSW Alex Kemp(CricketNSW–Assistant Greg McLay(Riverina-Coach),and and SamSkelly(ACTSouthern), (Central Coast),JasonRalston(Illawarra) Nikitaras (ACTSouthern),RyanO’Beirne Jordie Misic(ACTSouthern),Blake Ryam Meppem(CentralNorthern), Daniel Leerdam(ACTSouthern), Southern), MatthewGilkes(ACT (ACT Southern),Tom Engelbrecht(ACT Iain Carlisle(Illawarra),CharlieDummer Under 17squad Winsor ontheirselectionintheAustralian ACT/NSW CountryMaleUnder17team Assistant Coach),fortheirselectioninthe (Newcastle -Coach),KylePiper(ACT Glenn Winsor(Newcastle),MarkCameron Ravi Wikramanayake(ACTSouthern), Southern), HenryRailz(Western), (ACT Southern),KalebPhillips (ACT Southern),DominicO’Shannessy (Newcastle), JoshuaLow-McMahon Max Harper(Riverina),LewisHextell Northern), Toby Gray(Newcastle), Clarke (NorthCoastal),WillFort(Central Joshua Claridge(Newcastle),Nicholas Australian CountryMaleMeritteam Coastal) ontheirselectioninthe2017/18 (ACT Southern)andCalebZiebell(North (Newcastle), CameronSuidgeest Championships Final intheToyota AustralianCountry awarded thePlayerofTwenty20 Championships the PlayerofToyota AustralianCountry Country FemaleMeritteam selection inthe2017/18Australian McDonald (NorthCoastal)ontheir (Riverina), Tahlia Wilson (Illawarra), Appreciations • Neil McDonald (Coach), Carolyn Sheehan Naomi Woods (Illawarra), Troy McKiernan (Assistant Coach/Manager), Jessica Stoll (North Coastal - Coach) and Tommy • To the Umpires who offi ciated at all levels (Physiotherapist) and Allison Brockley Anderson (Newcastle – Assistant Coach) of Country Cricket throughout the season (Scorer) for their contribution to the New for their selection in the ACT/NSW Country and to the many honorary administrators South Wales Female Country Team at Female Under 18 team and volunteers, the Association would like the Toyota Australian Country Cricket to acknowledge its appreciation for their • Rachel Trenaman (Captain) and Championships held in Geraldton (WA) outstanding contribution and dedicated Tahlia Wilson on their selection in • Darren Goodger and the NSW Cricket support. The contribution of the Australian Under 19 side Umpires and Scorers Association for their local government bodies throughout all support of Country Cricket • Gabrielle Sutcliffe (Riverina), Alisha our country regions, is also recognised. Bates (Central Coast), Dharmini Chauhan • Match Referees and Umpires Observers In addition, thanks are expressed to: (Illawarra), Jessica Davidson, (Central Ian Thomas (Western) and Keith Griffi ths Northern), Grace Dignam (Central Coast), • The New South Wales Cricket Board, in (North Coastal), as well as all members Hannah Faux (North Coastal), Dahlia particular Chairman, John Warn and Chief of the Representative and Supplementary Glennie (Central Northern), Lara Graham Executive Offi cer Cricket NSW, Andrew Umpires Panels Jones for their continued support of (Central Northern), Hannah Green (Central • Zone Administrators Rob Pye (North NSW Country Cricket Coast), Abbey Taylor (Newcastle), Olivia Coastal), Hayley Bullock (Central Osborne (North Coastal), Clare Webber • Paul Marjoribanks as Chairman of NSW Northern), Graham Lowbridge (Southern), (Newcastle), Sarah Young (Illawarra), Country Cricket Alan Nichols (Newcastle), Lindy Peters Deni Baker (Central Northern), Kayla Burton • Ian Hogg for his contribution as the NSW (Central Coast), Colin Wood (Western), (lllawarra), Kareena Dawson (Central Country Delegate of the Country Cricket David Nichols (Riverina) and Glenn Bridge Northern). Steve Davies (Coach) and Reference Group (Illawarra) for their valued contribution Luke Knight (Assistant Coach) for their • NSWCCA Selection Panel Members throughout the season selection in the ACT/NSW Country Tim Grosser (Chairman), Greg Arms, • All New South Wales Blues Squad Female Under 15 team Neil Doherty, Greg Griffi th and Glenn members and Regional Development • Nathan Price (Captain - Newcastle), Grimmond and for their valued contribution Managers who participated in the Djali Bloomfi eld (ACT Southern), throughout the season Country Blitz Promotion Marty Jeffrey (Western), Ben Patterson • Jeff Cook (Coach), Robbie Jackson • All sections of the media for their (Western), Brock Larance (Western), Brynley (Assistant Coach/Manager), Peter continued coverage of Country Cricket Richards (ACT Southern), Nate Jones Lagopodis (Physiotherapist) and David (ACT Southern) for their selection in the • All Zone Academy Coaches and Regional Redden (Scorer) for their contribution to NSW Male team Coaches for their contribution to the the New South Wales Male Country Team coaching and development of players • Jemma Astley (Central Coast), Sara Darney at the Toyota Australian Country Cricket within their respective regions (Western), Zoe Fleming (Central Northern), Championships held in Geraldton (WA) Madison Greenhalgh (Illawarra), • All Women’s Cricket Representatives Anika Learoyd (North Coastal), Alex Patten for their work with the various women’s (Central Northern), Roxanne Van Veen programs in their respective Zones (Western), Dharmini Chauhan (Illawarra), and Associations. Naomi Woods (Illawarra) and Dimity Parton (Western) for their selection in the NSW Female Imparja Cup team.

MCDONALD’S COUNTRY COLTS WINNERS RIVERINA Cricket NSW Annual Report and Yearbook 2017/18 development ofcricket inschools.Eventually, members tojoincommittees toenhancethe support andtheNSWCA invitingNSWSCA some GradeClubssupplyingearlyfi nancial Grade Clubs.Theirrecognitionresulted in the supportofNSWCAandSydney Association identifi es,asearly1975, A glancethroughtheminutesofour to CricketNSW. Fittingly, thishonorarybodyreturneditsassets cricket inschoolsformorethanhalfacentury. Association. ThisAssocationhadpropagated A decisionwasmadetowindupthe academic programsandreducecosts. as wellminimisedisruptiontostudents’ homogeny acrossallschoolsportformats 15 Years CricketChampionship,achieving proposed formatwouldmirrortheNSW the SchoolSportAustraliamodel.Thenewly was timelytoalignopenschoolscricketwith The departing(peak)bodiesarguedthatit NSW delegatetherein. governed bySchoolSportAustraliaandthe a three-wayschools’associationcompetition NSW SchoolboysCricketChampionshipwith opted tocreateacompetitionreplacethe (CCSC) followedsuit.Instead,theparties Schools (GPS)andCity&Country Associated Schools(CAS),GreatPublic (CIS), anumbrellagroupforCombined In addition,CombinedIndependentSchools withdrawing theirsupportfortheorganisation. (CHS) andCombinedCatholicColleges(CCC) question bytheCombinedHighSchools meaningful contributionwasbroughtinto of thispublicstatement,theAssociation’s of cricket.However, withinafewmonths provide ameaningfulcontributiontothegame and strongvolunteerbasewouldcontinueto its wide-rangingnetwork,historyofinnovation the NSWSchools’CricketAssociation,with In lastseason’s AnnualReport,Iwrotethat NSW 2017 NSWSCHOOLBOYSREPRESENTATIVE TEAM

