DOCUMENT RESUME
ED 420 287 HE 031 344
AUTHOR Craemer, Helmien, Ed.; Verster, Annetjie, Ed.; du Toit, Renette, Ed.; Davids, Derek, Ed. TITLE Student's Guide to Higher Education in SouthAfrica: With Occupations, Study Opportunities, Bursaries,1998. Third Edition. INSTITUTION Human Sciences Research Council, Pretoria (South Africa). ISBN ISBN-0-7969-1863-5 PUB DATE 1998-00-00 NOTE 274p. AVAILABLE FROM Human Sciences Research Council, Private Bag X41, Pretoria 0001, South Africa. PUB TYPE Reference Materials Directories/Catalogs (132) EDRS PRICE MF01/PC11 Plus Postage. DESCRIPTORS *Career Choice; Career Education; *College Applicants; College Bound Students; *College Choice; Foreign Countries; Higher Education; Technical Education; Technical Institutes IDENTIFIERS *South Africa
ABSTRACT This guide for students contains information on the more than 2,200 programs offered at institutions of higher education in South Africa, as well as on the approximately 1,200 bursaries that p:-,7::,Nide si.udent financial aid. The first section urges students to adopt a long-range life planning approach to choosing a career and col.lego:. The next section presents brief descriptions, organized by field of in st, of typical occupations that require higher education. The following section provides course information by field of study, including university name, course name and degree, duration, and entry requirements. The following two sections present the same information for technikons, training institutions providing career-oriented education, and private colleges, respectively. Also provided is a list of technical colleges, with each college's courses and requirements listed. The section on bursaries distinguishes between scholarships (student aid based on academic merit) and bursaries (student aid based on both merit and need). Information on bursaries, loans, and other forms of financial aid are arranged in alphabetical order. Indexes to the bursaries are by field of study and institution. A final section provides addresses and phone numbers of the institutions listed in the directory.(DB)
******************************************************************************** Reproductions supplied by EDRS are the best that can be made from the original document. ******************************************************************************** 1998
I
A A IP
1
I A 111
AL
U S DEPARTMENT OF EDUCATION PERMISSION TO REPRODUCE AND 011ice of Educational Research and Improvement DISSEMINATE THIS MATERIAL HAS EDUCATIONAL RESOURCES INFORMATION BEEN GRANTED BY CENTER (ERIC) 074his document has been reproduced as received from the person or organization Human Sciences originating it Minor changes have been made to Research Council improve reproduction quality
TO THE EDUCATIONAL RESOURCES Points of view or opinions stated in this INFORMATION CENTER (ERIC) document do not necessarily represent 1 official OERI position or policy
SBN 0-7969- 863-5 Compiled by the Human Sciences Research Council
ft I STUDENTPLAN 7 30796918635 With us you can go so much further Moose from these courses offered by INTEC College
MANAGEMENT Toolmaker Business Management' Construction General Management' Appliance Repair Financial Management Building Gun Pro Marketing' Sales' P1, Video a Hi-Fi Repair Advertising Small Engine Repair Marketing Research Chemistry Lab Assistant Marketing Industrial Chemistry Communications Diesel Mechanic Public Relations Analytical Chemistry Principles of Purchasing Fire Engineering (IFE) Personnel Management Motor Cycle Repair Human Resources Air Conditioning a. Office Supervision Refrigeration Industrial Relations Electrical Eng. Tech. Supervisory Mngmt. Mechanical Eng. Techn. Production Planning & Motor Vehicle Techn. Control Quantity Surveying Security Management (ASAQS) Project Management Building Draughting Stores Admin. & Stock MechanicalDraughting Control Architectural Draughting Information Systems Engineering Draughting Tourism Management VOCATIONAL STUDIES Hotel Management . Franchising Estate Agent . Fundraising Business English Small Business Mngnt. ACCOUNTANCY Journalism Catering Management' Bartending Financial Commercial Art Bookkeeping Cost Psychology Farming Internal Auditing Child Day Care Certified Accountant Child Psychology Pastel Accounting° Sailing & Navigation SECRETARIAL Sport Psychology Junior Secretary Dental Office Assistant Professional Secretary Medical Office Assistant Personal Assistant Travel (COTAC 1) Girl Friday Horticulture WordPerfect Office CREATIVE STUDIES Suite° Gardening PROFESSIONAL Dressmaking' / Design IAC' CIS IMM Fitness and Nutrition ICB IBS FASA Recreational Art There are many things you want to achieve in life, so choosing the ACCA SAIM Photography TETASA SAIF Calligraphy right college to help you is important. INTEC offers you the widest HIGH SCHOOL Beauty Core GCE Std. 10' Short Story Writing range of top quality courses and excellent tutorial support to help you Std. 8 - equivalent' Interior Decorating TECHNICAL STUDIES Gourmet Cooking achieve your goals. Fitter and Turner Flower Arranging Electrician' NI -N3' LANGUAGE STUDIES Installation Electrician' French German Enrol now and enjoy the support of tutors who are experts in their Motor Mechanic Italian Spanish Electronics Welding Xhosa Zulu fields. Study with INTEC at home in your own time, at your own pace. Hierdie kursusse is ook in Afrikaans beskikbaar. We'll help you to enhance your career and enrich your future! ° Software supplied with course. New Courses
DEVELOP YOUR COMPUTER KNOW-NOW and move into an EXCITING and LUCRATIVE CAREER In today's information age you cannot afford to be left behindcomputers are now part.of business and everyday life To survive and remain competitive you must master computer skills and then constantly adapt to their related applications and technologies. Luckilyyou can become computer literate at any age. With INTEC Computer School you can do it at your own pace, in your own time and in your own learning environment. We offer computer courses ranging from basic computer literacy to application training, programming and networking courses. Choose from these Computer Courses offered by INTEC: MCSD U,MCSE NT 4.0 Internet CNA CNE A+ PC Service Technician Visual Basic° PC Repair Windows 95MS Word Access Excel PowerPoint MS Office (95 and 97) Intro. to Programming PC Literacy PC Skills PC Specialist COBOL PASCAL Systems Analysis & Design Programming Diploma Programming in C WordPerfect Office Suite°
e s s I 6.1 I II: .1 S 11 OR WRITE TO US TODAY: S t E' P.O.Box 1104, JOHANNESBURG 2000 P.O.Box 1332, PRETORIA0001 P.O.Box 2918, CAPE TOWN 8000 P.O.Box4086, DURBAN 4000 P.O.Box 12196, CENTRAHIL - P.E. 6006 Leader in Distance Learning visit us on the Internet and enrol direct: http://www.intec.edu.za/ or e-mail: [email protected] 3 077E 1998 STUDENT'S GUIDE TO HIG R DUCATIO IN SOUTH AFRICA WITH OCCUPATIONS, STUDY OPPORTUNITIES, BURSARIES
Visit our web site at http://www.careers.co.za
4 1998 STUDENT'S GUIDE TO HIGHER EDUCATION IN SOUTH AFRICA WITH OCCUPATIONS, STUDY OPPORTUNITIES, BURSARIES
611
Compiled by the Human Sciences Research Council Acknowledgements
The HSRC gratefully acknowledges all those institutions who contributed to this guide by sending their information promptly. Without their co-operation the compilation of the guide would not have been possible.
A special word of thanks to Professor Zach Nel of the Rand Afrikaans University for his assistance in revising some of the content, his valuable comments and his support.
THE AUTHORS
© Copyright 1998 by the Human Sciences Research Council
Although all the information in this book has been compiled with great care, the HSRC does not accept responsibility for any loss or damage that may arise from the reliance of any person upon the information this book contains.
ISBN 0-7969-1863-5
Third edition, first impression 1998
Published by HSRC Publishers Private Bag X41 Pretoria 0001
All rights reserved. No part of this publication may be reproduced or transmitted in any form or by any means, electronic or mechanical, including photocopying, recording or any information storage and retrieval system, without permission in writing from the publisher.
Compiled by the Unit: Human Resources Information and Development, Human Sciences Research Council. Director: Elize van Zyl Information compiled and edited by Helmien Craemer, AnnetjieVerster, Renate du Toit and Derek Davids 6
Cover design by Alta Benadie Database pages and indexes automatically typeset using software developed by Riaan van Rooyen and Vaughn Cleminson of Ice Logic, Johannesburg Imaging of database pages and indexes by Graphic Scan cc, Johannesburg Printed and bound by National Book Printers, Drukkery Street, Goodwood, Western Cape Contents
PREFACE ii LIFE PLANNING OCCUPATIONS Introduction How to use this section 7 Details of occupations 8 Index according to occupation 41 UNIVERSITIES Introduction 43 How to use this section 43 Key to abbreviations 44 Details of courses 45 Index according to field of study 63 TECHNIKONS Introduction 65 How to use this section 65 Key to abbreviations 66 B.Tech. Degrees and National Higher Diplomas 67 Details of courses 70 Index according to field of study 96 PRIVATE COLLEGES Introduction 97 How to use this section 98 Key to abbreviations 98 The Association of Private Colleges of SA code of ethics 99 Details of courses 101 Index according to field of study 115 TECHNICAL COLLEGES Introduction 117 How to use this section 117 Key to abbreviations 118 Details of courses 119 BURSARIES Introduction 141 How to use this section 141 Details of Bursaries for Any Field of Study 142 Details of Bursaries for Specific Fields of Study 174 Index according to Field of Study 228 Index according to Institution 235 ADDRESSES Universities 242 Technikons 243 Private Colleges 243 Technical Colleges 246 Agricultural Colleges 252 Nursing Colleges 252 Teacher Training Institutions 254 Preface
Unemployment is a reality that will remain with us for the foreseeable future. However, research shows that in South Africa, as in most other industrialized countries, the demand for people with high-level skills is rising constantly. Postschool education and the development of job-related skills are thereforesome of the best ways of increasing one's chances of securing employment. The Guide to Higher Education forms part of a series of products developed by the HSRCto assist school-leavers in making informed decisions on their future careers. By publishing this guidewe want to en- courage school-leavers to improve their qualifications and skills before entering the labour market. The 1998 guide contains information on more than 2 200 courses offered at institutions of higher edu- cation in South Africa. When compiling the information it was interesting to note the changes in the provision of higher education. New education providers are entering the market, new coursesare being designed and the content of existing courses is being adapted to meet the needs of the labour market. This emphasizes the need for up-to-date information. Regular users of the guide are therefore encouraged touse the most recent editions of the publication, which is updated annually. The cost of higher education is increasing every year. Bursaries can assist in alleviating this burden for students and parents. The guide contains information on approximately 1 200 bursaries available for studyat the various higher education institutions in the country. A new addition to the publication is the short descriptions of a number of occupations that require higher education. This was added because of the need expressed by users for career information linkedto in- formation on study opportunities. We hope that this information will make a useful contributionto career guid- ance. To all students who intend enrolling for higher education in 1999, we wishyou success in your endeav- ours. The time, money and energy that you are about to invest in your education will without any doubt be a sound investment.
Elize van Zyl DIRECTOR: HUMAN RESOURCES INFORMATION & DEVELOPMENT HUMAN SCIENCES RESEARCH COUNCIL
ii Life Plannin
YOUR GUIDE TO CHOOSING HIGHER EDUCATION IN SOUTH AFRICA INTRODUCTION Do you view the choice of a career as simply a process of matching an individual and an ideal career? Consider this view carefully. Some of the incorrect implications that stem from it are the following:
You are only suited for one "ideal" career a match that requires a "perfect" fit between your characteristics and the demands of the career: there are enough careers available it is just a matter of choosing the "right" one; you have only one opportunity to make a choice a choice you are supposed to commit yourself to for the rest of your life: you must first make your career choice - and then you can build the rest of your life around that choice; you need training only at the initial stage of the career of your choice -training that will be sufficient for the rest of your working life.
When considering these statements, you will probably realize that the matching model has made people very anxious about making the "one big correct choice". Another disadvantage of this model is that it generates the expectation that there are enough careers available for everybody and that careers and organizations are stable phenomena. Why has the mindset of one-job-for-life become outdated? In the age we are living in, known as the information ace, many of the traditional work practices. jobs and employment patterns are disappearing.Although job titles still exist, organizations now place less emphasis on careers and greater emphasis on the tasks and assignments that need to be done. Unemployment is widespread and life -long careers have to a large extent become something of the past. Virtually all employees will have to acquire specialist skills to keep themselves abreast of the latest developments in their field and indispensable in the workplace. In a certain sense everyone will have to become an entrepreneur. It is therefore expected that people will change jobs more frequently. There will be more temporary workers than permanent workers. The new world of work will include frequent transitions, with contracts and consultancies being the norm.People will experience more stress because of the insecurities that accompany having to cope with changes on a ongoing basis. This means that your initial career will probably not be the only time you have to make a career choice.In the future you will have to continuously develop new skills; some of you will even have to go right back to the beginning and choose a new career in order to meet the demands of the changing world of work.It is because of this that an alternative orientation - other than the one-job-for-life-mindset - will be useful to you. This alternative approach is known as the life planning approach.
LIFE PLANNING APPROACH
The life planning approach offers you a broader perspective on how to manage your many life decisions. Choosing a career is one example of a life decision. This approach draws on some elements of the traditional view, but it goes fur- ther in thatit incorporates the link between individuals, families and communities.It is a holistic approach because it addresses everyone's need to be a whole person. and it brings the many aspects of life together.It is not meant only for school-leaversadults also find it very useful. The best way to describe the new approach is to discuss it in terms of the critical tasks that you have to cope with. These critical tasks include the following:
understanding, yourself finding work that needs to be done choosing appropriate education and training weaving your life into a meaningful whole valuing multiculturalism managing personal transitions exploring spirituality and its connection to work
9 Life Plannina 1 Please keep in mind that you do not have to complete the first task before movingon to the second one. What is impor- tant though, is that you must be able to see the connection between the different tasks andto see them within the context of a lifelong process of being involved with work. As lifeprogresses, and our needs and the world of work change,we will need to reconsider these tasks. A more detailed explanation of the tasks follows:
Task One: Understand yourself
At this stage you may be confused about making a career choice because of theever-changing nature of work. A good starting point, however, is to answer the question "Who am I?" A few factors thatyou may wish to take into considera- tion in answering this question are your personality, interests and skills.