Schools

Cricket Association: following persons who werepillarsofthe said, itwouldberemiss nottomentionthe Association sinceitsinceptionin1966. That who haveservedtheNSWSchools Cricket recognise theremarkablecontribution ofthose In thelimitedspaceavailable,itisdiffi cultto circumstances. opportunities, irrespectiveoftheirfi nancial us toprovideallstudentswiththesame from CricketNSW, thissponsorshipenabled (2012-17). Withthegenerousyearlygrant Hickman andRitchardFinancialPlanning of NSW(1992-2009)andmorerecentlyfrom of NSW(1981-2018),TheLordsTaverners’ from CaltexOil(1976-84),TheCarbineClub sponsorships, withgenerousfi nancialsupport supported byanumberofextended From theearlystages,wehavebeen had anequalopportunitytoperform. Panels offi ciatedtoensurethatallstudents Country, SydneyGrade,StateandInternational community. Ineveryfi xture,umpiresfrom signifi cantcontributionoftheumpiring Our Associationwishestorecognisethe minimal cost. to runmanyofthevariouschampionshipsata post carnivalfunctionvenuesthatenabledus of staffandthesupplyqualityplaying it wastheirgenerositythroughtherelease The schoolswerealsoamajorcontributor, for appreciated. most recently, AndrewJones,hasbeenmuch Radford AM,BrianHughes,DavidGilbertand, the respectiveheadsofCricketNSWinBob this period.Inparticular, supportreceivedfrom provided invaluablecontributionsthroughout staff membersofCricketNSWwhohave Our Associationwouldtothankthemany up untilourAssociationcloseditsoperations. forthcoming andthissupporthascontinued fi nancialsupportanddelegatestatuswas

Association Council 1966-2006; FounderAustralianSchoolsCricket 1998-2018 President 2012-2018;NSWCADelegate Secretary 1988-1994,1995-2011, 1979-2018; NSWCCC&NSWCCSCAssistant Treasurer 1971-1987 Served inBathurstRegion50Years Country SchoolsCricketAssociation1991; whose shoulders westand. They aretheunsung heroes,thegiantson leading State/Province inthecricketingworld. the pyramidthathas seenNSWbecomethe These volunteersformedapartofthe baseof 1998-2016 1968-1978; Secretary&Assistant Years; NSWCADelegate13Years Secretary 17Years; AssistantSecretary6 Representative 1995-2016) Manager, AssistantSecretary&Treasurer 2018, CCCDelegate&RepresentativeTeam 1969-2012; President1982-2012 Club CupOrganiser 2018; CHS&NSWTeam Manager;Carbine AAK (Tony) GiffordOAM: Tony LantryOAM: Martin Haywood: Brian Sawyer: Michael Falk: Graeme Kightley: Tim Murray: Christopher Brown: Michael Punch: Br BrianBerg: 1975-1980; Patron1985-2006 Warren Saunders: Don WiburdOAM: Garth Lukins: Championship Referee2004-2017 Treasurer 2004-2011;Secretary2012-2018;

NSWSCA Committee2002-2018; NSWSCACommittee(NSWCHS NSWSCA Committee1973-2007; NSWSCAFoundingMember NSWSCACommittee2017- NSWSCACommittee& NSWSCACommittee NSWSCACommittee NSWSCACommittee NSWSCAPresident FounderNSWCity& NSWSCACommittee1992- NSWSCACommittee We gained great pleasure in watching many Under 17s carnival but the players did get to Max Harper NSWCHS 1 students progress to the highest level and take experience a day/night match at Caloundra Lachlan Lloyd NSWCIS pride in knowing that Schools’ Cricket played which was played as a 25/25, 50 over game Ben Mitchell NSWCIS an important part in their development as with each team facing 25 overs in the daylight cricketers and more importantly as a person. and then 25 overs under lights. This was a Josh Moors NSWCHS 1 Finally, I would like to thank my fellow great experience for the players and one I am Luke Powell NSWCIS Committee members who have served sure they will not forget. Tim Reynolds NSWCHS 1 Schools’ Cricket with great expertise and Queensland batted fi rst and came out fi ring Charles Wallace NSWCIS enthusiasm. The core of this group has scoring 3/143 from their time in the daylight Coach: Tim Laws; Manager: Huw Blood. been together for more than 20 years and using the Dukes ball. We responded with has served in different roles as the need 3/110, losing the latter two wickets just arose. These offi cials have been tireless before dinner. After dinner under lights, Australian 15 Years Championship and adaptable in giving their time to provide Queensland went on to record 6/330 and we The 15 Years National Carnival was held in opportunities for students in NSW to strive to lost wickets late in the chase to end up all out Queensland with a modifi ed draw because of achieve their cricketing aspirations. for 244. This meant that Queensland retained the introduction of extra teams. NSW selected Graeme Kightley the Gifford-Lukins Trophy. two competitive teams which fi nished second President NSWSCA & Schools Delegate We then moved to Noosa for the Carbine Cup and third behind Victoria Metro. As the result three-day match and, having lost the toss, of their performances, four NSW players 2017/18 Offi ce Bearers we struggled to be all out for 123 to which gained selection in the National team to Queensland replied with 352 all out late on compete in the National Under 17 carnival. Patron: David Gilbert the second day. President: Graeme Kightley We responded with 351 all out, including 112 The NSW Schoolgirls Secretary: Tim Murray by Nathan Baker, but Queensland closed the Championships match out to be 2/130 to record a win by 7 Assistant Secretary: Vacant wickets and retain the Carbine Club Trophy. Results of Round Games Treasurer/Public Offi cer: Chris Browne Round 1 NSWCHS 1 1/99 defeated NSWCISCHS 10/96 Auditor: Brad Gordon The Schools Championship 2017 NSWCHS 2 10/143 defeated NSWCCC 10/121 Delegate to the NSWCA: Graeme Kightley The NSW Schools Championship was held Round 2 NSWCIS 1 4/133 defeated NSWCHS2 2/67 Executive Committee: Brian Sawyer, Gavan in Wollongong, with the following schools NSWCCC 2/81 defeated NSWCIS 4/80 Twining, Ivan Spyrdz, James Henry participating: from CHS Epping Boys High Round 3 NSWCHS 1 6/102 defeated NSWCCC 7/55 School, Illawarra Sports High School, Affi liate Representatives Westfi elds Sports High School, from CCC NSWCIS 2/110 defeated NSWCHS2 3/107 St Augustine’s Brookvale and St Gregory’s Final NSWCHS1 3/54 defeated NSWCHS2 10/52 Combined High Schools: Darren Nunn Campbelltown, Kings from GPS, Knox Combined Catholic Colleges: Troy Nuske Grammar from CAS and Oakhill from Country Awards Greater Public Schools: Ross Turner Schools, who gained entry because the fi nal Best Batter – Sarah Young CHS2 Associated Schools of NSW: Mark Bos was washed out. Best Bowler – Isabelle Afaras CCC City and Country Schools: Andrew Waters From the fi rst round, St Augustine’s, Knox, Kings and St Gregory’s won through to the Best Fielder – Maddy Darke CHS1 The Carbine Club Cup 2017 semi-fi nals. The fi nal came down to a replay Player of the Championships – of the Downie Trophy fi nal where the CCC Hannah Darlington CHS1 NSW Schoolboy’s Representative Team 2017 Champions, St Augustine’s College, were which played in Queensland: defeated by St Gregory’s. Merit Team Zack Hersov GPS Champion School: St Gregory’s College Hannah Darlington CHS1 Luke Hawksworth CHS2 Campbelltown Maddy Darke CHS1 Tane Nunn CHS1 Round 1 NSWCHS 1 10/206 defeated NSWCHS 2 10/180 Hannah Faux CHS1 Ben Panayotopoulos CCC NSWCHS 10/278 defeated NSWCCC 10/240 Naomi Woods CHS1 Raveesh Srivastrava CHS1 Round 2 NSWCIS 8/194 defeated NSWCHS 1 10/166 Stella Campbell CHS1 Ryan Clark CCC NSWCCC 5/145 defeated NSWCHS 2 10/141 Sarah Young CHS2 Marty Jeffrey CHS1/2 Round 3 NSWCHS 1 2/157 defeated NSWCCC 10/156 Phoebe Litchfi eld CIS Nathan Baker CHS1 NSWCIS 9/227 defeated NSWCHS 2 10/153 Kate Petersen CIS Ollie Anable CHS1 Olivia Porter CCC Jack Harris CCSC Boys Merit Team Maddy Penna CCC Charles Wallace GPS Kaleb Phillips (c) NSWCHS 2 Isabelle Afaras CCC Fletcher Rose CCSA Thomas Atlee NSWCIS Emma Hughes CCC Coach: Jack Ritchie; Manager: Tim Murray; Connor Blaxhall NSWCCC Tour Manager: Brian Sawyer. Josh Claridge NSWCHS 1 The team travelled to Queensland and was Cameron Cotter NSWCCC disrupted by losing our grounds to the national Cricket NSW Annual Report and Yearbook 2017/18 Laurie Borg. Darren Goodger, KeithGriffi ths,KimNorris. Bill Hendricks,ClairePolosak. Graham Chudleigh,MarkHughes, Umpires’ andScorers’Association). Zone), andDavidWent (FarNorthCoastCricket Umpires’ Association),SamRees(Central North – StephenBlomfi eld(SydneyShiresCricket outstanding contributiontotheAssociation awarded tothreeFullMembersfortheir in attendance.PrincipalMembershipwas NSW on5July2017with104members Association washeldatBowlers’Clubof The 104thAnnualGeneralMeetingofthe Annual GeneralMeeting Manager, CricketNSW: Executive Offi cer, NSWCUSA/StateUmpire Claire Polosak. Umpire Educator-Female Engagement: Administration Manager: Administration Offi cer: Country UmpireObservers: Country UmpireAdvisor: Mark Grant,BillHendricks,GrahamReed. Graham Chudleigh,ErrolCranney, BobDavis, NSW PremierCricketUmpireObserverPanel: Delegate toSydneyCricketAssociation: Mark Hughes. Delegate toNSWCricketAssociation: AM MBE,RichardFrenchOAM,GrahamReed. Patrons: Liaison Offi cer: Honorary Treasurer: Appointed BoardDirector: Elected BoardDirectors: NSW Association WINNER OFTHEALANMARSHALLMEDAL SUE WOODHOUSEWINNEROFTHEMALCOLMGORHAMSCORERSAWARD, DARRENGOODGERWINNERPANEL 1,DAVID ABBEYWINNERPANEL 3ANDVIVEKS MEDAL –COUNTRY UMPIREOFTHEYEAR,SHARADPATEL WINNEROFTHEGEORGEBORWICKMEMORIALAWARD ANDPANEL 2,MICHAELMEEHANWINNER AWARD WINNERSLTOR,JOHNPEARCE WINNEROFTHETEDWYKESMEDAL–AFFILIATED ASSOCIATION AWARD, GRAEMEGLAZEBROOKWINNEROFTHE Brian BoothMBE,AlanDavidson Neil Findlay.

Cricket Laurie Borg. Nic Bills.

Darren Goodger. Geoff Garland(Chair), Ian Thomas. Troy Penman.

Gaurav Desai. Neil Findlay,

Umpires Scorers’ Award. the CountryUmpire oftheYear Award andthe thank theBradman Foundationforsponsoring The Associationwishestoacknowledge and Woodhouse (BlacktownDistrictCricketClub) George BorwickMemorialAward: Award): Ted WykesMedal(Affi liatedAssociation Graeme Glazebrook(Western) Kevin PyeMedal(CountryUmpireoftheYear): Year: NSW PremierCricketPanel1Umpireofthe Year: NSW PremierCricketPanel2Umpireofthe Year: NSW PremierCricketPanel3Umpireofthe Year: NSW PremierCricketPanel4Umpireofthe Malcolm GorhamScorers’Award: Year): Alan MarshallMedal(RookieUmpireofthe for 2017/18were: French andGrahamReed.Theawardwinners Performance DavidMooreandPatronsDick John McGruther, GeneralManagerCricket Foundation), CodeofConductCommissioner Aden Nawaz(Beastwear),RinaHore(Bradman of ManagementmemberPaulDilleyAPM, NSW CountryCricketAssociationCommittee the SydneyCricketAssociationAndrewFalk, to welcomeasspecialgueststheChairmanof superbly asMC.TheAssociationwaspleased magician PhilCasswhileJayLentonperformed wonderful entertainmentprovidedbycomedian/ was attendedby178membersandguestswith held atBankstownSportsClubon14April2018, The AnnualDinnerandAwards Presentation, Presentation Annual DinnerandAwards Cricket Umpires’Association)

Darren Goodger Sharad Patel David Abbey Michael Meehan Vivek Solanki

John Pearce(CoffsHarbour&District

and Sharad Patel

Sue

Scorers • Administrators Troy PenmanandNicBills. was superblyorganisedbyNSWCUSA The AnnualDinnerandAwards Presentation • • • • umpire panels: NSWCUSA wasrepresentedonthefollowing Representative Umpires IanWrightwhomadehisdebutasascorer • ChristineBennisonandDarrenMattison • offered to: The congratulationsoftheAssociationare Kay Wilcoxon,SueWoodhouse, IanWright. Darren Mattison,GeoffRogers,RobynSanday, Christine Bennison,CherylBrain,Toni Lorraine, season 2017/18: Cricket NSWRepresentativeScorerPanelfor The followingscorerswereappointedtothe Scorers merchandise, ofthehighestquality. provided umpireswithfi eldshirts,andother arrangement withBeastwearwhich The Associationcontinueditssponsorship Sponsorship Troy Penman, GlenStubbings Anthony Hobson,Ryan Nelson,MarcNickl, Cricket NSWState UmpirePanel: Panel: Cricket AustraliaDevelopmentUmpire Lightbody, Tony Wilds, Gerard Abood,GregDavidson,Simon Cricket AustraliaNationalUmpirePanel: Gerard Abood,PaulWilson ICC InternationalUmpirePanel: ICC EliteUmpirePanel: v Englandfi xtureattheSCG. in aOne-DayInternationaltheAustralia Australia vEnglandTest matchattheSCG. who weretheappointedscorersfor