Personality
It is said that people are most happy doing work that isan expression of their personalities.By doing some self- exploration, you will be able to identify your personal likes and dislikes;you will be able to focus on jobs that you will feel comfortable with and you will be able to concentrateon types of activities that will give you the greatest job satis- faction. For example, if you are an extrovert you may like to work with people,or do work outside the office. On the other hand, if you are an introvert you may prefer to do work that allowsyou some solitude and quiet times for reflection. Interests
Interests are things you like to do. In thinking about your interests, remember thatthey may only be hobby oriented. An interest may also reflect a desire for status rather thana genuine interest in the actual nature of the work, for examplean interest in medicine or law. There is a difference between being good at something and being interestedin it.You may find it easy to do mathematics although you don't enjoy the subject,or you may like art, but are not good at it. In such cases you may have to think very carefully before deciding on a job in that direction. Ifyou have ability in a certain field, but not the interest and you wish to capitalize on your ability, youmay have to reach a compromise between the two. For example, ifyou are good at science and technical subjects, but enjoy working with people rather than things,you may consider becoming a teacher or lecturer in the science or technical field. Skills
Everyone is good at some things and not so good at other things. Manypeople believe that intellectual ability is the only skill that counts in one's work and learning activities. We thereforeoften think about our abilities in terms of school marks - but abilities actually involve more than just school marks. There are things that we are good at around the house and inour free time that can be relevant to certain jobs, for example holding leadership positions in the community, cooking,singing, playing an instrument or fixing things. These are skills that are just as important as school subjects in obtaining work and makinga success of a job. Task Two: Find work that needs to be done
In the past, school-leavers were very unrealistic about their job choicesas they based their preferences solely on their so- called psychological profiles without really taking the demands ofthe job market into consideration. While it makes good sense to answer the question "Who am I?" it is justas important to answer the question "What work is available?" To answer this question you need informationon available jobs. You can get this information by consulting newspapers and magazines that advertise jobs, or by talking toas many people about their work as possible. Visit different places of work and consult with counselors and personnel agencies. Bear in mind that South Africa is now also part of the international jobmarket. In terms of your job hunt you must think and act locally and globally. International economic trends nowadayshave a major impact on the local job market and you should therefore take cognizance of such trends. Life Plarining (continued}
Although intelligence does play a role in choosing and obtaining work, this single factor has been artificially overemphasized in the past. Motivation, showing responsibility and the willingness to work hard, also play a vital role in achieving success. Consequently, less intelligent people who work hard and make good use of their potential are more likely to be successful than more intelligent people who do not apply themselves. Obviously, however, certain minimum levels of ability are required for certain fields of work or study.
Task Three: Choose appropriate training and education
Be well prepared to do the work of your choice. The best preparation is proper education and training. Increasing im- portance is being placed on learning to such an extent that we now speak about lifelong learning. Make sure about the qualifications required for the work of your choice, and in this regard you will find this book very helpful as it gives an overview of educational and training opportunities. There is a wide variety of study opportunities to choose from. These include study opportunities at universities, technikons, technical and private colleges as well as occupation-specific educational institutions, such as agricultural, nursing and teacher training colleges. In today's competitive job market, you will greatly enhance your chances of find- ing employment if you acquire specific, marketable skills through education and training. This book is therefore aimed at giving a comprehensive overview of study opportunities at South African educational and training institutions.
Before you enroll for a course, evaluate the course in the following ways:
Obtain a detailed curriculum from the institution so that you can get an indication of the subjects and topics that are covered. Find out how widely recognized the qualification is in the world of work by asking various employers Talk to people who have completed the course to find out how useful they found it. Try to establish how the training or educational programme you intend following will fit into the new national quali- fications framework. In certain professions, an authority or professional body controls the standard of entry into the profession by control- ling the qualifying courses.Ensure that the course that you choose is in fact recognized by the professional body concerned.
Although there is some overlap between training and educational institutions, it is useful to understand the nature of the different institutions. The following brief description outlines some of the differences between education providers:
Universities
Traditionally, universities provide a broad general background to subjects and are more theoretical than practical. The aim is to provide an understanding of fundamental concepts in a particular discipline. Admission to a university requires a minimum of a Senior Certificate with Matriculation Endorsement.If you are over 23 years of age and have a school - leaving certificate you may, with the necessary approval, also be admitted to a university. Many of the degree courses offered at South African universities require specific school subjects and a relatively high level of achievement in those school subjects before a student can be admitted to such courses. This publication spells out the entry requirements for and duration of study for all degree courses at our universities. Please also bear in mind that for certain courses there are only a limited number of openings available and students must therefore be pre- pared to undergo a selection process. Since most of the universities have early closing dates for applications for some courses, you should make timely enquiries about these dates.
Technikons Technikons are training institutions that provide career-oriented education of a high standard. You would therefore enrol for a course that provides vou with theoretical knowledge as well as practical know-how and skills. Technikons strive for a balance between theory and the application of theory in real work situations.
Life Planning 3 Life Planning (continued)
To acquire skills that are immediately useful to the employer, you have to spend part of your training gaining theoretical knowledge at the technikon and the other part of your training at the work place, learning to do the practicalaspects of the work. You need at least a Senior Certificate (Std 10/Grade 12). or equivalent, to be admitted toa technikon. Technik- ons offer a wide range of courses that lead to a certificate, diploma, higher diploma as well as Bachelor's, Master's- and Doctoral Degrees in technology in selected fields of study. The nature and duration of thecourses and the entry require- ments are also given in this publication. As in the case of universities, you must apply at an early date for admission. In many instances selection also takes place.
Technical colleges
These are training institutions that equip studentswith knowledge and skills that prepare them for specific tradesor occupations. Here you learn by doing things that will enable you to carry out the particular job at the end ofyour training. Studies at technical colleges are open to individuals who have passed at least Grade 9 (Std 7).In some courses, however, you may be required to have passed a higher standard, particularly in mathematics.Technical colleges usually offer technical, commercial, arts and cultural enrichment courses. These courses are referred toas National Technical Certificates (also known as N Certificates) and range from N I to N6.
Private colleges
You may be surprised to know that private colleges are the largest single sector providing training and higher education to students in South Africa. During the course of last year more than 350 000 students were registered for variouscourses at private colleges. Admission requirements vary from a matriculation certificate to specified, usually pre-matriculation minimum educational requirements. For courses aimed at the development of basic skills,no formal educational requirements other than a minimum level of numeracy and literacy are required.In some cases, qualifications attained through completing such courses lead to admission to educational opportunities at a higher level. Many private colleges offer face-to-face tuition for UNISA degrees, which enablesyou to obtain a recognized degree in a small class environment. Other private colleges offer a wide range of skilled-based, work-relevant diplomas in association with professional institutes and associations. The courses are practical, recognized and highly effective. The advantages of enrolling at private colleges are that they offer tuition in small classesor groups, and that they oftencontract part-time lecturers with outstanding practical experience in their relevant fields.Before enrolling at a private college make sure that it is acknowledged and reputable by establishing whether it isa member of the Association of Private Colleges in Southern Africa (APCSA).
Task Four: Weave your life into a meaningful whole
When making a career choice remember that people have different roles to fulfil in life. Some of themost important life roles concern love (family and parenting), labour (work), learning (formal and informal education and training) and leisure (sports activities, etc.). In your planning, try to give recognition to the relationship between the different roles and somehow try to find a balance between them. Only you can find the balance that is meaningful foryour life, but keep in mind that paid work, which provides a minimum standard of living, is essential before other rolescan be fulfilled with satisfaction. It is much easier to choose an occupation than to plan your life together with somebody else,or with a family (of which there are now a number of different types in South Africa). In the past,many people did not see the connection between their work and their family life, which frequently led to family breakdowns. A major trend in the job market today is that more women are entering the market. Contrary to popular belief, women seem to enjoy different life roles.
12 Life Planning Life_lantiing(c_ontkilued)
What can you do to find a greater balance between work and family? Here are a few tips:
Make greater use of home-based work. If possible, create more flexible working hours. It is not degrading for men to accept a greater family role. Do not regard a person's work-family choice as a one-time career decision, since family and career orientations change over time.
Task Five: Value multiculturalism Another critical task is to deal constructively with differences. South Africa is made up of diverse cultures and the world of work demands an understanding of and respect for people of other cultural orientations. Training in intercultural workshops can develop interpersonal and communication skills that will help you to deal with cultural differences.
Task Six: Manage personal transitions
Personal transitions refer to the changes you need to make in your lifetime. They can be short, sharp changes, entailing a journey into the unknown, often requiring the courage to take risks and the ability to cope with fear. Examples are losing a job, being transferred or promoted, changing to another organization. retiring, etc.
How can you master personal transitions? There is a three-step model that proposes the following:
I. Be aware of the approaching change. Place yourself in a position where you can identify your transition. Can you describe the change in your own words? Where are you in the transition process? How does it change your roles, routines and relationships? 2. Take stock Assess your potential resources for coping with your transition. In identifying your resources think about yourself. your situation, your support network and strategies. 3. Take charge You can take charge by selecting appropriate coping strategies and developing an action plan. Try also to profit from change by increasing your options, understanding and control of what is happening to you. In order for you to cope with your entry into your first job or to make a job change, you need to take opportunities and obstacles into ac- count. Opportunities are factors in our lives that make it easy for us to achieve certain things. They count in our fa- vour, for example good school marks or previous work experience. There are, however. also other factors that con- stitute barriers and prevent us from achieving what we would like to achieve. Such obstacles include financial prob- lems, wrong school subjects, or insufficient work skills.
Your plan of action should exploit opportunities and find ways of overcoming obstacles. One of the obstacles you may need to overcome is a lack of training or education. In planning for this you will have to start well in advance and attend to the following:
Obtain as much information as possible about the job that you are interested in and the qualifications and skills needed to do the job. Write to the various educational institutions to obtain information on courses. specific admission requirements and dates for applications. Apply and return application forms in good time. Find the addresses of institutions that can offer financial help. If possible, visit the educational institutions offering the courses you are interested in.
i3 Life Plannina 5 mita (condi')icedI Task Seven: Explore spirituality and its connection to work iu
Only in the past decade has spirituality become associated with careers. Spiritualitycan refer to beliefs and a worldview it does not necessarily imply organized religion. Sometimes spirituality is used to referto the core of a person from which meaning, self-understanding and life understanding are generated. Itcan also be seen as the deep integration of all understanding, wholeness and a sense of the interrelatedness of all life. How doyou rate yourself on some of the follow- ing work values?
Security Money Advancement Independence Creativity Relationships Self-expression Variety Power Achievement Social contribution Service Leadership Personal growth
For many people, values are a substitute for spirituality as a guiding force in their lives.Values are beliefs and moral principles that determine how you view your life, what is important toyou, what you regard as right and wrong and what kind of person you are striving to be. Values help to identify our most important needs andprovide a meaningful way to explore our spirituality. Values give meaning to life and help clarifypurpose.
It is appropriate to end this discussion with a quote from Matthew Foxon his explanation of the connection between spirituality and work:
Life and livelihood ought not to be separated but to flow from thesame source, which is the Spirit. Spirit means life, and both life and livelihood are about living in depth, living with meaning,purpose, joy and a sense of contributing to the greater community. inticiduCtiott,i'
The career environment (workplace) in the 21st century will be different to today's. Many writers have reported that stable careers will not be the norm in the future.These changes in companies, the downsizing of core groups of employees in organisations, the greater use of temporary workers, and the rise in global unemployment must be considered before you make any choices! It seems that the traditional concept of an employee working for a firm, doing well and experiencing ongoing job security and satisfaction, has been replaced by a new concept based on continuous learning and multiskilling.It is therefore important to note that
you will have to drive your own career; the ultimate goal of the career will be psychological success (feeling of pride and accomplishment); you will have to continue learning; the demand in the labour market is shifting fromknow-howto learn-how; you will have to develop the competency to adapt and develop self-knowledge; learning how to learn will be very crucial.
REMEMBER TO THINK ABOUT THIS WHEN YOU CONSIDER INFORMATION ON OCCUPATIONS AND BEFORE YOU MAKE A FINAL DECISION!
y-^ Owla. s OW?'"
Information on occupations is listed according to fields of interest. The section gives a short overview of typical occupations that require higher education. Use these descrip- tions to decide on the skills with which you want to equip yourself. Use the alphabetical list of occupations at the end of this section to trace the occupation in which you are interested. The index will refer you to the relevant page number.