Claire Polosak,Ben Treloar

RodTucker KEVINPYE PANEL 4, OLANKI The congratulations of the Association are • SSA 15 Years and Under Male (Brisbane/ for the appointment of umpires to offered to: Sunshine Coast) – Berend du Plessis and representative matches under the auspices of • on his appointment to umpire Andrew Hamilton their Zone. a Champions Trophy semi-fi nal and on • Under 17 Male (Brisbane/Sunshine Coast) We offer thanks to John Burgoyne who standing in his 60th Test Match in the – Roberto Howard and Ryan Nelson replaced Lachlan Walker as the Southern England v Pakistan fi xture at Lord’s • Under 19 Male (Hobart) – Anthony Hobson, Zone Umpire Representative after Mr Walker (First Test, 24-28 May 2018). Troy Penman, Claire Polosak, relocated to Newcastle. • Gerard Abood on his elevation to the Glen Stubbings The Country Cricket NSW Umpire Sub- ICC International Umpire Panel, his T20 • National Indigenous Cricket Championships committee was disbanded with umpire International debut and appointments to (Alice Springs) – Stuart Grocock appointments to all matches in the Country umpire the Sheffi eld Shield Final and act as Cricket NSW representative programs made • Australian Country Cricket Championships TV Umpire for the JLT One-Day Cup fi nal. by the State Umpire Manager. The selection of (Geraldton) – Graeme Glazebrook • Paul Wilson on his appointment to the the Country Cricket NSW Umpire Panels was Gerard Abood and Greg Davidson were Women’s World Cup (UK), U19 World made by the Country Umpire Advisor and the selected by Cricket Australia for umpire Cup (New Zealand), World Cup Qualifi ers State Umpire Manager. exchange. Mr Abood umpired two fi rst-class (Zimbabwe) and to umpire the domestic The umpires selected on the Representative matches in India while Mr Davidson umpired JLT One-Day Cup Final. Umpire Panel were: a fi rst-class match in New Zealand. Both were • Greg Davidson on his appointment to fi ne representatives for New South Wales and • Bruce Baxter (North Coast) umpire the WBBL Final. Australian umpiring. • Gary Crombie (Central North / Newcastle) • Simon Lightbody on his elevation to the • David Cullen (Illawarra) National Umpire Panel and his debut in the Country Cricket NSW • James Figallo (Central Coast) KFC T20 Big Bash League. The primary duty of the Zone Umpire • Neil Findlay (Illawarra) • Tony Wilds on his elevation to Representative is to liaise with NSWCUSA in the National Umpire Panel and his relation to the planning and implementation • Graeme Glazebrook (Western) of training and development programs to be appointment to umpire a WBBL semi-fi nal. • Greg Jones (Western) conducted within the Zone by the Association. • Claire Polosak on making her List A The following were appointed as Zone Umpire • Ross McKim (Newcastle) debut and her appointment to the Women’s Representatives: • John Pearce (North Coast) World Cup. • Central Coast: Don Maisey • David Went (North Coast) • Ben Treloar on his elevation to the The umpires selected on the Supplementary Development Umpire Panel and his • Central North: Gary Crombie Umpire Panel were: appointment to umpire three matches • Illawarra: Neil Findlay in the U16 International Series between • Newcastle: Kim Norris • Ken Brooks (Riverina) Australia and Pakistan and act as the TV • North Coast: Paul Dilley APM • Tony Hackett (Riverina) Umpire for the WNCL fi nal. • Riverina: Pat Kerin OAM The Country Cricket NSW Finals were umpired • Troy Penman on his appointment by: • Southern: Lachlan Walker / John Burgoyne to umpire two matches in the U19 Country Championship: Graeme Glazebrook • Western: Greg Jones International Series between Australia and Neil Smith and Pakistan and to umpire the U19 Male All worked tirelessly to support cricket Plan B Regional T20 Bash: Bruce Baxter and National Championships fi nal. and promote umpiring in their Zone. Their Graeme Glazebrook • Ryan Nelson on his elevation to the appointment proved to be an asset in the Country Colts: Gary Crombie and David Cullen Cricket NSW State Umpire Panel, his debut communication process between NSWCUSA in the Futures League and his appointment and Country Cricket NSW. Zone Umpire Bradman Cup: Ken Brooks and Gary Crombie to umpire the U17 Male National Representatives also assumed responsibility Championships fi nal. • Graeme Glazebrook on his appointment to umpire the Australian Country Cricket Championships T20 (Men’s) fi nal. • Stuart Grocock on his appointment to umpire the National Indigenous Cricket Championships (Men’s) fi nal. • Berend du Plessis on his appointment to umpire the SSA 15 Years and Under (Male) fi nal. NSWCUSA was represented at the following Cricket Australia National Championships: • Under 15 Female (Adelaide) – Michelle Evans and Annette MacKenzie • Under 18 Female (Canberra) – Kirsten NSW CRICKET UMPIRES’ AND SCORERS’ ASSOCIATION STAFF, L RO R, NIC BILLS, CLAIRE POLOSAK, DARREN Funston and Annette MacKenzie GOODGER, TROY PENMAN Cricket NSW Annual Report and Yearbook 2017/18 Troy PenmanandBenTreloar. v SydneyUniversityatOldKingsOval– Troy Penman. at SCG–SteveO’Shaughnessyand Glen Stubbings. at HowellOval–BerendduPlessisand Marc Nickl. at OldKingsOval–RobertoHowardand and Troy Penman. Suburbs atManlyOval–AndrewHamilton Ben Treloar. Sydney UniversityOval–DarrenGoodgerand Lightbody andTony Wilds. Warringah atMark Taylor Oval–Simon Davidson. at BankstownOval–GerardAboodandGreg SimonDodwell andAnthonyRaymond • appointment of: The Associationacknowledgesthe and AndrewHamilton. Warringah atMerrylandsOval–DarrenFoster AW GreenShield: Poidevin-Gray Shield: Fifth Grade: Fourth Grade: Third Grade: Second Grade: Kingsgrove SportsT20Cup: First GradeLimitedOversCup: First Grade: Premier Cricketfi nalswere: The umpiresappointedtothevariousNSW opportunity tofurthertheirexperience. Affi liatedAssociationswhoacceptedthe season 2017/18,including31membersfrom umpires offi ciatedinNSWPremierCricket offi ciatedbyaccreditedumpires.Atotalof196 by-round basistoensureallmatcheswere the umpireappointmentprocessonaround- for theiroutstandingcommitmentinmanaging Cricket Umpires’Association)arecommended Penman andStephenBlomfi eld(SydneyShires appointments inaprofessionalmanner. Troy available sowillinglyandwhofulfi lledtheir credit tothoseumpireswhomadethemselves such anextensivecoverageispleasinganda Cricket, a100percentcoverage.To have in NSWPremierCricketandSydneyShires Two umpireswereappointedtoeverymatch Sydney CricketAssociation includes 39affi liatedumpireassociations. The Associationhas1,281members,which Membership NSW Districts atJoeMcAleer Reserve. Briars andMount Pritchard-Southern Grade FinalplayedbetweenBurwood to umpiretheSydneyShiresCricket First

ParramattavSydneyUniversity ParramattavManly-Warringah Cricket Sydney Universityvat Manly-Warringah vWestern Northern DistrictvManly- ParramattavManly- Penrith vGordon

Umpires PenrithvSydney Parramatta

and Drummoyne. a NSWPremierCricketFirstGradematchat match inPerth,whileJackPatersonumpired umpire aWACA PremierCricketFirstGrade Association whichsawRobertoHoward with theWestern AustralianCricket An umpireexchangeprogramwascommenced Grade matchatSydneyUniversity. Wolff umpireda NSWPremierCricketFirst First GradematchinHobart,whileHarvey umpired aCricketTasmania PremierLeague and CricketTasmania continued.SharadPatel The umpireexchangebetweenNSWCUSA their fi rstgradedebut. and BruceWhitehouse,eachofwhommade umpires IanHerbert,KedarOza,SharadPatel The Associationofferscongratulationsto 150FirstGradematches–PeterTate • 150FirstGradematches–Andrew • 250FirstGradematches–DarrenGoodger • 550matches–ChrisWeir • 600matches–LindsayKain • during theseason: Signifi cantumpiringmilestoneswereachieved umpiring performancesacrossthegrades. and observationshaveassistedtoimprove Umpire ObserverPanel.Theirfeedback appreciation totheNSWPremierCricket The Associationextendsitsthanksand BerendduPlessisandSharadPatelto • SathishKumarandBobMcGregorto • offi cials inrecruitingnewumpires. hard workatthelocal levelbyvolunteer New SouthWales isappreciated,asthe umpires forcricketcompetitionsthroughout training teamtoeducatingandpreparing commitment anddedicationoftheNSWCUSA Cricket tobecomeaccreditedumpires. The the NSWCUSAassessmentonLaws of A totalof198peoplesuccessfullycompleted courses wereconducted. and Wollongong. Atotalof20suchtraining Ourimbah, Parramatta,Scone,Tamworth Moore Park,Narrabri,Newcastle,Orange, Dubbo, Granville,Kempsey, Lismore, at Albury, Armidale,Bowral,, 2017 CodeoftheLawsCricketfacilitated New SouthWales withtrainingcoursesonthe to umpiretraininganddevelopmentacross The Associationmaintaineditscommitment Training andDevelopment Hamilton Phillips South. between UNSWandPenrithatDavid umpire theMetropolitanCupFinalplayed and StGeorge-SutherlandatBISP2. Grade FinalplayedbetweenUniversities umpire theWomen’s PremierCricketFirst

Scorers

Association Premier Cricket. involvement andcontributiontoNSW in the2018/19seasonandtotheirongoing increased numberofactivefemaleumpires in season2017/18.We lookforwardtoan in SCAcompetitionswerefi lledbyfemales Wales andatotalof91matchappointments 103 accreditedfemaleumpiresinNewSouth the femaleengagementspace.We nowhave Claire Polosakhasdoneanoutstandingjobin quality umpiretrainingState-wide. Borg forhiscommitmenttodeliveringhigh Gratitude isextendedtoleadtrainerLaurie The Associationofferscongratulationstoeach. GregMorrissey(Parkes)receivedthe • PatKerinOAM(Cootamundra)was • GrahamHudson(Morpeth)receivedthe • Tony Hackett(Wagga Wagga) was • JohnEvanswashonouredwithlife • PaulDilley(PortMacquarie)wasawarded • Member Achievements NSWCUSA Executive Officer R DGoodger NSWCUSA inhistime asChairman. the futureandappreciatehissupport of NSW. We wishMrWarn everysuccessin thanks forhistenureasChairmanof Cricket Warn weextendourcongratulationsand NSWCUSA expressesitsgratitude. To John Andrew Jones,andtheNSWCricket Board, Performance Department.To DavidMoore, season. TheAssociationsitsintheCricket offi cialsandtheAssociation duringthepast to CricketNSWforitssupportofmatch Team offersavoteofthanksinappreciation The NSWCUSABoardandManagement Vote ofThanks and Western Zone. to cricketinParkes,LachlanCricketCouncil Medal oftheOrderAustraliaforservices to sportinCootamundra. awarded theMaxRuddTrophy forservices to cricketinHunterValley CricketCouncil. Medal oftheOrderAustraliaforservices Match Offi cialoftheYear. awarded theCricketNSWCommunity accredited umpiretrainer. NSWCUSA asMerchandiseOffi cerandan fi xturesandhasbeenaloyalservantto he hadstoodin385NSWPremierCricket time ofhisnominationforlifemembership, the Associationonandofffi eld.Atthe Mr Evanshasgivenoutstandingserviceto General Meetingon6September2017. membership ofNSWCUSAataSpecial the peopleofNewSouthWales. years ofdedicatedexemplaryserviceto the AustralianPoliceMedalforhis34 Association Notes

CRICKET NSW CHAIRMAN JOHN WARN, LEFT, PRESENTS LISA STHALEKAR’S LIFE MEMBERSHIP TO HER FATHER HAREN STHALEKAR IN LISA’S ABSENCE.

Acknowledgement of Signifi cant and Australian players will be infectious. that passion and commitment to the future Departures Geoff is a decorated coach, having been Head generations. Coach for Pakistan, the Blues and the Kochi Trent Johnston Cricket NSW wishes to express its sincere Tuskers in the IPL. thanks to all staff for their effort and Trent was appointed to the Blues Head Coach Most recently, Geoff came back to work for commitment over the past 12 months. role in 2015/16, where he had immediate the Blues, fi rst on a part time basis as the success with the Blues winning the Matador We also acknowledge those people who bowling coach with Trevor Bayliss and then Cup fi nal. While he was able to follow up the left the Association during the past year full time with Trevor and Trent Johnston. He next year winning the Matador for a second including Joey Ratcliffe, Michael Visser, has also worked as the bowling coach for the time, success in the Sheffi eld Shield eluded Gareth McCarthy, Jeanne Fourie, Mladen Sydney Sixers for a number of years. Bilek, Herman Lotey, Michelle Goszko, the teams that he coached. He was the Blues bowling coach in our last Daniel McKenna, Haylee Ellis, Nicholas He worked diligently with the Blues squad Sheffi eld Shield title. Toscan, Kathy Barber. during his tenure with the squad and made CNSW would like to thank Geoff for his In particular, the Association would like to every effort to assist the Blues with their commitment in the full-time role over the last pay special tribute to the following people performance. Unfortunately the squad did not few seasons. He has been a great asset to all for their distinguished service and contribution perform to expectation in the Sheffi eld Shield bowlers and those that have been coached by to Cricket NSW. during his tenure, nor did individuals develop him have been very fortunate. as expected. Geoff Lawson As we all know, Geoff is a former Australian Cricket NSW separated from Trent at the After the 2017/18 season, Geoff Lawson international, having taken 180 wickets during conclusion of the 2017/18 season. a 46 Test career. He is one of only eight ‘100 announced that he would pull back from his The Board and staff wish Trent the best in Club’ Blues playing members and is a Life full-time commitments with the NSW Blues his future endeavours. team. Member of NSWCA. Geoff has decided to work more closely with Geoff is possibly the most passionate Blue. Justine Whipper the pathway program and the Transition squad He is committed to the NSWCA, the players Justine has been with CNSW for almost and will mentor coaches within the CNSW and staff and is always willing to provide sage 5 years and moves on as she has been system. CNSW appreciates his commitment advice when required. appointed as the National Manager to the Pathway and Transition squad and his Although not in a full-time role, we are very - Professional Development and Wellbeing passion in developing our next crop of NSW fortunate that Geoff is continuing to impart Program with the Australian Cricketers Cricket NSW Annual Report and Yearbook 2017/18 team toachieveresults, includingtwoWBBL by settingupthebest opportunitiesforthe team totheCluband ensuredtheirsuccess He alsooversawtheintroductionof the WBBL Club turningaprofi tforthefi rsttime. landscape, Domwasacriticalfactor inthe content andanunderstandingofthe media Sponsorship. Withastrongbackground in streams fromTicketing andMembershipto spearheading thedevelopmentofrevenue business throughastronggrowthperiodand team toacommercialsuccess,guidingthe transition oftheSixersfromagoodonfi eld An avidcricketsupporter, Domsaw the for thefi rsttime. bringing hisbusinessnoustothesportsarena saw theClubgofromstrengthtostrength, Dominic Remond’s fi ve yearswiththeSixers Dominic Remond for thenewrole. be missed,butitwillholdheringoodstead knowledge ofsystemsandhelpfulnaturewill systems andevents.Herattentiontodetail, coordinating multipletravel,payments, within thepathwayoverpastfouryears, Hayley wasinvolvedinalotofmovingparts her thatshehasgainedthisnewposition. passion foreventsandwearedelighted During thisrole,itconfi rmedtoHayleyher to April2018. Events Team withCNSWfromDecember2017 and, morerecently, asecondmentinthe the roleasCricketPerformanceCoordinator four years-beginningasanintern,takingon Hayley hasbeenwithCricketNSWforover Cricket Australia. role asEventsCoordinator(Sydney)with Hayley hasbeensuccessfulingaininganew Hayley Blight best interestswerebeingaddressed. families andfriendsgreatsuretythattheir and partnerswassecondtononegave on thefi eld.Herrelationshipswithfamilies order sothattheymayperformtotheirbest that theplayers’lifeofffi eldwasin no boundaries.Justine’s focuswastoensure Her workwiththecontractedplayersshowed putting parent’s mindsatease. and relocatingtothecityplay, aswell helping themwiththedemandsofHSC time withcountryandcitypathwayplayers, On topofthat,shewouldspendimmeasurable both themaleandfemalecontractedplayers. appointment ofAnikaLalic,Justinemanaged with playersaswellstaff.Upuntilthe Justine hasbeenselfl essinherinteractions Development ManagerinAustralia. person thatiswidelyseenasthebestPlayer Association. Thisisagreatrewardforthe Association