i Occupations 7 process to ensure that work is progressing as it A career in ceramics will appeal to those who enjoy should. creating artistic solutions to practical problems. This Daft' iletimigve career involves working with one's hands and ART TEACHER handling various materials and the ceramist must master a number of skills including day selection and ACTOR / ACTRESS Art teachers help pupils to develop the knowledge, skills and understanding necessary to work in various preparation; forming the day by hand-sculpting, Actors use speech, make-up, costumes and gestures fields of Art. wheel-throwing, coiling, press-moulding and slip- to portray characters in stage, films, television and casting; decorating articles by texturing, carving or radio productions. They work in schools, technikons, universities and painting; and firing by any one of a number of colleges. Art teachers plan lessons according to a methods which range from the extremely simple to To find work, they attend auditions where they curriculum and select the materials needed. They the highly sophisticated. demonstrate their acting ability to those in charge. If prepare and assign class projects and evaluate the hired, they must attend long rehearsals and memo- progress of their pupils. Art teachers may also CLOTHING DESIGNER rise lines and cues. In addition, they may have to arrange trips to art museums or exhibitions and Clothing designers apply their knowledge of style, attend special classes (in dancing or singing, for arrange pupil exhibitions. A school Art teacher will line, colour, proportion and fabrics to the task of example) if this is required for the part. also attend staff meetings and perhaps parent- designing clothing. The industry covers a broad teacher meetings in the evenings. Art teachers are spectrum and designers may slot in at various levels Travel may be required when plays go on tour or sometimes expected to teach another school subject of creativity. filmed productions are to be shot in particular in addition to Art. locations. Many actors/actresses must rely on other It is a very competitive field and only a few designers jobs while waiting for acting engagements. ARTIST become trend setting fashion leaders, who are drawn from the ranks of couturiers and custom-designers. ANIMATOR Artists create a variety of works of art using the media they prefer, such as oil paint or water colour. They Most clothing designers are employed by factories An animator draws a series of sketches or pictures, decide on a subject or idea for their work and select manufacturing garments for the mass market each showing a brief portion of an action, which is the supplies they need. They may have to prepare photographed to give an effect of continuous the supplies e.g. by stretching the canvas or mixing Fashion styling falls into this field, too, and, entails movement when run through a projector. paints. Using their own methods they create the the selection and adaptation of high-fashion garments for lower-budget production for the mass work they have in mind. Animators themselves make only the key drawings market Designers may also specialise in certain types referred to as 'extremes'. These drawings on the Some artists create works for their own satisfaction of clothing, such as footwear, hats or sportswear. animator's underlit drawing board are necessary for while others undertake commissioned works or showing the action-spacing instructions that guide portraits. Many artists teach art in schools or other COLOUR CONSULTANT the animator's assistant in doing the intermediate educational institutions or give lessons in their homes A colour consultant is a person who has exceptional drawings needed to complete the depiction of the or studios. Most artists cannot support themselves skills in using colour to maximum effect. His primary action. solely on the sale of their work but have to hold down function is to advise interior designers, architects, other jobs too. textile manufacturers and private domestic dients on When all the drawings have been completed and the effective use of colour. assembled, the action is checked. Flipping through Art is a reflection and an integral part of human the pages will reveal any error in the action sequence, history, progress and culture. Artists today, as in the Colour consultants are often asked to co-ordinate the and the relevant drawing can then be corrected. The past, reflect, record and comment on our world, our colour scheme for a whole job. The degree of drawings are then photographed in sequence. Sound beliefs, our moments of magnificence and failure, our freedom that they have will depend entirely on the effects are mixed with speech on the dialogue track fears and ambitions. The artist skilfully gives physical client. It is therefore important that a colour consult- and combined with the optical negative for the final expression to a vision so that the observer can feel ant listens to the client's instructions carefully and composite print. and understand the world in the same way. interprets them accurately. ARCHITECT CARTOONIST In addition to familiarity with colour theory, colour The architect is professionally trained to design and consultants require sound technical knowledge of Cartoonists prepare satirical or humorous cartoons decorate buildings, with a view to utility, durability, dyes, fabrics, fabric production processes, paints and for publication in most of the visual media such as convenience and aesthetic appeal. Architects use surface treatments (such as different wall and ceiling newspapers and magazines. their knowledge of construction materials and finishes). methods, and of architectural techniques to design Cartoonists may create their own characters and may and oversee building construction. write their own scripts or illustrate the scripts of COSTUME DESIGNER others. All cartoonists need extensive art experience The task of a costume designer is to design the An architect will discuss the purpose, requirements and many require writing skills too. Political cartoon- costumes for live performances and television and and cost of a project with the client and then prepare ists also have to keep up to date with politics, film productions. It is the costume designer's drawings. If these are accepted, the final design is economics and social conditions. Television cartoon- responsibility to ensure that the period of the prepared together with working drawings for the use ists should be very versatile and able to produce performance is accurately reflected in the costumes, of contractors. The architect may assist the client in anything from comic flash cards to animated right down to the last accessory, induding hats, selecting a contractor. During construction, the cartoons. shoes, gloves and even hairstyles. architect may visit the site to ensure that the design is being followed. Architects may also help in selecting Cartoonists specialising in advertising must be Costume designers need to be able to work creatively building sites, preparing cost and land-use studies, familiar with selling and advertising techniques and within certain restrictions. Some period costumes and carrying out long-range planning for site trends as well as with art techniques. The work of a need to look heavy, yet should be designed in such a development. cartoonist can be very stressful because of the need way to allow the actors to move freely. This is to work to deadline.This is especially true of a especially important when action such as dancing or ARCHITECTURAL TECHNOLOGIST political cartoonist working for a daily newspaper. fencing forms part of the performance. The designer An architectural technologist is the practical executor also needs knowledge of fabrics in order to create of the architect's conceptual designs. Most of his time CERAMIST / CERAMIC DESIGNER the feel of a period. is spent at the drawing board, but he is also expected A ceramist designs and produces ceramic objects to assist the architect in a number of other areas, Costume designers working for small companies will such as tableware, vases, decorative pots, wall such assite surveying-, (which includes preparing need to do the cutting and machining themselves. decorations and sculptures. The field spans a range measured drawings of existing buildings and This will be done by specialists in a large company, of creative levels from working in a ceramics factory collecting practical information relating to the but the designer needs to supervise the process and within a fairly rigid framework through producing project),the preparation of presentation drawings take responsibility for the final product. attractive pottery for the tourist and cottage industries and models for the client, detail design, landscape to the highly-creative environment of an individual design, the preparation of working drawings for the ceramist creating original ceramic sculptures. building contractor and supervision of the building
8 DISPLAY ARTIST GRAPHIC DESIGNER out research on design, creation of character, period Merchandise displayers design and install shop and Graphic designers create the original design work and make-up and hairstyles for studio dramas, live shop window displays in an attractive and eye- final artwork used for newspaper and magazine theatre and film shots. catching manner. A theme is chosen and then the advertisements. hoardings, pamphlets, posters, necessary properties (such as lights, mannequins and package designs, catalogues, greeting cards and They consider the shape of the face, the bone background scenes) are obtained or constructed and brochures. They are also involved in the television structure, the form of the eyes and the complexion installed. In addition, previous displays have to be and film industry.Here they have a major input in before applying the make-up. Special effects are dismantled. the production of advertisements, films, documentary created by tinting and bleaching the hair, making up programmes, etc. They also design book covers, and applying beards, moustaches and wigs, etc. In small shops, one displayer may perform all the calendars, letterheads and labels. They also use colouring materials, padding and tasks. while in larger shops they may specialise in prosthetic pieces to simulate wounds, cuts, scars and such activities as carpentry, painting, signwriting, The graphic designer is instructed by the employer or bruises or to create monstrous faces and hands. interior or exterior displays or administration. commissioned by a client to undertake a particular assignment, analyses the employer's or client's needs They are required to remain on duty during produc- The display artist should construct window displays and advises on the most effective methods of tions to touch up actors' make-up. A specialist in or dress counters in such a way that products catch meeting those needs, keeping market trends in mind. special effects and prosthetics may become a make- the eye of the potential buyer. The work of the up designer. display artist is thus an important part of merchan- INTERIOR DECORATOR MUSIC TEACHER dise marketing. An interior decorator designs, plans and furnishes the interiors of public and private buildings. Music teachers give instruction in instrumental DRAMA TEACHER and/or vocal music to people of all ages. They may Drama teachers instruct individuals and groups in the A decorator considers the use to which the area will teach popular or classical music to serious students techniques and principles of acting. Pupils are be put, as well as the budget and the taste of the and those who are studying music as a hobby. Some evaluated and a course of study is then adapted to client, and then sketches plans for the client's teachers give private lessons while others teach in meet individual needs and abilities. approval and modifies them if necessary. After public or private schools, colleges or universities. obtaining the client's approval the interior decorator Instruction may include diction, enunciation, voice buys the furnishings and supervises the work. In addition to teaching students to play certain development and accents as well as movement, instruments or to sing, they may teach the various acting styles and character development. Drama Decorators in shops advise buyers and executives on theoretical components: Rudiments of Music, teachers may produce and direct plays for school and style and colour trends in interior furnishings. Some Harmony. Counterpoint, Musical Form, History of public performances and this will include the interior decorators also design furniture to be used in Music (general musical knowledge and musical supervision of make-up, costumes. scenery and various settings and a few work on film or television. appreciation) and instrumentation (and orchestration). lighting. Music teachers in educational institutions may also JEWELLER / GOLDSMITH conduct choirs, school bands and orchestras.
The jeweller or goldsmith is a trained craftsman who A school music teacher will also attend staff meetings Drama teachers may also be involve in other school designs and manufactures jewellery. He utilises activities such as sport and fund-raising, and may and perhaps parent-teacher meetings in the evenings metals such as gold, silver or platinum and precious and may be expected to teach another school subject also visit pupils at home and have discussions with and semi-precious stones. Craftwork production parents. in addition to Music. They may also be required to entails the making of individual articles by hand by help with other school activities such as sports and skilled craftsmen whereas mass production entails educational tours. FASHION ARTIST the use of moulds and machines to produce articles. Fashion artists are the commercial artists who create MUSICIAN clothing advertisements for newspapers, magazines Jewellers and goldsmiths make and repair rings, and television spots. necklaces, earrings and other jewellery. They make Musicians perform for the purpose of entertaining. moulds to cast mass-produced jewellery or dies to The nature of a musician's work can vary considera- They illustrate brochures, pamphlets and catalogues. stamp it and carry out the finishing work, such as bly, depending on the field of specialisation: (1) They sketch the new fashions shown in photographs setting stones and engraving. Typical alterations and composers write or improvise musical compositions, or worn by mannequins or live models in such a way repair jobs involve enlarging or reducing the size of thus translating their own creations of melody and as to attract the attention of readers or viewers and rings, resetting stones and replacing broken clasps harmony into musical signs and symbols for others; stimulate their interest in purchasing the garment. and mountings. Some jewellers or goldsmiths repair (2) performers study music scores carefully and watches and do hand-engraving. Qualified gem- rehearse them until they are played perfectly before Fashion artists must pay special attention to small mologists appraise precious and semi-precious appearing in public as soloists, accompanists or details that may easily be overlooked, since these are stones. members of orchestras. They have to tune their the very things that may make the garment more instruments to the proper pitch and may play from attractive to the buying public. Since they constantly LANDSCAPE ARCHITECT / LANDSCAPE TECH- memory or from sheet music; (3) conductors study strive to see fashion in original and interesting ways NOLOGIST the selected music and preparing themselves to conduct a band or orchestra; (4) music teachers give fashion artists often work with advertising staff to Landscape architects or technologists design outdoor develop new approaches to promotion. lessons either at a training institution such as a school spaces to make them functional and attractive. These or privately. spaces may range in size from small privately owned FASHION DESIGNER gardens to city squares and parks. PATTERN-MAKER (CLOTHES) Fashion designers create clothes which can be produced within a certain price range and in keeping Landscape architects or technologists first study the The main function of a pattern-maker is to translate with current styles and trends. Their ideas for styles geography of the project site, examining the slope of the fashion designers design into a pattern. First of all come from scanning trade publications, visiting the land, the trees present and the distribution of the initial working sketch is made from the design. shops. travelling and observing lifestyles. shade and sun. Preliminary plans and budgets are After the pattern has been sketched and the specifi- then drawn up after consultation with engineers, cations outlined, a sample garment is made up. A Designers develop and record their ideas by making project architects, horticulturists and municipal master pattern is then prepared and the pattern is sketches. draping dummies or making patterns. officials. After plans have been approved final graded into different sizes. They select colours, fabric and trimming for their drawings are prepared showing existing and designs. Next they prepare samples or model proposed features: lists of all materials needed are Pattern-makers work in conjunction with boutiques garments which are then checked carefully for drawn up. Finally contractors are invited to submit and clothing factories. appearance, fit and quality of work and if they are tenders for carrying out the work. accepted the samples are included in their lines and PHOTOGRAPHER presented to sales personnel or private clients. Some MAKE-UP ARTIST Photographers use cameras to portray people, places, fashion designers run their own businesses. Make-up artists apply cosmetics, powder. paint or objects and events. Most photographers specialise grease paint to the faces of actors before they appear but their basic equipment is the same. Using their on stage or in front of the cameras. They also carry
Occupations 9 knowledge of design and composition, they select works closely with the director, sound and lighting images to obtain the effect they want Essentially the producer frees the director to concen- technicians and technical manager. trate on the artistic aspects of the film the two Press photographers take pictures of fires, accidents, occupations are complementary. TAXIDERMIST prominent people, sports and other subjects of A taxidermist preserves, stuffs and mounts animal interest. They do not usually pose their subjects and PROFFESSIONAL DANCER skins for display in museums or private collections they have to work against time. Scientific photogra- This term covers a range of different styles of and study collections. He uses his artistic ability and phers photograph visible objects or events, or use dancing, including classical ballet, modem, acrobatic, knowledge of the technical processes to create a special equipment to photograph information not aerobic, mime, night-club and ball-room. preserved animal that looks as life-like as possible. normally visible; they usually work in research Taxidermy methods have changed considerably institutes and hospitals. A studio photographer Many a young girl dreams of becoming a ballet through the ages. works in a studio and takes photographs for pass- dancer. The dream, however, rarely encompasses the ports, identity documents, formal portraits and reality of the self-discipline required and the rigorous Today, extensive use is made of dermosculpture, wedding photographs. A forensic photographer and arduous ballet lessons and rehearsals every day, which entails making a plaster of Paris mould, fitting takes photographs of crime scenes-- for instance, including weekends and holidays. This is a strenu- the tanned damp skin over the cast, gluing it and the scene of a murder in order to help detectives ous career and its demand for physical perfection keeping it in place during the drying process by solve the crime. An advertising photographer takes entails a constant concern with diet, weight, fitness means of pins and various methods of bandaging. A photographs of people or objects for use in adver- and health. recent advance in taxidermy is the freeze-drying tisements. A fashion photographer usually works for method, where the animal is placed in a life-like magazines and takes photographs of models The rigorous and early training required, the short position and frozen; the moisture is then vacuum- displaying clothes. duration of a career and the strong competition for extracted from the frozen specimen. This method is jobs make this a career for the very dedicated. Ballet usually combined with more traditional methods. The The work of a photographer contains two basic training for girls usually begins at five to eight years most successful method of preserving fish, reptiles elements;the taking of a photograph and its of age and for boys between ten and fifteen. Training and invertebrates is to create a plaster of Paris mould development and printing. Photographers often in modem dance does not have to begin as early as which the taxidermist paints to look life-like. work in more than one field of photography. this. The physical demands of professional dancing force most dancers to stop performing by their late Taxidermists need to draw extensively on nature to PHOTOJOURNALIST thirties, but many continue to work in the field as achieve realistic work, for example animal anatomy, The modem photographer is a combination of an choreographers, dance teachers or artistic directors. natural poses and positions of animals and birds and artist and a scientist who has to master the use of natural-looking skin colours. They are sometimes sophisticated equipment and development processes RADIO PROGRAMME WRITER called upon to do fieldwork to collect animal and bird as well as see in a perceptive way. Radio programme writers work in all areas of the specimens. radio field. They often take the news from the wire TEXTILE DESIGNER Photojoumalists specialise in one aspect of photogra- services and edit or rewrite new stories for local phy -- they photograph newsworthy events, people, broadcasters. The main function of a textile designer is to create or other illustrative or educational material for use in and develop designs which are either woven or publications or telecasts, using still cameras. They Radio programme writers also produce story scripts, knitted into or printed onto textiles. A textile designer normally have to travel to different and sometimes organising various materials and writing each story to requires artistic skill and a sound knowledge of fabric dangerous locations, for example to cover natural conform to length and format requirements. If characteristics and factory reproduction techniques to disasters or military conflicts. The photojournalist necessary, they edit and rewrite story material. Radio design exquisite and marketable textiles. needs to understand the story behind the 'on-the programme writers also create feature scripts for the spot news' - and needs to be able to portray this in a news staff and sometimes develop commercials for These designers are mostly employed by the fashion- series of photographs which form a visual statement sponsors. Radio programme writers generally work fabrics and home-textiles industries. It is sometimes or essay. for radio networks while there are many freelance expected from textile designers to travel from one radio script writers. country to another to study fashion trends. Photojoumalists can also diversify into publishing photographic books, calendars, postcards and SINGER TOWN AND REGIONAL PLANNER posters. Singers perform either as soloists or as members of a Town and regional planners develop, at many scales vocal ensemble to entertain a variety of audiences. from regional to neighbourhood level, programmes PRESS PHOTOGRAPHER They interpret music using their knowledge of for the most advantageous and purposeful develop- The main function of a press photographer is to harmony, rhythm and voice. They follow or memo- ment of towns, cities and rural areas. The work of photograph newsworthy events. Dramatic front-page rise printed text and musical notation and may sing a the town and regional planner is focused on improv- news photographs sell newspapers, so press capella or with instrumental accompaniment. ing the living conditions of people. photography presents particular demands to the photographer. The pictures need to have a sense of Some singers make recordings or go on concert tours They estimate future needs for housing, business and immediacy and to portray the essence of a situation while others perform in operas, musicals or appear as industrial sites, community facilities and open spaces in usually no more than one shot. Press photogra- concert soloists. Singers may sing in films, on stage, in order to meet the needs of expansion and renewal. phers therefore need to be able to get to situations on radio and television, in night-clubs and in other They further investigate the nature and extent of quickly, since newspaper deadlines are very pressing places of entertainment. Some singers may teach and problems concerning prospective development such and the photographs have to be prepared for direct choirs or give private voice lessons. Singers are as projecting future needs in traffic and transporta- publication. The press photographer will often be known according to voice range as soprano, con- tion. They must keep up with legal issues involving called upon to produce usable images under tough tralto, bass, baritone or tenor and are often expected community development and changes in housing conditions. to be able to act, dance or play an musical instru- and building codes. ment. PRODUCER FILM AND TV Most of his work is done in an office but he also need Producers plan and co-ordinate the practical STAGE MANAGER to go out to see whether everything is done according to the proposed development plan. He works closely organisational aspects of a film or television produc- Stage managers are responsible for ensuring that with architects, engineers, economists, sociologists, tion. They set up auditions for actors and control the theatre productions run according to plan. They administrators and management. securing of costumes, props and other equipment ensure that performers are prepared and waiting in Producers co-ordinate the sound, scenes, music, the wings in time for their scheduled appearances. camera work, timing and modifications to the script. VIDEO EDITOR They instruct the actors and crew regarding the time- They also ensure that set changes, sound and lighting The main responsibility of a video editor is to turn table and rehearsals and see that the production runs run according to plan. This is an extremely responsi- rough video footage into a finished and polished to schedule. Ensuring that the production does not ble position with actors and technicians reporting to video ready for screening on television. Working very run over budget is also their responsibility. They the stage manager, who is assisted by an assistant closely with film producers, video editors use their negotiate staff contracts, authorise the payment of stage manager, a props master/mistress, stage knowledge of continuity, camera angles and televi- salaries and arrange publicity for the production. hands, a wardrobe master/mistress and dressers and sion pacing-, to create mood, pace and timing. The StudentPlan- we can't take the hard work out of studying but we can take the hassle out vice fees provided I use Standard Bank ATMs. of banking. What's more, my accounts are linked elec- My folks said I had it really easy, that in tronically and with my AutoBank card I can their day things were tougher. Huh, there I do my banking at any time, anywhere at any was, filled with dreams, burning with ambition ATM. I'm impressed. In fact next year I plan to and working every night. And with this sinking make use of their vehicle finance facility at a feeling that I would never have enough money preferential rate. to do it all. There's only one problem though; all My folks bank at the Standard, so this means my folks were right! that's where I went. Boy was I surprised. The For more information call 0800 12 1000. Standard don't just offer student loans for university and technikon studies, they offer a complete package. g Standard Bank I got a Student Loan at a preferential rate and a Student PlusPlan Account that STUDENTPLAN- earns more interest as I save, free of any ser- With us you can go so much further.
13 SBSA 311929 At the center of people development
,,,....2=.0111111111
r.
The Professional Education and We also offer specialist certificates Training Department of the IPM in Personnel Management, Industrial provides more than a certificate or Relations and Training Management. diploma, it creates opportunities for We also offer leading-edge training continuous learning through programmes and practical workshops structured training and development on topical Human Resources trends programmes and by facilitating and corporate solutions through networking and advancement customized in-house training. opportunities. If you'd like to know more about these courses call us on (011) 482-4970. In the Education field the IPM Diploma inPersonnel Management is recognized and accredited by the Human Science Research Council on a Matric plus three year level (M+3).
2 0 .Aeiul owl 110.0.
Fil&Tele" "shin aic M ediaSno
yti f
-.01111111k
. =a,
& Pro Film & Televiiion Production Tec,iq Speciial Effeets, Decor Painting an Animation & Televis
Drama Presentation
co \ Tel0.' 66 1,. Fa- 300 .0- LEnt pi.rsity.co.z f --- STUDENT'S GUIDE TO STUDENT'S HIGHER EDUCATION Guideto IN SOUTH AFRICA 1998 HIGHER EDUCATION IN SOUTH Everything a school leaver needs to know about AFRICA WITH OCCUPATIONS. OPPORTUNITIES, STUDY making a decision to get tertiary training BURSARIES Information on how to choose a career Short descriptions on occupations according to field of interest Comprehensive course information on universities, technikons, technical and private colleges Address details for all categories of tertiary institutions A list of bursaries available Useful indexes to occupations, fields of study and bursaries Information updated and published annually
STUDENT'S GUIDE TO DISTANCE EDUCATION IN SOUTH AFRICA 1998
A comprehensive guide to distance courses and institutions Comprehensive course information for distance learning institutions Address details for distance learning institutions Useful indexes to fields of study and distance institutions showing courses listed Information updated and published annually
VISIT S S IV E
Re6Ulcir updatifig:of tourseinfirm'ation, National and interricitionaledUiationlin searches cind'burscirie,s,
Databases for Guides and web site compiled and maintained by theHSite 22 video editor cuts footage that is not going to be used The third area of adult education is that of skills their work. Many dergymen engage in community, and ensures that the film still flows sensibly. He or development. Skills training ranges from personal- civic, educational and recreational activities sponsored she also generates digital effects, adds graphics and growth skills, such as assertiveness and time by or related to the church. They also have adminis- titles and prepares the soundtrack for audio final management, to skills required for economic survival, trative duties such as writing testimonials for mixing. such as home industries and job-hunting. People in members of their congregation. Some of them are the caring professions -- nurses, social workers and ex-officio members of clerical bodies where the joint WEAVER psychologists are ideally suited to carrying out this activities of the church are managed. There are two types of weavers: hand weavers and type of training, but such a background is not operators of mechanised weaving machines. Hand essential since these skills can be taught by anyone DRAMA TEACHER weavers weave cloth on table or floor looms. They who has had to develop them to run their own lives. see page 9 need to have sufficient knowledge of the weaving process to enable them to control the quality of the The fourth area in which adult educators work is that FITNESS / HEALTH CONSULTANT of enrichment, where people join classes in subjects final product. Hand weavers can work either to Health and fitness consultants assess the physical specific instructions in a factory-type setting or they such as dancing, flower-arranging and creative writing purely for personal enrichment. Adult health and fitness levels of their clients and, on the can work independently as artistic weavers, creating basis of this assessment, offer advice on lifestyle their own designs. educators in this area are people who have made a special study of a subject or who have achieved changes to improve fitness and general health and well-being. Weavers who operate automated weaving machines success or recognition in a certain field. in textile factories need to acquire expertise in ARCHIVIST In the initial evaluation, the health and fitness operating the automated machinery. The tasks they consultant will conduct physical tests such as perform include: observing the machine-weaving An archivist is responsible for the care and preserva- measurements of pulse, heart rate and weight. The process for defects; removing defects in the cloth by tion of valuable materials which could include consultant will also evaluate the client's general state cutting and pulling out filling; examining automated documents, maps, photographs, microfilm, films, of well-being by inquiring into such matters as stress, looms to determine the causes of stoppages; video tapes and sound recordings. The archivist also eating habits, illnesses and physical activity. The marking or cutting cloth to specified lengths and; has to store these materials in such a way that they consultant will then recommend a lifestyle plan for replacing bobbins on non-automatic looms. are easily accessible. the client which will address aspects such as diet, an exercise programme and stress management. WOODCARVER Since many of the materials in an archivist's care are Although much of the work previously done by hand irreplaceable, proper preservation of them is probably HOME ECONOMICS TEACHER is now done by machine, some tasks still require the the most important part of the job. Archivists need to keep abreast of the latest techniques to guard against Home economics teachers instruct individuals in skill and ingenuity of the woodcarver. Woodcarvers subjects related to family living and home-making. carve beautiful images and designs into selected various hazards. They need to file and index the material so that it is easily accessible to researchers. They teach nutrition, clothing and textiles, family pieces of furniture. They design and carve lyre- relations and similar subjects in schools, colleges, backed chairs, ball-and-claw feet for tables and Record management, (control of material kept in its office of origin), and regular evaluation of the material technikons and universities. Some of them provide chairs, ribbon-festooned aprons of tables, drawer extension courses on an informal basis to women, fronts of chests, tea coasters and the like. to determine whether it is of temporary or permanent significance is also part of archival work. Another churches, welfare and youth organisations, immigrant groups and government departments. Such exten- Woodcarvers mark with chalk those pieces of wood aspect of the job involves the publication or dissemi- nation of information to scholars and other potential sion courses involve lectures, demonstrations, which must be cut away. Here the woodcarver must exhibitions and group discussions. work carefully so that he does not cut away too much researchers in order to familiarise them with the wood. They lay the article on a workbench or clamp archives in the archivist's custody. it firmly in a bench vice and slowly cut and chisel away ART TEACHER Home economics teachers are also called upon to set the wood. They finish the articles by sand papering and mark examination papers, and may be required them carefully and staining or varnishing them. see page 8 to participate in school fund-raising and sport activities and in parent and pupil liaison. BEAUTY TECHNOLOGIST / SOMATOLOGIST Somatologists (beauty technologists) are concerned HOME ECONOMIST with the treatment and prevention of disorders Home economists are concerned with domestic living involving the skin and body. They are interested in and they work to improve products and practices that ADULT EDUCATOR the overall health and well-being of people. The affect almost everyone in our society. activities of a somatologist include:- assessing and There are essentially four different areas in which an treating skin and figure problems;recommending adult educator works. The first is that of professional Most home economists teach in various types of and carrying out slimming treatments and exercises development where qualified workers are taught new educational institutions. Some work closely with the in conjunction with a diet recommended by the approaches, informed of new developments and media to promote products. Others conduct research client's doctor; - cosmetic sales;specialised make- legislation or shown how to improve certain aspects in an area of personal interest within the broader field up techniques; - and permanent and temporary of their jobs. Large corporations often perform this of Home Economics. They also work as interior removal of unwanted facial and body hair. They use type of adult education through their established decorators and in the catering field. The nature of the massage and modem apparatus in close co- training departments. Adult educators working in this work depends on the type of post the home econo- operation with dieticians, dermatologists and medical area have usually become experts in a particular area. mist is employed in. practitioners. The second area is that of adult basic education and LIBRARIAN AND INFORMATION WORKER Interest in the holistic approach to body and mind has further study where adults attend literacy classes and led to recent changes to the curriculum of this course. The basic function of the librarian and information study part-time or full-time to improve their The course now places greater emphasis on physical worker is not only to select, acquire and organise a qualifications. Such courses are offered by commu- education, nutrition and stress management and less vast amount of information, but also to make this nity centres, religious institutions, non-governmental on aesthetic treatments such as make-up. information and these sources available as efficiently organisations geared to this purpose, professional as possible and wherever needed. institutes, business colleges, universities and CLERGYMAN / MINISTER technical colleges. Literacy may be taught by anyone Libraries have the following departments: ordering or who is competent in the language being used and Clergymen or ministers attend to the spiritual and acquisition, cataloguing and classification, lending or who has teaching ability primary-school teachers moral needs of their congregations. They deliver circulation and information or reference. In large are ideally suited to this task. High-school teachers sermons, lead services of worship and administer libraries and information services the various tasks are needed to prepare students for Std 8 (Grade 10) such sacraments as baptism and holy communion. may be handled in separate departments, but in small or Matric (Grade 12) and educators teaching career- They conduct weddings, funerals, confirmation and libraries all the work is usually performed by the same related courses need to have passed the courses other religious ceremonies. They provide instruction staff. themselves and have worked in the appropriate to individuals interested in joining the church and fields. counsel those seeking guidance. Visits to the sick, Every library has to select the books and other elderly, handicapped and bereaved are also part of material it needs and then order whatever is needed
Occupations 23 11 from local or foreign sources. Upon receipt the They advise teachers and parents on ways to help who are learning disabled, blind, deaf, or mentally or material is handed to the cataloguing and classifica- these children. physically handicapped. tion department where it is carefully analysed to determine its contents so that it can be indexed SCHOOL COUNSELLOR Special education teachers observe pupils individually properly. The primary responsibility of a school counsellor is to so as to understand each one's psychology and supply high-school children with career information, characteristics. Specific teaching techniques and A direct service to the user consists of the answering and to help them gain the self-knowledge and equip curricula using special teaching skills are then of inquiries. The staff responsible for reader advisory them with decision-making skills which will allow selected and applied so as to meet each pupil's needs services could be known as reference librarians them to make appropriate career choices. Counsel- and suitable materials and equipment are selected (attending to general reference questions), subject lors devote a large part of their time and energy to or developed in each case. Special education teachers reference librarians (responsible for a related group of administering and evaluating aptitude tests and must also observe the behaviour and progress of subjects) or subject specialists (responsible for interest questionnaires, the results of which they pass each pupil and report on this to the school authori- services to readers to a particular subject). Books and on to pupils, in a suitable form so as to assist them in ties. These teachers usually work closely with the periodicals normally form the major part of library understanding their capabilities. parents of handicapped children to help them acquisitions. understand and look after their children. Another area in which school counsellors are of help There are also various libraries aimed at a certain type is in the emotional development of pupils. This can The special education teacher forms part of a broader of user, such as public libraries, university and college be done on a one-to-one basis where necessary; in team of psychologists, social workers, occupational libraries and school libraries and information services this situation the counsellor may liaise with the pupil's therapists, school counsellors and medical personnel, serving individual research institutions, government parents and other teachers. Emotional development all of whom are geared to help the pupil overcome or departments, commercial firms, organisations and can also be dealt with on a group basis with sessions cope with disability. associations. addressing issues such as drugs and Aids. Counsel- lors are also expected to initiate appropriate meas- SPORTS ADMINISTRATOR / SPORT ADVANCE- MUSIC TEACHER ures for pupils with learning problems. MENT OFFICER - see page 9 Sports administrators regulate, plan and promote SECONDARY (HIGH) SCHOOL TEACHER sporting and recreational activities. They make PRE-PRIMARY SCHOOL TEACHER The secondary school teacher educates pupils in contact with other sports organisations in order to Pre-primary school teachers lead small children in Standards 6 to 10 (Grades 8 to 12). The teacher plan and co-ordinate such activities. activities designed to promote social, physical and follows the syllabus of work laid down by the relevant intellectual growth. They also teach personal education department and the subject teachers at the They attend sporting tournaments, training courses hygiene, music, art and literature. school in order to prepare pupils for examinations. and meetings where the administrative aspects of sports meetings and events are dealt with. They They introduce children to the basic elements of Secondary school teachers teach pupils the subjects organise coaching sessions for trainers and leaders in mathematics, language, science and social relation- they have selected. They use various teaching sports and recreation, as well as special sports events ships. They organise and supervise activities such as methods and demonstrations in their lessons as well and fitness schemes. games, group activities and dramatic play acting and as audio-visual aids. They prepare teaching outlines, encourage children in singing, dancing and in the use assign tasks and correct homework and also give They may help plan and design sporting and of art materials. They see that children have rest tests in order to evaluate progress, record results and recreation complexes, and do research in the field of periods, and watch for signs of illness or other issue progress reports to parents. Secondary school training, fitness, diet, equipment and apparatus. problems. Pre-primary school teachers evaluate the teachers keep attendance records and maintain They also participate in the process of conflict progress of the children in their care and discuss this discipline and also participate in departmental and resolution between sporting organisations or with parents. professional meetings and educational conferences. individual sportsmen and women. They may coach pupils in various kinds of sports and PRIMARY SCHOOL TEACHER cultural activities during the afternoons and may be TRAINING OFFICER Primary school teachers impart knowledge to children responsible for special activities or school societies. Training officers prepare and conduct training and, by understanding their needs, guide them programmes for employees in industry, commerce, through the various developmental stages. They SOCIAL WORKER or govemment. The main aim of this training is to teach their pupils the basic concepts of mathematics, Social workers help people of all ages to cope with develop the workers' skills and to improve their languages and science. They may use audio-visual the problems caused by poverty, unemployment, productivity. aids to present subject matter. illness, antisocial behaviour and other social inade- quacies. Training officers meet with management and study In addition to actual teaching they prepare lessons job operations so as to understand the demands of according to a curriculum prescribed by the relevant Social workers practise in the fields of child and family the actual work situations for which employees education department. Primary school teachers are welfare, marriage and divorce counselling, care of the require training. They then select teaching aids such also expected to help with extra-curricular activities elderly, medical social work, psychiatric social work, as textbooks or manuals, demonstration models and such as sports, concerts, film shows and fund-raising social work with the mentally or physically disabled, visual aids, and schedule the training sessions. efforts. Teachers have to do such administrative social work with alcoholics and drug dependants, Training officers also conduct specialised training work as filling in attendance registers, keeping social work with criminal offenders, and social work in sessions, on-the-job training and apprenticeship records of children's progress and setting, and the workplace or school. programmes. They finally test the trainees to marking homework and examinations. measure progress and sometimes advise on further The social worker use various working methods, study at a technikon or university. REMEDIAL TEACHER often in combination: (1) case work - case workers Remedial teachers therapeutically assist pupils to set up one-to-one relationships with individuals, overcome their specific learning disabilities. Children visiting them to give them personal assistance and Entertainment/Performing with specific learning disabilities usually have average encouragement; (2) group workgroup workers or above-average intelligence but cannot cope organise group activities for people sharing similar arts effectively with certain aspects of school work. These problems, interests and needs the organisation of recreational activities for the elderly is but one disabilities emerge for example, as an inability to ACTOR / ACTRESS integrate letters into words, reversal of words and example; (3) community work community numbers, misspelling of words and an inability to do organisation workers identify needs in the community see page 8 arithmetic. and help plan and develop health, housing, rehabili- tation and other welfare services. DISC JOCKEY Remedial teachers usually start their investigation by A disc jockey is an announcer on a musical radio scrutinising children's work books for indications of SPECIAL EDUCATION TEACHER programme who selects the music to be played on their problems. They then test the children to verify Special education teachers instruct children who have the basis of the programme speciality and listeners' or to diagnose the problem. To remedy the inability special educational needs. This may include children tastes. Disc jockeys also comment on the music they make use of various remedial aids and methods. selected and provide listeners with interesting