Notes cricket internationally. tradition ofCricketNSWalumnileading Manager fortheICC,continuingalong appointed astheParticipationPathways David leftCricketNSWforDubaiwhen catalyst formajorengagementintheregion. his determinationtodrivecrickethasbeena NSW inahighlyprofessionalmannerand Northern NSW. DavidrepresentedCricket promoted totheroleofDevelopmentLeader His performancewasrewardedwhenhe region formostofhistimethere. obtained annualdoubledigitgrowthinthe successful DevelopmentManager, David years. Establishinghimselfasahighly on theFarNorthCoastofNSWformany Game Developmentandcricketparticipation He joinedCricketNSWin2008anddrove Leader roleforNorthernNSW. region, DavidsteppeduptotheDevelopment the DevelopmentManagerforNorthCoast throughout NorthernNSW. Aftersixyearsas driving participationandgrassrootscricket David spentover10yearswithCricketNSW David Szumowski Mets Baseballorganisation. Performance Co-ordinatorwiththeNewYork the 2017/18seasontotakeupapositionas expertise. MichaelleftCNSWattheendof enormously fromhistime,energyand and theplayersinthoseprogramsbenefi tted enthusiasm workingwithourpathwayplayers management. Healwaysshowedgreat conditioning practicesandbowlingworkload impact intoourpathwaystrengthand Additionally, Michaelhadafar-reaching Performance Gym. the designandre-buildofNSWHigh Michael alsomadealargecontributionto summer’s Ashesseries. Hazlewood, Cummins,Lyon) priortothe of theAustralianTest bowlingattack(Starc, an importantroleinthephysicalpreparation of theBluesyoungerpacebowlersandplayed substantial gainsinthephysicaldevelopment in Bluessquadfi tnessandskinfoldlevels, 10% inbothseasons,continuedimprovement He contributedtoasquadinjuryrateunder contributions. over twoseasons,Mikemadesomeimportant As theBluesStrengthandConditioningCoach Michael Main GFinity, ane-sportsstart-upbusiness. wish DomsuccessinhisnewroleasCEOof under histenure.TheSixersandCricketNSW Championships andanotherfi nalappearance contribution toCNSW. We thankherfor herdedicationandsignifi cant the offi ceeverydayandshewillbemissed. Ally broughtamazingenergyandpresenceto wellbeing initiatives. programs andorganisingourhealth staff conference,logisticsofallourtraining new hire),organisingasuccessfulCNSWall were recruitingover60roles(inductingeach Some ofthehighlightsduringhertenure improved manyofourprocesses. capable andtalentedHRprofessionalshe at CNSW, sheprovedherselftobeavery Manager fortheWorld T20.Duringhertime Ally hastakenuptheroleofPeople&Culture Ally Dirkis further opportunitiesinhiscareer. Club. We wishTom allthebestashepursues similar rolewithSydneyUniversityRugby his rolewiththeSixersconcurrentlya was obvioustoallaroundhim.Tom performed Sixers andhisenergyfortheteamrole Tom wasextremelypassionateaboutthe A popularfi gureamongsttheplayinggroup, Head Coachandothersupportstaff. programming, inconjunctionwiththe and individualstrengthconditioning was involvedinteamperformanceplanning the StrengthandConditioningCoach,he appearances in2014/15&2016/17.As seasons, whichincludedtwofi nal Conditioning Coachforfourconsecutive Tom wastheBBLSixersStrengthand Tom Carter to producetheexcellent AnnualReports all PremierClubpersonnel whocontinue David Sherwoodfrom hisfamily. We commend scorebooks compiledbythelegendary scorer received anamazingcacheofoldRandwick Nolland havebeenconstantvisitors. Lyall James Rodgers,Lyall GardnerandDavid Richard Cook,GrahamKing,Michael Falk, Longstanding researcher-club historians periods ofcrickethistory. articles orbooksonindividualcricketers to gainmaterialsforwritingandpublishing data fortheirwritingofindividualreportsor to researchforclubhistories,accumulate researchers usingourexcellent,vastresources Premier levels.Ortheymaybeveryserious cricket knowledgeatthefi rstclassorClub/ might beinterestedbrowsersaddingtotheir or [email protected]. Ourvisitors You mayvisitorcontactuson(02)83026003 Cricket NSWheadquartersinMoorePark. all between9amand3pmeveryTuesday at We areopenfor visitorsandwelcomethem 2017/18 The CliffWinningLibraryReport Mr Bergin also served as President of the Parramatta Cricket Club for fi ve years. He was a club delegate to the NSWCA/SCA, for both clubs, over a 25-year period. He served that role for Mosman between 1975/76 and 1980/81 and then again between 1987/88 and 1999/2000, when he returned after six seasons with Parramatta. Mr Bergin was also secretary at Mosman for 12 years and Parramatta treasurer for four years, whilst concurrently serving as President. His many other roles included: • 1976/77 to 1978/79 – Member of NSWCA Country Committee for 3 years DICK GUY • 1979/80 to 1981/82 – Member of NSWCA that we use for our research purposes. We He was also a member of the Australian Grade Committee for 3 years thank Andrew Bayles who has continued his selection panel that famously selected former • 1982/83 to 1985/86 – Member of NSWCA worthy research and publications of volumes, Blues off-spinner Peter Taylor to make his Test Executive Committee for 4 years currently on the history of NSW country debut, in the fi fth Test of the 1986/87 Ashes • 1986/87 to 1999/00 – Member of NSW cricket, that are invaluable for our research series at the SCG. Taylor claimed career best Cricket Board for 14 years work. We were able to assist prolifi c authors fi gures of 6-78 in the fi rst innings. • 1996/97 to 1999/00 – Member of NSW Alf James, Richard Cashman, Max Bonnell Mr Guy served as a national selector for two Country Cricket Association Committee and Ken Piesse with their latest publications. seasons between 1985 and 1987. of Management for 4 years. Ken’s new book will be on Cec Pepper. He collected 25 wickets in eight First-Class Congratulations to John Rogers on the limited- His remarkable contribution also included matches for NSW between 1960/61 and edition publication of his book on Warren being head selector, a scorer and the Vice 1968/69, returning best First-Class fi gures Saunders and other St George legends. Thanks Patron for Mosman since 2003. of 4-64 on two occasions. also to Cameron Jones for the material he Amanda Beehag has offered to us. Many thanks to Dr Colin In fi ve matches for NSW Colts, he claimed 21 Clowes and Colin Jefferies who continue with wickets at 24.56 and took best fi gures of 6-71. Amanda “Tetley” Beehag was an executive their epic task of producing the never-ending Mr Guy was a prodigious leg-spinner throughout offi cer with Women’s Cricket NSW between Premier Cricket statistical tables. his 18 seasons with the Gordon Cricket Club in 1999 and 2001, before men’s and women’s cricket integrated in 2004. Our valued association with the SCG Museum the Sydney First Grade competition. continued with assistance to museum curator He claimed 786 wickets at the outstanding Following her term as a leading cricket Anthony O’Carroll’s task of completing the average of 16.44, with an amazing 61 fi ve- administrator, Ms Beehag went on to be recording of all major sporting events at the wicket hauls from 1957/58 to 1974/75 and a senior adviser for the Australian Sports SCG since inception. career best fi gures of 8-34. Commission in Canberra. No matter what the future holds for the Amanda was a professional sports Noel Bergin relocation of Cricket NSW headquarters, the administrator who loved to travel. She found Cliff Winning Library will survive and continue Cricket NSW Life Member Noel Bergin passed the time to fi ll roles such as youth selector to serve our important purposes as it has done away on December 19, 2017. and team manager for the NSW Under 18 since establishment in the city at York Street Mr Bergin was elected a life member of Women’s teams for six years. in 1906 and later at Druitt Street. We have an the NSW Cricket Association in 1986 in Cricket was her favourite sport; she made a almost ideal situation here in the boardroom recognition of extraordinary service for lasting heartfelt impact on many of the Cricket of Cricket NSW in Driver Avenue and believe the association, Mosman Cricket Club and NSW family including former Breakers captain our history and future will continue as a Parramatta Cricket Club. Lisa Sthalekar, who has fond memories of valuable servant to cricket in NSW. He was also a Director on the Australian Amanda when working at Cricket NSW as an Bob Brenner and Dr Colin Clowes Cricket Board (now known as the Cricket emerging player. Honorary Librarians Australia Board) for nine years between Amanda combined her administrative skills 1988/89 and 1996/97. with coaching and was a qualifi ed Level Obituaries In 2001, Mr Bergin was awarded the Medal 2 coach in both Australia and the United of the Order of Australia (OAM) for services Kingdom. She was heavily involved in Dick Guy to cricket. coaching in England as one of three coaches at Wolverhampton Ladies Cricket Club and Former Chairman of Selectors for the New Mr Bergin was a very well-known fi gure within Staffordshire County Junior program. South Wales Blues, Australian selector and the wider Sydney community legend of the Gordon Cricket Club, Dick Guy, and served both the Mosman and Parramatta During the early 1980s, she commenced passed away on 16 May 2018 aged 81. clubs in several capacities. playing for her beloved Manly Cricket Club in 2nd Grade before moving up to 1st Grade with Mr Guy served as Chairman of the NSW panel His involvement with cricket in the Sydney the Ku-ring-gai and Gordon clubs. of selectors for nine seasons from 1979/80 Grade competition began in 1970, when he to 1987/88 and served as a selector for 16 fi rst joined Mosman, where he was to serve as Ms Beehag passed away aged 54 in June seasons between 1972/73 and 1987/88. President for eight years. 2018. Cricket NSW Annual Report and Yearbook 2017/18 Lothian extended17 seasonsfrom1963/64 The outstandingcricketing careerofMr passed awayinApril aged72. (now Parramatta)CricketClub,BillLothian, Long-time servantoftheCentralCumberland Bill Lothian Mr Stimsonwasaged92. 1969/70. for eightcampaignsbetween1962/63to also captainedtheBalmainFirstGradeteam 1979/80 after27seasonswiththecluband He playedhislastmatchforBalmainwasin 158 againstBankstown-Canterbury. 43rd birthdayin1968/69whenheposted His careerbestscorecamejustbeforehis half-centuries. of 26.22,includingtwocenturiesand25 matches, scored4,695runsatanaverage a remarkable22years.In206FirstGrade The FirstGradecareerofMrStimsonspanned Sydney CricketClub. of whichwereplayedforBalmain,nowthe Sydney Gradecricketcompetition,themajority and, played17seasonsinthetopgradeof the 1967/68SydneyFirstGradepremiership Keith StimsonledtheBalmainCricketClubto Keith Stimson 2010, GrantLambert. Kelleway, andBluesallrounderbetween2002- New SouthWales playerthelateCharlie of acenturyand10wicketsinmatch,former Only twootherplayershaveachievedthatfeat by aninningsand247runs. leading theteamtoacomprehensivevictory Balmain dismissUniversityfor22and73, 6-11 and5-44on4January1947tohelp After scoring133in144minutesheclaimed 1946-47. across theChristmas/NewYear periodof same matcheithersideofhis29thbirthday His highestscoreandbestfi gurescameinthe half-centuries. on 24occasions,scoringonecenturyand20 Mr Morgancollectedfi vewicketsinaninnings 1941-42. with abestreturnof56scalpsat12.50in off-spin, twicetaking50wicketsinaseason, and claimed402wicketsat20.19withlively He played224matches,amassed3,968runs team fornineseasons. (1943-54), wherehecaptainedtheFirstGrade both Western Suburbs(1937-43)andBalmain Mr Morganwasadistinguishedplayerfor 100th birthday. June 2018,sixmonthsaftercelebratinghis in Sydney, LesMorgan,passedawayon20 The oldestcricketertohaveplayedFirstGrade Les Morgan Association