12 2 4 Occupations snippets of information about some of the selections prepare the food themselves. They plan the gather information about the product or service and and recording artists involved. They may also arrangement of tables so that guests will not be its potential customers. comment on general matters such as the weather crowded as they serve themselves at buffets or sit and traffic conditions, and give time-checks and run down to enjoy their meals. Caterers may also arrange Once the objectives of a particular assignment have station promotions and competitions. Disc jockeys to hire bartenders and to provide entertainment for been determined, the copywriter and the art director sometimes interview recording artists and, depending these gatherings. team up to think out and design a campaign and on the structure of their programmes, may run decide how best the campaign objectives can be phone-in or write-in requests. Some disc jockeys Caterers own and often manage public dining achieved by communicating this particular campaign also perform at night-clubs. establishments or restaurants, dining rooms and persuasively to the target market. cafeterias in hotels, department stores, factories, DRAMA TEACHER schools and hospitals.In this context caterers, They may consult other advertising agency specialists see page 9 cooks, bartenders and chefs work as a team. and the client. Copywriters also write all types of promotional or informational booklets, sales promo- MUSIC TEACHER CHEF tional materials or merchandising campaign materi- als. see page 9 Chefs supervise and co-ordinate the activities of the other cooks and kitchen helpers who are engaged in EDITOR MUSICIAN the preparation and cooking of food. They estimate the amount of food needed, purchase the food The specific duties of editors are determined by the see page 9 supplies and check for food quality. They also plan type of employer. menus. When the food is prepared, chefs give PROFFESSIONAL DANCER instructions on the sizes of the portions and super- Editors in book publishing firms decide if a manu- see page 10 vise in the arrangement of the food on the platters script has the potential to be a successful publication. and plates. Many chefs hire and train the cooks who Once a manuscript has been approved, they arrange RADIO PROGRAMME WRITER work in the kitchen. The chef is also responsible for for the copyright, decide on the print, production see page 10 the cleaning of the kitchen and ensures that high- techniques and promotion. In many publishing firms, quality of service and food are provided at all times. copy editors check through the text carefully, SINGER correcting language and factual errors and some- HAIRDRESSER times doing extensive rewriting. Magazine editors see page 10 Hairdressers cut and style hair according to custom- assign, accept or reject, prepare and sometimes write ers' requests. They also trim, shape, shampoo and articles for publication. They supervise the work of tint or bleach hair. They give scalp treatments and other editors, writers, photographers, typesetters and Hand Craftslhandwork) & massages, and permanent waves. They also trim advertising workers. Editors in the newspaper and style beards and moustaches and may advise industry work at a hectic pace to meet deadlines. __ _ Services customers on personal grooming and cosmetic aids Managing editors are the owners' representatives and available and some hairdressers fit and style wigs. set editorial policy. AROMATHERAPIST Usually hairdressers are assigned to a work area which has a customer chair and an area where INTERPRETER Aromatherapy is a branch of both holistic medicine equipment such as combs, rollers and hairdryers is Interpreters help people from different cultures to and beauty therapy. It entails massaging the body kept and salons must be kept scrupulously clean. communicate effectively in spite of language with essential aromatic oils, each of which has Hairdressers who manage or own salons have the differences by translating orally what one person has different properties some stimulate, others soothe. responsibility of ordering supplies, keeping records, said into a language that others can understand. It is Clients discuss their specific problems with an keeping an appointment book, receiving clients and important to note that the interpreter differs from the aromatherapist who then selects the correct oil or hiring employees. translator because the interpreter concentrates on the oils for treatment. The oils have to be mixed with a spoken language and on the emotions and attitude of carrier oil (pure vegetable oils) because they are highly HOME ECONOMIST the speaker, while the translator deals with the concentrated. The object of the treatment is to written language. detoxify the body and to calm and relax the client. see page 11 A distinction is often made between two types of BAKERY TECHNOLOGIST MEAT-CUTTING TECHNICIAN / BUTCHER interpreter -- the simultaneous and the consecutive Bakery technologists apply their knowledge of Meat-cutting technicians cut large pieces of meat into interpreter. Simultaneous interpreters translate a chemistry, biochemistry, microbiology and bakery serving portions. They also prepare meat products speaker's words into a second language while the technology to maintaining and improving the quality such as sausage or ham. After cutting the meat, they words are still being spoken. Consecutive interpret- of baked products. They are responsible for control- weigh, price, label and pack it. ers wait until a speaker pauses, and then translate ling quality from raw-material stage to end product. what has been said up to that point. This entails testing products at various stages of In retail stores, they may set up displays and wait on processing. customers. They sometimes have to custom-cut to Interpreters may work in certain govemment meet their customers' special needs. Meat-cutting departments, embassies the and courts. All inter- The job also involves conducting research into technicians are also responsible for selecting meats preters should study the cultural, historical and improving baking methods for mass consumption from wholesalers or abattoirs and for maintaining political background of the people whose languages and developing more efficient ways of storing, records and inventories. They must also ensure that they interpret in order to best understand the packing and distributing products to eliminate the workplace is clean and that they adhere to safety meaning of their words. Working conditions are regulations. spoilage. In addition, bakery technologists are generally excellent. Simultaneous interpreters usually responsible for training production staff in the various work at international conferences in glass booths that aspects of bakery technology and supervising them PATTERN-MAKER (CLOTHES) are placed so that the interpreter will have a good to ensure proper application of the techniques. see page 9 view of everything that goes on in the conference hall. Consecutive interpreters work mainly in the court and CATERER WEAVER in the diplomatic field. Caterers provide food and refreshments plus the see page 1 1 necessary serving utensils and related items for JOURNALIST luncheons, wedding receptions, and other large Journalists gather factual information on subjects of gatherings. Perhaps more importantly, they help general public interest and set out to write clear, clients to plan such social gatherings, set reasonable Language- informative reports for publication in newspapers and limits on the guest lists, plan the details of the menus magazines or for broadcasting over television and and stay within their budgets. radio. A journalist may specialise in print journalism, COPYWRITER broadcast journalism or work in both and may cover Caterers supervise workers who prepare and serve Copywriters write advertisements and scripts for TV, a specific field (such as crime or the environment) or the food and refreshments, and may also help to film and radio commercials and think up ideas for work on a special assignment. Journalist observe complete advertising campaigns in all media. They
orifirtne 13 events, conduct interviews and do research to get Television announcers usually specialise in specific steps to prevent sensitive information from 'getting their information. areas of announcing such as news, sports or the into the wrong hands'. weather, and must be familiar with the chosen area. Correspondents may live in distant locations and A staff announcer reads advertisements, introduces CORRECTIONAL SERVICES OFFICER report news by telephone or electronic means. live and filmed programmes, identifies stations and Officers in the Department of Correctional Services Feature writers cover new developments for a makes promotional and public announcements. ensure the safe custody of prisoners as commanded particular department such as sport, politics or Some work as announcer- producers and also by a court of law from the date of imprisonment until human interest. They often supply historical develop, create, record and produce special radio and such a person can be released. These officers are background for current events. Columnists write television programmes. also concerned with the training and treatment of regular columns filled, for instance, with personal prisoners during their imprisonment, and for the opinions on current events or lively gossip about RADIO PROGRAMME WRITER relevant administrative work. public figures. see page 10 The activities of these officers include carrying out NEWS REPORTER TRANSLATOR duties in a prison, an administrative office, a work- A news reporter collects and gathers information A translator translates written material from one shop, a prison hospital or on prison farms and the about newsworthy events in order to write stories for language into another. The type of written material territory surrounding each prison. publication or broadcast. News media broadly fall into may vary widely and may range from legislation and two categories and reporters will generally specialise reports of government commissions to instruction ENVIRONMENTAL HEALTH OFFICER in one or the other: print media, which include manuals, scientific research papers and recipes. Environmental health officers are essentially con- newspapers, magazines and the related discipline of cerned with the effect that various environmental digital publishing on the World Wide Web and The translator usually studies the contents and factors have on the health of communities. This can broadcast media, which cover radio and television. background of the text before commencing with the be an exciting and varied career and environmental actual translation. In addition to language skills, health officers can apply their basic training to many Reporters usually start out by reporting on general translators must also posses wide general knowl- different fields of interest. news, such as court cases or crime. As they become edge. Some translators may work as terminologists more experienced they move on to specialised areas or lexicographers and some may act as interpreters Environmental health officers regularly inspect such as sport or politics. News reporting offers a wide too. sanitation and drinking water in rural areas to prevent range of possibilities, depending on the reporter's the spread of diseases such as cholera and typhoid. temperament. One can opt for the high-pressure They are also responsible for issuing the necessary 'buzz' of a daily newspaper, for feature writing for warnings and putting controls in place in the case of magazines, for sub-editing and layout or even if -14tv,Etifonteinitnt$1,,, malaria and rabies outbreaks. In urban environments action is what you really want -- broadcast reporting Protectlop Services :; they monitor pollution and inspect restaurants, from war zones. supermarkets and food manufacturers to ensure that standards of hygiene in the storage, packaging and PUBLISHER AGRICULTURAL INSPECTOR serving of foodstuffs are maintained and that foods The main responsibility of a book publisher is to The main function of agricultural inspectors is to for retail are not labelled in a misleading fashion. decide what to publish. Manuscripts are either evaluate the quality and standard of agricultural submitted by an author, in which case a decision to products. There are three main areas in which they These officers are also concerned with a healthy publish will be based on quality and suitability for the may specialise plant quality control technician, meat working environment and inspect industries for company's publishing list, or they may be commis- inspector and animal health technician. problems such as asbestos and other dusts, heat or sioned. cold stress, noise, chemicals and high and low Plant quality control technicians are responsible for pressure in the case of divers and pilots. Another Commissioning general books requires an ability plant health services, plant and seed control services aspect of this career is port control where health accurately to assess trends in the reading market, and analyses services. They control the quality and officers control entry from ships and aircraft to ensure while commissioning for educational publishing marking requirements of fresh plant, animal and that contagious diseases are not brought into the entails maintenance of regular contact with govern- liquor products and also focus on the control of plant country. ment or university departments, depending on the diseases and harmful insects. sector of education, to establish suitable subject areas FIREMAN in which to publish. Once a reading trend or subject The primary function of meat inspectors is to ensure Firemen protect life and property from fire and area has been identified, the publisher needs to find a that animals that are slaughtered are fit for human attempt to prevent the outbreak of fires. They also suitable author to write the manuscript and must consumption. Their most important duty is to inspect give assistance in the event of disasters such as negotiate a publishing contract. the levels of hygiene and cleanliness in abattoirs. earthquakes, train derailments, vehicle accidents, floods and so forth. When a book is accepted for publication it is sub- Animal health technicians (veterinary technicians) jected to a process of editing, design, production and assist veterinary surgeons preventing and controlling Procedures for extinguishing fires or for handling marketing. In medium- to large-sized publishing diseases through a variety of methods, including disasters such as vehicle accidents are mostly houses, these processes are usually controlled by research into these diseases, and the production of planned and practised beforehand. However, upon specialised personnel. The publisher needs, however, vaccines and dips. They are responsible for ensuring arrival at the scene it remains necessary to decide to keep in touch throughout the process as budgets, that farmers respect the laws regarding animal health upon suitable techniques, for instance whether to use deadlines, publicity and special editorial agreements and for informing and guiding farmers in the control water hoses or chemicals to extinguish a fire. are ultimately his responsibility. of animal diseases. Firemen also carry out routine tasks such as cleaning RADIO AND TELEVISION ANNOUNCER CAREERS IN THE NAVY fire engines, polishing equipment and working in the The duties of a radio and television announcer are The SA Navy offers a wide range of careers in various radio room. They attend lectures, demonstrations determined by the employer. fields. This write-up focuses on three officer careers, and practical training sessions. Firemen who are namely combat, naval and intelligence officer. employed at airports, must be distinguished from A radio announcer is a person who communicates by ordinary firemen. They provide effective fire protec- means of the radio to his listeners. He should have Combat officers lead the Navy's combat element and tion for aeroplanes and buildings and also perform an aptitude to communicate with people and their training focuses on maritime warfare. It is their specialised emergency and rescue services. especially an invisible audience. He may introduce responsibility to ensure that the Navy's sophisticated recorded music, present news and commercials and computerised weapons and systems are used with INSPECTOR OF WORKS comment on matters of local interest. Most radio maximum efficiency. Naval engineer officers are An inspector of works ensures that the structural, announcers conduct research to prepare pro- responsible for designing, developing and supporting mechanical and electrical aspects of building grammes which are relevant and meaningful to his the Navy's weapons and electronic and propulsion construction are carried out according to plan and audience. services. Naval intelligence officers gather and specifications and conform to required standards. evaluate information regarding the Navy to ensure maximum efficiency of operations and also initiate
26 14 Occupations Their duties are varied and are determined by their supervise the purchase of materials and the work of information sources to verify an applicants personal, specific employers. They draw up specifications and the various skilled artisans and labourers who are financial and other relevant details. If dients fail to lists of materials for new works and building repairs, assigned to the project. pay after these attempts the credit managers refer refurbishments and extensions. They carry out these cases to there attorneys. inspections, prepare reports and make recommenda- CHARTERED SECRETARY tions, draw up cost estimates for specific jobs, and do Chartered secretaries co-ordinate and direct the FINANCIAL AND INVESTMENT MANAGER valuations of particular properties. They recommend support services of a business. It is the chartered Financial managers are responsible for managing and progress payments and on completion of jobs inspect secretary's responsibility to ensure that a company is controlling the financial matters of a company. In and test the completed buildings or installations for legally constituted, economically viable and properly large corporations they oversee the functions of compliance with the required specifications. organised. This is a pivotal and senior position in a financial employees appointed to take care of specific company and is very often the route to a directorship. aspects of the financial division, but in smaller They are not only in charge of the artisans in their companies the financial manager is responsible for department, but also of the contract workers, Chartered secretarial work is very wide-ranging in its performing all tasks himself. The duties of a financial because most of the work is done on a contract basis activities and any one or more of the following may manager indude: regular evaluation of the company's by private contractors. They also come into contact be included in a day's work: ensuring that the affairs performance against budgets and targets; drawing with architects and engineers. of the company are carried out in accordance with the up budgets; and submitting the company's tax Companies Act: calling shareholders to the Annual returns. The financial manager also needs to record, TRAFFIC OFFICER General meeting; drafting agendas for and taking analyse and interpret all financial information relating Traffic officers perform duties within the municipal minutes at board meetings; assessing the impact on to the company and to keep senior management boundaries. They test prospective drivers for the company of new taxation legislation; and regularly updated and is expected to report financial licensing and inspect vehicles for road worthiness. analysing proposals for changes to the company's problems immediately so that suitable strategies can They control traffic and ensure that traffic flows computer system. The company secretary will also be devised to avoid disaster. effectively, enforcing laws and regulations pertaining regularly communicate with people across a wide to road traffic, and may give evidence in cases in the range of authority levels in the company. Investment managers are responsible for finding the traffic court. In some provinces the work of the traffic best possible way of investing the company's money officer and the provincial inspector are combined. In COMPANY SECRETARY and other such assets. These could be shares in the other, a distinction is made between the traffic officer Company secretaries perform routine management stock market, property, debentures, artwork or some and the provincial inspector. The traffic officer duties which enable their employers to attend to other type of investment The work involves a great controls traffic, patrol roads/ highways, while the other matters. They keep records of all activities in deal of administration which would, in a large provincial inspector protects the public from mal- the firm and distribute information to the depart- corporation, be dealt with by a company secretary. practices, particularly in commerce and ensure that ments concerned. They see to it that certain returns The duties of financial and investment managers are trading hours are kept. are filed with the Registrar of Companies as stipulated so closely linked that they are normally combined in in the Companies Act. smaller companies.
It is their task to see to the installation and mainte- FOOD SERVICE MANAGER nance of an information system which is relevant to The primary function of food service managers is to the policy and decisions of the company. They are manage the process of serving food to a large BUILDING MANAGER responsible for contracts and agreements undertaken number of people. The food service manager by their firms. Building managers use their knowledge of all aspects motivates a large team of workers to work quickly of building and construction in a practical capacity and efficiently to produce food that is tasty, attrac- They may handle lists of shareholders, share issues when they plan and oversee building projects and tively served and prepared according to high and share transfers and send out dividends that are advise architects, engineers and quantity surveyors standards of hygiene. This is a senior position. declared from time to time. They attend directors' on specific aspects of building practices. Although food service managers are not chefs they meetings and keep minutes. manage the process of food preparation --, they They see to aspects such as different subcontractors, should be prepared to roll up their sleeves and help CONSTRUCTION MANAGER materials needed, time available, contracts and out where needed if things get hectic. regulations, and provide liaison between architects Construction managers are responsible for co- and building contractors. There are five important ordinating building projects from the time they are Food service manager's duties cover a wide range, functions which building managers perform them- initiated until they are completed. They apply basic depending on the sectors of the industry in which selves, or of which they should have a sound building principles to solving practical problems on they are employed. For example, a hospital would knowledge: purchasing, calculation of expenses, site. Their duties include: site setting out and require modification of menus to suit certain diets, a planning, building surveying and control manage- organisation; hiring and supervision of labour, school canteen may require recipes to be standard- ment. determining which equipment to use and where to ised and restaurants require menu planning and place it on the site; supervision of programming analysing . Food service managers' responsibilities Although they do not necessarily carry out these operations; and identifying problem areas and taking include setting up supplier relationships and ordering tasks themselves, they should see to it that these corrective action. and storing food. Financial control and administration aspects of the building process run smoothly. They are important in this line of work this applies to can work in various positions as project managers of Construction supervisors effectively form a link financial control of the food products and the wages large building projects, building controllers for large between management and the workers on site. of the kitchen staff. municipalities or contract or financial managers. They may also act as technical advisers when CREDIT MANAGER Another important aspect of the job is the food buildings are planned and constructed. service manager's ability to deal with people effec- Consumers and businesses use credit to buy houses, tively. This applies to handling staff problems and cars, large domestic appliances, raw materials used in dealing with dissatisfied customers. BUILDING CONTRACTOR manufacturing and merchandise to be sold in stores. Building contractors are independent construction Credit managers (credit authorisers) have the final GARAGE MANAGER specialists who bid on specific assignments within a authority in accepting or rejecting credit applications. major construction project. The construction of one Garage managers are responsible for the total large building might involve many contractors and When evaluating a credit application the credit organisation of garages. An important part of their subcontractors working together towards its manager analyses detailed financial reports, inter- duties is the supervision and control of personnel. completion. views the representatives of the various companies, They hire, train, promote and terminate the services and reviews credit agency reports to determine the of employees when necessary in co-operation with The contractor must analyse the specifications of the records of such firms in repaying debts. Some credit the different sub-managers in charge of the various work and determine the materials, personnel and managers in banking institutions, for example, departments of the garage. related costs which would be required to complete determine whether the personal details such as the the assigned task. When all of these factors have income and address of a credit card applicant are They also supervise promotion activities such as the been considered, a bid is submitted. If the firm correct before the credit card is approved. Credit display of specific motor vehicles for which they are accepts the contract, the contractor must then managers therefore need to contact a wide range of agents, and the display of parts and accessories.
Occupations 2 15 They are directly responsible for retaining the there may be more than one manager and every goodwill of the public by ensuring satisfactory service They are responsible for the formation of marketing manager may be responsible for a separate depart- and creating and maintaining a sense of shared divisions and the assignment of authority and ment. purpose among the garage staff. Also, as managers, responsibility for marketing tasks. Practically every they should run the garage on a sound basis. type of manufacturer employs marketing managers STAGE MANAGER and sales managers. Larger organisations employ see page 10 HOTEL / MOTEL MANAGER specialists in various sub-fields of marketing Hotel or motel managers are responsible for operat- management. The marketing manager works closely STOCK CONTROLLER / INVENTORY AND ing their establishments to ensure maximum with the market researcher. STORES MANAGER profitability for directors while providing the best PRODUCER FILM AND TV The prime responsibility of a stock controller is to service for their guests. Company policy determines control the stock of the organisation by which he is the room rates and credit policy. see page 10 employed. Controlling stock comprises a number of tasks, including: ensuring that stock is properly They may manage all departments of the hotel/motel PRODUCTION MANAGER stored to prevent damage; ensuring that proper or have heads who manage the individual depart- Production managers plan, organise, manage, co- security measures are in place so that unauthorised ments of housekeeping, accounting and food ordinate and control production. This entails the persons do not have access to stock; preparation of services. Hotel/motel managers are responsible for transformation of raw materials or a combination of requisitions and other paperwork for ordering new handling any problems or emergencies which may raw materials into the final product. stock; controlling a back-order file and releasing arise. They consult on proposed changes in menus, stock accurately and timeously on receipt; checking investigate existing cost structures and reassess They select new tools, machines and equipment and documentation, amounts and condition of new stock; marketing procedures and methods to reach the most effective production processes and proce- returning damaged stock to suppliers; establishing additional prospective customers. dures for use in industrial plants. They arrange when unused stock needs to be disposed of; machinery and equipment and plan the work flow. payment of suppliers; and control of the stock control In some hotels which have conference rooms, They decide whether all components should be department's budget. managers cater for weddings, meetings and confer- manufactured or whether some should be obtained ences. Hotel/motel managers work in large or small elsewhere. They also conduct time and motion I STOCKBROKER hotels, motels or resorts. studies, analyse production jobs and set standards of There are many career directions that can be pursued production and performance for workers. in the fast-moving world of stockbroking. Portfolio HUMAN RESOURCES MANAGER/PERSONNEL MANAGER managers in the Investment Department assess their They design processing systems and apply research clients' financial status. Analysts in the Research Human resources managers work together with top techniques to production and other problems. They Department analyse the companies listed on the management officials to plan personnel policies that devise ways to keep health and accident hazards to a stock exchange. The information that they compile will meet the needs of employers and employees. minimum, study cost and quality of products and assists portfolio managers in investing their clients' They forecast employment requirements, and co- develop management control systems. These funds and is sold to the broker's clients by the ordinate transfers, promotions, dismissals, salary activities often require the application of statistical Institutions and Client Services Departments. increases and reinstatements. techniques in order to find the most favourable solution to production problems. The dealer who works on the trading floor presents They keep evaluation and confidential records of the popular image of the stockbrokers. There are employees. They also recruit, select, test, appoint PURCHASING MANAGER various categories of dealers: unauthorised clerks and place staff in suitable posts. They control the Purchasing managers ensure the effective supply of 'run' orders from the trading desk to the dealers; the progress of all activities and modify policy to meet machinery, raw materials and services to enterprises authorised clerk carries out buy and sell orders with particular objectives. They give personal attention to by buying items which are used or processed by their dealers from other brokers; institutional dealers take new programmes and personnel problems, stay employers. and carry out buy and sell orders over the telephone updated on labour laws and advise employers and from South African corporations and offer companies employees on their obligations and rights. They Their main duty is to find suppliers who offer the best market information; arbitrageurs do the same as often represent management in negotiations with value. They therefore compare catalogues and institutional dealers, but they deal with overseas trade unions and employees'associations on issues journals, telephone suppliers, examine samples and institutions. The Derivatives Department trades in the such as salary increases. They promote employee attend demonstrations and conferences. They futures and options market, an area so unpredictable welfare such as benefits, leave, housing schemes and consult with employees in the various departments to that it is often said that these dealers are born with a medical aid. determine the specifications of the items needed. 'nose' for the job. The dealers do the trading in this market and strategists apply their knowledge and The job description of personnel managers or human They must establish good business relationships with experience to the market to develop new strategies. resources managers depends on the type and size of suppliers in order to obtain satisfactory payment the organisation where they work. Bigger companies plans, quick delivery for emergency orders and cost The Corporate Finance Department lists shares on the usually have a team of people working in the human savings. Purchasing managers must check delivered Johannesburg Stock Exchange and the Administration resources department, where each one has a goods before they can authorise payment. The Department does the paperwork for all the other particular section to manage. These sections may purchasing manager must have a sound knowledge departments a task which can become quite include the following: staffing, training or human of every aspect of the company. pressurised at times. resource development, staff utilisation, organisation planning and development, labour relations, remu- SALES MANAGER neration, research, management, staff welfare and administration. Sales managers organise and monitor marketing and distribution strategies. Their work includes the MedicaVSclence MARKETING MANAGER supervision of the sales staff and the development of Technology sales programmes designed to introduce prospective Marketing managers promote and sell their com- customers to new products and services. pany's products and services to other businesses, ACUPUNCTURIST merchants and institutions. Sales managers are also responsible for reviewing Acupuncturists treat patients with ailments by market trends and evaluating sales. Sales manage- inserting needles of various lengths into their bodies Marketing managers need to be thoroughly familiar ment may include the development of a network of at various points. Acupuncturists will first consult with the products or services they promote as well as dealers who sell a product in the field. with their patients to establish their histories and the with their use. They should also know the special problems that have been diagnosed by traditional needs of customers. They are responsible for It is important that the sales manager leads by doctors and then apply their knowledge of acupunc- recruiting, selecting, appointing and motivating example in providing an excellent service to clients ture to determine the points at which the needles marketing personnel. They must know and apply and the public at large. Poor service can lead to a should be inserted. Each point is believed to be marketing techniques such as advertisements and decline in profit for the company. The sales manager effective in the treatment of a different ailment. The displays, market research, and identification of must provide the sales staff with the best training and needles are left in the body for a specified time, marketing opportunities. information on sales strategies. In bigger companies