Notes (Commonwealth) Games. Australian Cyclingteamforthe1962Empire Notably, hewasalsotheManagerof later years. delegate toCountryCricketformanyofhis Coast DistrictCricketAssociationandwas Templeman servedasTreasurer oftheSouth Between 1996/97and1999/2000,Mr Southern Zone. Zone in2007.HewasalsoChairmanof he wasmadeaLifeMemberofSouthern commitment tosportintheregion,where Mr Templeman maintainedadecades-long May aged81. community, BarryTempleman, passedawayin Dedicated servanttotheSouthCoast Barry Templeman than 400FirstGradewickets. history oftheParramattaclubtotakemore Mr Lothianwasthefi rstfastbowlerinthe until injured. Grade teamin1976/77andpartof1977/78 He wasalsocaptainoftheParramattaFirst retirement in1979/80. at thetoplevelofSydneyGradecricketuntil Petersham-Marrickville andcontinuedplaying claimed 6-71forCentralCumberlandagainst On FirstGradedebutinseason1965/66,he He claimed450FirstGradewicketsat20.14. Wales atColtsand2ndXIlevels. to 1979/80.HealsorepresentedNewSouth (1963-80) First GradePlayer, CentralCumberland Bill Lothian Offi cer Former Women’s CricketNSWExecutive Amanda Beehag Southern ZoneLifeMember Barry Templeman (1937-43), Balmain(1943-54) First GradePlayer, Western Suburbs Les Morgan Life Member Selector, FormerNSWCADirector and NSWCA NSW Cricketer, FormerAustralian andNSW Dick Guy Former CNSWPatron Sir NicholasShehadieACOBE Former NSWCADirectorandLifeMember Noel BerginOAM Former CNSWEmployee Ashley Bryant NSW andAustralianCricketer Bob HollandOAM Obituaries 25/04/2018 01/06/2018 01/05/2018 20/06/2018 16/05/2018 12/02/2018 19/12/2017 17/08/2017 17/07/2017 M WhitneyandRHore Hon KGreene,MRosen,JTait, Life MemberNominations M DaltonandBWhitehouse M Bonnell(Chair),IHogg,TIceton, Constitution Review Hon KGreene I Hogg(Chair),JWarn, GMonaghanand Grants B ClarkandJHenry M Rosen(Chair),HonKGreene,GMail, Cricket R Timbs andMsMStamoulis J Warn, HonPForsythe,JKnox,LGorman, Remuneration &Nomination and RTimbs J Tait (Chair),HonPForsythe,JKnox Audit &Risk As at30June2018 Sub-committees TheDirectorsoftheNSWCricketBoard • To themembersofNSWParliamentary • To thepatronsofourWBBLteams,TheHon. • To theNSWMinisterforSport,TheHon. • To theNSWPremierTheHon.Gladys • To MrAlanDavidsonAMMBE,andThe • To HisExcellencyGeneralTheHonourable • Thank You of cricketinNSW throughout theseason forthebetterment Sub-Committees which metregularly Cricket Committee,aswellthevarious Association andtheNSWWomen’s the NSWCricketUmpires’andScorers’ and NSWSchools’CricketAssociations, Sydney, NSWCountry, NSW Districts and theManagementCommitteesof the Jo Haylen,MP Co-Chairs ChrisPatterson,MPand Friends ofCricketGroup,particularly The Hon.PruGoward,MP, SydneyThunder Gladys BerejiklianMP, SydneySixersand assistance of Sportfortheirgeneroussupportand Stuart Ayres MPandtheNSWOffi ce for theirongoingsupportofcricketinNSW Berejiklian MPandtheNSWGovernment patrons ofCricketNSW Honourable JohnHowardOMAC,also Lendlease Breakers and MrsLindaHurley, patronoftheNSW New SouthWales, PatronofCricketNSW, David HurleyACDSC(Ret’d)Governorof • The Men’s State Selection Panel, R Gerdes (Fairfi eld-Liverpool – Proxy for P Dilley (North Coastal – 3) David Freedman (Chairman), Greg Mail R Cook – 1) K Robinson (North Coastal – Proxy for and Steve B Smith M Rosen (Gordon – 4) P Dilley – 1) • The Grade Advisor Panel Corey Richards, R Timbs (Hawkesbury – 3) T Clayton (Riverina – 2) Bill Anderson, Gavan Twining, Beau Casson H McKay (Hawkesbury – Proxy for M Erdeljac (Riverina – Proxy for and Anthony Clark R Timbs – 1) T Clayton – 2) • The Women’s State Selection Panel, I Finlay (Mosman – 4) G Creighton (Southern – 4) Kerry Marshall and Janine Stainer D Graham (North Sydney – 4) D Cox (Western – 4) • Dr John Orchard (Medical Director), Dr Scott Burne (Sydney Thunder), M Langford (Northern District – 0) C French (ACTCA – 4) Dr Leanne Hutchison, Dr David Samra C Hambleton (Northern District – Proxy for M Hughes (NSWCUSA – 3) • Honorary Librarians, Mr Bob Brenner, M Langford – 3) L Borg (NSWCUSA – Proxy for Dr Colin Clowes and the team of librarians G Monaghan (Parramatta – 3) M Hughes – 1) and researchers involved in the Cliff P Goldsmith (Penrith – 3) E Myatt (NSWDCA – 2) Winning Library P Wright (Randwick Petersham – 4) B Howard (NSWDCA – Proxy for • All Local Government authorities, schools The Hon K Greene (St George – 3) E Myatt – 1) and universities throughout NSW for the G Kightley (NSWSCA – 1) provision of facilities and for their support T Iceton (Sutherland – 4) of the game in general J Penrose (Sydney – 4) T Murray (NSWSCA – Proxy for G Kightley – 1) • Volunteers at all levels who give so freely D Bryant (Sydney University – 3) Ms R Hore (NSW Women’s Cricket of their time and expertise for the benefi t J Toyer (Sydney University – Proxy for Committee – 1) of the game D Bryant – 1) J Biviano (Sydney Shires – 4) • All sections of the media for their support D Bhandari (University of NSW – 3) The Hon P Forsythe (Appointed Board over the past year. N Govers (University of NSW – 0) Director – 4) D Thompson (Western Suburbs – 1) Attendance – Meetings Of The L Gorman (Appointed Board Director – 2) M Swan (Western Suburbs – 1) NSW Cricket Association J Knox (Appointed Board Director – 4) D Thompson (Western Suburbs – Proxy for J Warn (Chairman – M Swan – 2) Attendance NSW Cricket Board Manly-Warringah – 4) G Tunn (Central Coast – 1) The NSW Cricket Board met 12 times between B Freedman (Bankstown – 4) G Rowlands (Central Coast – Proxy for 1 July 2017 and 30 June 2018. S Foster (Blacktown – 3) G Tunn – 1) J Warn (Chair) (12), G Monaghan (1/1), A Connolly (Campbelltown-Camden – 2) T Psarakis (Central Northern – 4) P Forsythe (12), D Thompson (0/1), M Rosen M van Vugt (Eastern Suburbs – 2) I Hogg (Illawarra – 4) (11), K Greene (12), I Hogg (10), J Knox (12), R Cook (Fairfi eld-Liverpool – 3) P Marjoribanks (Newcastle – 4) L Gorman (12) R Timbs (10/11), D Bhandari (3/3)