16 2'5 Occupations according to the ailment being treated, and then and arrange and interpret X-rays, which they regard A dentist in private practice performs a variety of removed. as an important diagnostic tool. administrative duties such as bookkeeping and the buying of supplies and may also supervise /manage a Acupuncture is an ancient Chinese art and is a branch Chiropractors' approach to healing is holistic, so they whole team of co-workers such as dental assistants, of holistic medicine. It is used in the treatment of do not prescribe drugs or perform surgery. They will, receptionists, dental technicians and dental hygien- ailments such as arthritis, hypertension and ulcers, however, refer a patient to another medical practitio- ists. when patients seek an alternative to traditional ner if they feel that this is necessary. Their treatment medicine. People seeking to cure themselves of entails manipulation or adjustment of the spinal DERMATOLOGIST addictions such as smoking and drug-taking and column, the use of traction, massage, acupuncture, A dermatologist is a doctor who specialises in the those seeking a way to lose weight often consult heat therapy, and the application of support braces diagnosis and treatment of skin diseases, such as acupuncturists. and advising the patient with regard to lifestyle acne, eczema and psoriasis. changes in respect of diet, exercise and rest. ANAESTHETIST Please refer to the description of a medical doctor for An anaesthetist is a medical doctor specialising in the DENTAL TECHNICIAN more information. administration of local and general anaesthetics to Dental technicians are skilled crafts people who make patients about to undergo a medical procedure. The and repair dental restorations such as bridges or DIETICIAN / NUTRITIONIST anaesthetist first consults with patients to ascertain dentures (both metal and plastic), crowns, and The dietician interprets the science of nutrition in their history in respect of allergies, previous reactions maxillo-facial prostheses. terms of food for both healthy and ill people. He to anaesthetics and current medication and then strives to maintain good health and combat disease monitors patients throughout the medical procedure Dental technicians follow the directions or prescrip- in people from all walks of life and from varying and their recovery from the anaesthetic. The anaes- tions of a dentist and do not deal with patients socio-economic circumstances.Dieticians, for thetist also follows up on patients' immediate post- themselves. They may be generalists and perform all example, prescribe diets with less salt for people with operative recovery to establish whether the anaes- types of laboratory work or they may specialise in high blood pressure and a reduction in sugar and fat thetic is causing any adverse side-effects. such areas as denture construction or bridgework. intake for those who are overweight. BEAUTY TECHNOLOGIST / SOMATOLOGIST When a denture has to be made, the dentist obtains The nature of the dieticians work are closely related to see page 11 impressions of the patient's gums and palate, from his field of expertise. Dieticians work in a variety of which the technician makes a model. When this has fields and include the following areas of employment: BIOKINETICIST been modified for comfort, the final dentures are cast (1) Hospital work - an administrative dietician (plans in an acrylic material or artificial resin. Dental meals, trains supervisors, performs administrative Biokineticists are human-movement specialists who technicians make crowns, bridges and fillings, and prescribe exercise routines either as a preventative tasks). (2) A therapeutic dietician (plans special diets work with braces or correction appliances. The according to the doctor's prescription). (3) A clinical health measure or to correct a health problem such product that the dental technician is making usually as a sports injury or recovery from disease or illness. dietician (plans diets for out-patients). (4) An affects the appearance of the patient, which means Biokineticists work closely with their clients' doctors educational dietician (instructs nurses, medical and that the work of dental technicians needs to be very dental students. (5) Counselling or nutritional and other medical practitioners. A very important precise and neat. aspect of the work is the accurate evaluation of the education. (6) Quantity catering industries, govern- ment departments, orphanages, old age homes, etc. client's physical condition. The biokineticist uses DENTAL THERAPIST scientific methods and instruments to assist in the where quantity cookery is undertaken make use of evaluation and prescribes a programme of healthy Dental therapists take care of most of the dental the knowledge of dieticians. exercise based on the results thereof. needs of people who are reliant on the state health (7) Researchthey work for the Medical Research services for their health-care needs. The work of Institute where intensive research work is undertaken. BIOMEDICAL ENGINEER dental therapists can be classified as preventive They also work at the SABS, CSIR, universities, food dentistry and they need to recognise when patients control boards and so forth. (8) Teaching - they may Biomedical engineers use engineering principles to should be referred to dentists for more advanced be appointed as teachers, giving instructions in Home solve medical and health-related problems- an treatment. Economics. (9) The media - to write women's example would be the production of a mobility aid columns in newspapers and magazines, to demon- such as an artificial leg for someone who has lost a The dental services that dental therapists offer are strate for the radio and television. (10) Consulting leg in a car accident.Biomedical engineers design dental examinations; simple fillings and extractions; dieticianswork in private practice and are available and develop medical instruments and devices such as treatment of and the taking of preventive measures to doctors, hospitals and the public. artificial organs, hips and heart valves, pacemakers against the more common oral diseases; X-rays; and monitoring devices, and adapt computers to cleaning, scaling and polishing; and teaching people ELECTROENCEPHALOGRAPH (EEG) TECHNICIAN serve medicine. how to care for their teeth. An electroencephalograph (EEG) machine measures the electrical activity of the brain. The records Research ranges from the study of engineering Dental therapists have to register with the SA Medical aspects of human biological systems to the im- obtained are then used by specialists to diagnose and Dental Council in order to practise and must diseases and disorders such as epilepsy. provement of existing medical devices. Biomedical work under the supervision of a dentist or a senior engineers may arrange testing to ensure the con- dental therapist for at least one year before they may Electroencephalograph technicians operate EEG tinuing safety of electronic, electrical and mechanical practise on their own. equipment used for the diagnosis, treatment and equipment. After the patient has been reassured and helped to relax, electrodes are selected and placed on monitoring of patients. Some biomedical engineers DENTIST advise and recommend the purchase of new the patient's scalp in standard locations. The EEG equipment to administrators. Duties may also include The job of the dentist is twofold, to treat ailments or technician also selects and operates the instrument the training and supervision of technicians. abnormalities of the oral cavities and to try to prevent controls. their occurrence or reoccurrence. CHIROPRACTOR While the record is being made the technician Dentists examine teeth and the tissues of the mouth observes and records the patients behaviour. The Chiropractors diagnose and treat patients whose to diagnose diseases or abnormalities. They fill EEG technician is responsible for the classification and health problems are associated with the body's cavities, extract teeth in serious cases and substitute filing of reports and also perform general office duties muscular, nervous and skeletal systems, especially dentures designed especially for the patient. They such as arranging appointments, and ordering the spine. They believe that if anything is interfering also treat abscesses and infections of the gums, clean supplies and equipment. with any of these systems it will impair the normal teeth and take X-rays of the oral structures. Dentists functions of the body and lower its resistance to may correct malocclusions by straightening teeth. GYNAECOLOGIST disease. A gynaecologist is a medical practitioner specialising They also perform corrective surgery of the gums and in the treatment of diseases and disorders of the Chiropractors follow a standard routine of diagnosis. supportive bones. They provide their clients with which is much the same as that used by traditional female reproductive system. Gynaecologists in this information on diet, brushing, flossing, the use of country also practice as obstetricians as the two doctors. They consult with patients regarding their fluorides, and other aspects of dental care. history and carry out physical, neurological and branches of medicine are so closely related. Obstet- orthopaedic examinations, arrange pathological tests rics is the branch of medicine concemed with
Occuoations 17 childbirth and midwifery. Patients are sometimes Radiotherapy is the treatment of patients with activities and children's play activities. The tools and referred to gynaecologists by general practitioners or malignant conditions such as cancer by the applica- equipment used are in accordance with each activity. they may go straight to a gynaecologist. tion of ionising radiations. The medical physicist is responsible for ensuring that the correct dose is One can conclude that the occupational therapist HERBALIST delivered accurately. helps patients to regain their self-confidence, to be Herbalists use remedies made from plants to able to act independently in spite of their physical, stimulate a patient's own bodily defences to produce Nuclear medicine makes use of radionuclides to psychological and social limitations. relief or a cure for ailments and diseases. They diagnose diseases. Patients are given prescribed require patients to explain their symptoms and to quantities of radionuclides and images of their organs OPTOMETRIST are obtained by means of a computerised scintillation give a detailed medical and dietary history dating Optometrists examine eyes for vision problems, back to their childhood. Some herbalists use modem camera. The information obtained from these images disease and other abnormal conditions. They test for diagnostic methods such as blood-pressure tests, assists in diagnosing the patient's disease. Medical proper depth and colour perception and the ability to physicists also work closely with nuclear medicine biochemical tests or sending the patient for X-rays. focus and co-ordinate the eyes. When required, they Once a diagnosis has been made the herbalist gives physicians to develop new and improved techniques prescribe lenses and/or treatment. When disease is the patient a remedy made from plants, either bought of assessing organs. found, they refer patients to an ophthalmologist for or gathered by himself or herself, which is specifically treatment. blended to deal with the patient's particular condition. Medical physicists working in diagnostic radiology must ensure that the X-ray equipment complies with Many optometrists supply the prescribed eyeglasses The herbalist's approach to medicine is essentially safety standards, that optimal exposure techniques and fit and adjust contact lenses. They also prescribe holistic so he or she also advises patients in respect of are used and that patients and staff are not exposed corrective eye exercises or other treatment not diet, exercise, breathing and other lifestyle factors to more radiation than is absolutely necessary. requiring drugs or surgery. In addition, optometrists which could impact on their health. Some herbalists consult with educators for preventive vision care for sell ready-made remedies to pharmacies and health MEDICAL PRACTITIONER (DOCTOR) school children, and with public officials and man- shops. Medical practitioners (doctors) are licensed practitio- agement to help eliminate vision hazards. The ners of the science of medicine, who diagnose optometrist informs people about the correct reading HOMOEOPATH diseases, prescribe medications and otherwise treat habits, lighting and general eye safety. Homoeopaths are legally recognised medical diseases and disorders of the human body. practitioners who treat patients who are ill in a ORTHOTIST-PROSTHETIST different way from conventional medical doctors. They can work as general practitioners who care for Orthotists-prosthetists design and make artificial They diagnose illnesses as traditional doctors, but all general complaints that do not require in-depth limbs (prostheses) and surgical appliances such as follow homoeopathic principles in the treatment of treatment, as medical officers in hospitals or as callipers, splints, braces and surgical shoes (orthoses). the ailments. specialists in a specific field. Doctors question the patient, take medical histories, and perform physical Patients are measured to ensure that the new Treatment entails the administering of tiny quantities examinations seeking the true cause of the com- appliance or limb will fit perfectly. A cast is made of of specially prepared plant, mineral and other plaint. They may then prescribe medication or may the applicable part of the patient's anatomy and the therapeutic substances. Popular interest in holistic refer the patient for further investigation or treatment appliance or limb is constructed, using the cast as a medicine has encouraged a growing number of to one or more of the specialists. General practitio- point of measurement throughout the process. The people to consult homoeopaths. ners may perform small operations or assist surgeons orthotist-prosthetist then constructs the appliance or with big operations. limb from a variety of materials, using a number of MEDICAL LABORATORY TECHNOLOGIST / processes, including sawing, drilling, riveting, BIOMEDICAL TECHNOLOGIST The medical practitioner in private practice performs moulding molten plastic, and mixing pigments to a variety of administrative duties like bookkeeping Medical technologists assist doctors and pathologists match skin colour and applying them to the artificial and the buying of supplies. He may also act as in the diagnosis of disease by performing all kinds of limb. supervisor/manager of a wide range of people clinical laboratory tests. They play an important role working close with him. His team may include nurses in the fight against diseases. The orthotist-prosthetist then tests the limb for and receptionists. freedom of movement and other functional efficiency. The four main lines of work are: He or she measures and modifies the finished NEUROLOGIST diagnostic work, researchwork, blood transfusion product on the patient until the patient is satisfied. technology, and the preparation of serum and A neurologist is a doctor who specialises in the The orthotist-prosthetist will also spend some time vaccines. The medical laboratory technologist does diagnosis and treatment of diseases of the nervous with the patient, instructing him or her on the proper not work directly with patients. He forms part of a system, for example Parkinson's disease, multiple use of the new appliance or limb. laboratory team, assisting a 'professional officer' who sclerosis and brain tumours. has a degree. Some technologists identify disease- PAEDIATRICIAN causing organisms, parasites, fungi, viruses and You may refer to the description of the medical Paediatricians care for the physical, mental and cancer cells, and some do research, and develop new doctor for more information. emotional health of children from birth to adoles- laboratory techniques, while others teach at tertiary cence. institutions. OCCUPATIONAL THERAPIST The occupational therapist assists the physically They examine children at regular intervals to prevent The medical laboratory technologist in the blood disabled, the mentally disturbed and children with problems, as well as examine, diagnose and treat transfusion technology field conducts tests on blood developmental or learning disabilities to function illnesses or injuries. They advise parents on health, to determine blood groups and diseases like aids independently in everyday life. nutrition, development and other aspects of child and hepatitis. These technologists must be ex- care. When children are chronically ill or handi- tremely careful because most of the time they work Occupational therapy includes programmes for the capped, paediatricians advise parents and children on with infected material.Medical laboratory technolo- improvement of physical functions (e.g. power and special services. gists train and supervise laboratory assistants and dexterity of the hands-), improvement of mental other technologists. health (e.g. social adaptability), the improvement of At times they consult with or refer patients to other self-care, self-management and personal inde- specialists. Paediatricians may also serve as counsel- MEDICAL PHYSICIST pendence (the occupational therapist also advises on lors in situations ranging from advising parents on Medical physicists specialise in applying physics to adaptations, aids devices and structural alterations to infant care to helping adolescents with emotional medicine. They provide a professional service in buildings to enable the patient to function inde- problems. medical physics, consult with physicians, conduct pendently), and the promotion of the normal multi-disciplinary research and teach physics to development of the sick or disabled child. PATHOLOGIST medical students and other medical staff. Medical Pathologists study the nature, cause, development physics can be sub-divided into three different The occupational therapist uses everyday activities as and effects of disease. Pathologists provide and applications: radiotherapy, nuclear medicine and treatment medium. The activities includes personal interpret laboratory information essential to medical diagnostic radiology. management activities, work activities, recreational diagnosis and patient care.