Grants to Clubs and Affi liates 2017/18

Seasonal Grants Amount Description Premier Clubs $ 394,700 20 x $19,735 Shires Club $ 166,698 14 x $11,907 Country Authorities $ 324,840 8 x $40,605 NSW Districts Cricket Association $ 120,000 City & Suburban Cricket Association $ 5,788 Sydney Shires Cricket Umpires $ 3,859 TOTAL $ 1,015,885

Coaching Grants Amount Description Premier Clubs – Men’s $ 365,620 20 x $18,281 Premier Clubs – Women’s $ 45,000 9 Clubs x various amounts TOTAL $ 410,620

CA Grants Amount Description Premier Clubs – Men’s $ 307,280 20 x $15,364 Premier Clubs – Women’s $ 74,800 9 Clubs x various amounts TOTAL $ 382,080

Total Grants $ $1,808,585 Cricket NSW Annual Report and Yearbook 2017/18 ABN 27000011987 NSW CricketAssociation&ControlledEntities Year ended30June2018 Financials BALANCE SHEET REVENUE &EXPENDITURESTATEMENT oa qiy 12033 19,051,245 19,051,245 19,051,245 21,240,393 7,649,385 21,240,393 162,881 21,240,393 3,917,723 162,881 7,688,538 1,012,487 2,556,294 7,486,504 499,843 26,700,630 2,463,109 499,843 1,984,690 2,740,896 53,634 7,188,695 2,402,466 28,928,931 2,348,832 123,392 392,970 24,298,164 38,514 Total Equity 16,718,679 2,206,290 Retained earnings Equity 2,167,776 354,259 7,063,123 Net Assets 1,523,796 26,722,641 Total Liabilities 20,454,965 1,710,797 (460,073) Total Non-CurrentLiabilities Other liabilities 4,389,621 40,102,447 Non-Current Liabilities 41,934,915 Total CurrentLiabilities Other liabilities (526,924) 2,189,148 Provisions Payables Current Liabilities 44,380,894 338,402 46,814,949 1,832,468 Total Assets Total Non-CurrentAssets Property, plantandequipment Receivables Non-Current Assets 282,017 2,434,055 Total CurrentAssets Other assets Other fi nancialassets Receivables Cash andcashequivalents Current Assets Overall Surplus Depreciation Increased (Decreased)Value ofInvestments Surplus (Deficit) beforeNon-Cashitems Expenditure Revenue 2018 2017 2018 2017 $ $ $ $ $ WE’RE IN SAFE HANDS! At Transport for NSW, we’re 100% commited to improving road safety, and in partnership with Cricket NSW, we’re making a real difference. Our ‘PLAN B’ drink driving message engages the cricket community and encourages everybody to make better transport choices. We’d like to say thanks for another great season and we look forward to continuing our partnership. Lendlease Breakers WNCL Champions 2017/18

Sydney Sixers Rebel WBBL Champions 2017/18