3 0 18 Occupations Some pathologists perform autopsies to determine corresponds to reflexes in the feet and that working the nature and extent of diseases, the cause of death A wide range of skills is used, including mobilisation, on the feet in a specific way can help to heal those and the effects of treatment. Others supervise and massage and manipulation, together with electrical parts of the body. Exponents of reflexology believe co-ordinate the performance and reporting of a wide equipment. These skills are used to relieve pain and that disease today is caused by the body being range of diagnostic and screening tests and maintain stiffness in joints, to improve muscle strength and constantly exposed to stress, which gradually erodes a rigid system of quality control to ensure the co-ordination, and to help disabled people to lead its immune system. A reflexologist therefore aims at accuracy of test results. useful lives with as much independence and personal reducing stress, thus enabling the body to heal itself fulfilment as possible. Physiotherapists treat all age naturally. Circulation and the supply of nutrients and Many pathologists are involved in research concern- groups, from babies, children and adolescents oxygen to the cells improves when the body is in a ing the nature and origins of disease and the through to senior citizens. state of relaxation. Reflexologists, in keeping with possibilities for prevention and cure. Other patholo- their holistic approach to healing, combine this gists teach medical students, nurses and other health The emphasis is not only on the treatment of special treatment with advice on nutrition, exercise science students. patients. Preventive and educational programmes are and positive thinking. Reflexology is not regarded as also essential aspects of this worker's role. The a replacement for medical treatment, but as an PHARMACIST nature of the work includes the application of additional maintenance therapy. The pharmacist forms the link between the pharma- thermotherapy, electrotherapy, ultra-sound, infrared SPEECH THERAPIST AND AUDIOLOGIST ceutical manufacturer and the medical doctor, the radiation, massaging and exercise. doctor and the patient, and the patient and the These therapists diagnose and treat patients who community. His role in the health team is to manu- PODIATRIST / CHIROPODIST have voice, speech and language disorders. They facture, prepare and supply suitable and safe The function of the podiatrist is to maintain the can, for example, help children who stutter to medicinal products for the prevention or cure of human foot in its healthy state and to treat abnor- overcome or reduce there problem. illness in man. malities. Podiatrists diagnose and treat deformities and diseases of the foot. They prescribe preventive They test various aspects of hearing, fit hearing aids The nature of a pharmacist's work vanes to a great measures and perform minor operations using a local and provide therapy for patients with impaired extent, depending on the pharmaceutical field in anaesthetic. At present the extent to which podia- heating. (Unless otherwise stated, the term 'speech which he is employed. The following possibilities trists may prescribe medication and drugs is limited therapist' as used here covers the audiologist as well.) exist: retail pharmacy, industrial and wholesale by law. If the symptoms they observe in the foot Depending on the cause of the disorder they may pharmacy, hospital pharmacist, education and suggest other problems, they refer patients to work individually or as a team with one or more of the research, civil service pharmacists (as administra- medical specialists. Podiatrists usually handle all kinds following: medical doctors or specialists, psycholo- tors and inspectors in government departments). of foot care problems but some specialise in specific gists, physiotherapists, social workers, educationists Some pharmacist conduct research while others are disorders. and occupational therapists. Once the problem has involved in training. been identified, speech therapists work out individual PSYCHIATRIST programmes for patients. They provide therapy and work with patients either individually or in groups. In PHYSICIAN Psychiatrists are physicians trained to deal with the many cases the family of the patient is involved in the Physicians are medical doctors who have specialised prevention, diagnosis and treatment of mental therapy. The therapists are also responsible for as diagnosticians in internal medicine. They study the disorders. Psychiatrists take complete histories of programmes that focus on the prevention and basic bodily systems (digestive, circulatory, respira- their patients, including medical, emotional, and identification of communication disorders. tory, etc.) so that they can identify the causes of developmental information. unusual internal disorders. After obtaining a complete history, the psychiatrists SURGEON Many patients are referred to them by other doctors determine the nature and degree of the disorder and Surgeons are doctors who specialise in performing who have been unable to locate the source of the decides on the treatment programme. The psychia- surgery to prevent the spread of disease, to correct patient's complaint.Physicians perform tasks similar trist then directs or administers the kind of care and deformities, to repair injuries and to improve body to those of a general practitioner and often recom- treatment necessary. functions. mend laboratory tests and X-rays to aid diagnosis. Once the problem is defined, the physician treats it by Psychiatrists may be involved in research or teach at Most surgeons are in private practice. Their patients accepted medical methods. Internists may specialise universities. In addition, they may serve as consult- are referred to them by general practitioners and in the treatment of allergies, the cardiovascular ants in courts of law, special schools and community specialists. The surgeon examines each patient as system, gastro-enterology, pulmonary diseases, agencies. completely as possible, reviews his medical history nephrology or rheumatology. and consults with other doctors to be sure an RADIOGRAPHER operation is necessary. The procedure is explained to PHYSIOLOGIST Radiographers apply X-rays and radioactive sub- the patient and/or the family. Physiologists are biological scientists who study the stances to patients for diagnostic and therapeutic Before surgery, surgeons check the equipment, various life functions of plants, animals and man purposes. All radiographers work at the request of a instruments and surgical setup to be sure everything under normal and abnormal conditions. They qualified doctor or dentist. (This is not to be con- that is needed is present and sterile. After surgery specialise in the study of cells, tissues or one of the fused with radiologists or radiotherapists, who are the patient's condition is monitored until recovery organs. They are interested in the internal 'commu- medical specialists.) from the effects of the operation is complete. nication' of organs, energy procurement and utilisation, blood circulation, defence systems against There are four categories of radiography (1) Diag- VETERINARIAN infection, repair mechanisms, reproduction and nostic radiographers capture X-ray images of the metabolism. human body on film or other media using sophisti- Veterinarians diagnose and treat animal diseases and cated X-ray equipment. disorders. They test dairy herds for tuberculosis and Some physiologists investigate the effects that factors brucellosis, and inoculate animals against diseases such as drugs or pollution have on the life processes (2) Therapeutic radiographers localise, plan and such as rabies and hog cholera. They perform and bodily functions of plants and animals. Physiolo- administer radiation treatment mainly in the treat- autopsies to determine causes of death, inspect gists have provided the basis for much of the work ment of cancer. (3) Nuclear medicine radiographers animals intended for human consumption, both done by pathologists, nutritionists and toxicologists. prepare and utilise radioactive pharmaceuticals to before and after slaughtering. They advise on the capture diagnostic images of the anatomy and care and breeding of animals. They engage in PHYSIOTHERAPIST physiology of the patient. (4) Ultrasound radiogra- general practice, treating various animal species, or specialise, restricting their practice to pets or single The physiotherapist is a member of the medical team phers produce images of the human body using species. They may engage in a particular function and as such evaluates, plans and carries out treat- equipment which generates high-frequency sound such as research and development, consultation, ment programmes for the ill and for handicapped waves. Radiographers may be involved in admini- teaching, technical writing, the sale or production of persons. One can argue that the physiotherapist not stration, personnel management or teaching. commercial products, or the rendering of technical only treats people with sport injuries, but people from services for commercial firms. a wide spectrum. The physiotherapist helps the REFLEXOLOGIST client to function effectively within the limitations of Reflexology is a branch of holistic medicine which is his injury or disability. based on the principle that every part of the body
3'1. Occtioations 19 VETERINARY TECHNOLOGIST most effective uses for new products. They may Theoretical astronomers concentrate on developing In the laboratory, veterinary surgeons and scientists travel to neighbouring countries to help the people theories concerning various aspects of -or objects in- are assisted by veterinary technologists and veterinary increase their food production by means of new the universe, based on their knowledge of physics nurses. techniques. They may work on developing new types and the observations made by other astronomers. of grain, legumes and grasses with techniques that Observational astronomers plan research which The veterinary technologist is specially trained to will increase and improve food production and help involves the measurement of electromagnetic execute laboratory procedures, to handle and inject replenish soil. radiation (such as light waves). They analyse the animals and to record observations. He is also results they obtain and publish their findings so that expected to implement animal health schemes and to ANALYTICAL CHEMIST others in the field will have access to the information. control disease in the field. Analytical chemists examine the composition, It is possible to work in both theoretical and observa- structure and characteristics of a variety of materials tional astronomy, though most astronomers tend to Their tasks can be divided into three main categories. and the processes and changes they undergo. In be more active in one or the other. Some astrono- (1) Diagnosis: They collect specimens of plants, feeds, particular, they investigate which substances are mers also teach Mathematics or Physics at university. blood and tissues from animals for testing to present and in what quantities. They also aim to determine the causes of disease or deaths. (2) develop new methods of analysis. Analytical chemists BAKERY TECHNOLOGIST Research: This is carried out in disciplines such as work closely with a team of chemists who are all see page 13 virology, bacteriology, parasitology, toxology, specialists in their own fields. They conduct their pathology and nutrition. The research mainly experiments in a laboratory and usually write their BIOCHEMIST focuses mainly on preventing animal diseases and on reports in their own offices. The biochemist is a scientist who deals with phe- methods of increasing animal productivity. (3) nomena that distinguish the living from the ginani- Manufacture: Veterinary treatments (antigens and ANIMAL SCIENTIST mate (non-living) in chemical and physical terms, vaccines) are produced. Animal scientists are concerned with the study, whether animals, plants or micro-organisms. He rearing and management of livestock. They may endeavours to breach the gap between the highly work on the economic provision of meat, milk, eggs, integrated activity of the living cell (a biological unit) Natural Science &. textile fibres, leather and a variety of products and the properties of its individual components. essential to man. They advise on production and the Mathematics presentation of animal products. They conduct Biochemists are employed in different fields that research in the areas of animal selection, breeding, determine the nature of the work.Biochemists, for feeding, housing and disease control. Some may example, conduct research into ways of re-using ACTUARY control breeding practices to improve certain strains waste materials. Their work can therefore play an Actuaries are experts in the theory and practice of in animals. important role in preserving the earth's natural statistics, and specifically those of mortality, sickness, resources. retirement and unemployment. Actuaries work AQUATIC SCIENTIST mostly with numbers and figures. An aquatic scientist (limnologist) is a person who BOTANIST studies the physical, chemical, biological and Botany is the branch of biology that deals with plant They devise, compile and develop life insurance ecological aspects of inland and marine water life. The botanist's work is very important because policies, pension and medical aid schemes and environments. He studies physical aspects such as human beings depend on plants for food. perform other specialised functions mainly relating to temperature, the available light and water move- the assurance industry. They also deal with invest- ments; chemical aspects such as the organic and Botanists conduct research into all aspects of plant ments of life assurance companies, for example the inorganic composition of the water; biological life. They may identify and classify plants, study the investment of money in government stock, mortgage aspects, which entails detailed observation of the structure of plants, and study the relationship bonds, ordinary and preference shares, property and various types of aquatic plants and organisms: between the environmental influences of rainfall, other securities. interrelated aspects such as the relationship between temperature and sunlight. Plant physiologists study organisms and their environments: and other aspects the effect of nutritional components on plant growth. A considerable amount of the actuary's time is such as the control of forms of pollution that causes These physiologists usually concentrate on one crop devoted to the evaluation of a company's liabilities in fish to die. An aquatic scientist's time is divided . group or one plant process. Plant pathologists are respect of all policies. between being in the laboratory and being out in a specialists in the causes and control of plant diseases. water environment when he is busy with research. Weed scientists study the different types of weeds AGRICULTURIST and also how to control them without destroying the The agriculturist is a scientist specialising in one or ARCHAEOLOGIST environment. more aspects of biology or agronomy for the purpose Archaeologists reconstruct records of extinct cultures. of providing food or increasing its production. They study, classify and interpret artefacts, tools, art CARTOGRAPHER and dwellings to obtain a better insight into the Cartographers draw up and revise maps that provide Agriculture includes crop science and animal science. history, culture, social, spiritual and technological the map user with information about the earth's The agriculturist is therefore someone who special- activities of earlier societies. surface. The cartographer gets his information from ises in an aspect of crop science or animal science. aerial photographs, field reports, historical manu- Crop scientists (agronomists) investigate field crop An archaeologist's job can be divided into broad scripts and other charts and statistical reports. problems and develop new and improved growing categories. The task begins with field work. which methods to obtain higher yields or better quality. entails the excavation of an archaeological site. Plans He produces the chart using photolithography, They may specialise in a specific crop, group of crops, have to be drawn of the site, meticulous records kept, drawing and etching techniques. The cartographer production, weed and pest control, or irrigation. photographs taken and the objects found sorted and works with computer programs and printouts and numbered. The next step is the work in the labora- photogrammetry which gives a three-dimensional Animal scientists conduct research on animals, and tory where the objects are scientifically analysed. perspective of the landscape. develop scientific methods of breeding, caring for and Finally the archaeologist has to interpret his or her managing domesticated animals. They may special- findings and write them up in a report, which may be Cartography is concerned with four different map ise in certain types of animals, their breeding, published in a scientific journal. processes: linework (sketching lines and engraving) physiology or nutrition, meat, butter or eggs. colour separation (the preparation of different masks ASTRONOMER for each separate colour for multi-colour maps), the AGRONOMIST Most astronomers are involved in research, teaching positioning of letters and symbols, and the repro- Agronomists (or grassland scientists) investigate or a combination of both. Astronomers are experts duction of maps. field-crop problems and develop new and improved in the fields of mathematics and physics. They use growing methods for higher yields or better quality. their knowledge, for example, to study the universe: CHEMICAL ENGINEER They provide information on plant diseases, weed this knowledge can be applied to developing Chemical engineers are involved in all phases of killers and the biological control of insect pests. They navigational systems that will enable us to find our chemical processes and chemical production. Some advise farmers about crop rotation, fertilisers, field way through space. engineers work in research, designing and perform- drainage and irrigation. Agronomists may become ing experiments and then analysing the results. manufacturers' representatives and show farmers the Others help to design and construct manufacturing
20 Occupations facilities, occasionally designing a pilot (or test) plant times without a full report from a professional FORENSIC ANALYST as a first step and following through to the final step ecologistand often more than one ecologist is Forensic analysts apply their knowledge of chemistry of supervising the workers constructing the final enlisted by different interest groups attempting to and biochemistry to the task of finding evidence installation. gain public approval for their agendas. through chemical analysis. Their services are invaluable in police and legal work, since they are Some engineers help to solve the problems involved ECONOMIC GEOLOGIST called upon to detect traces -or confirm the pres- in producing high quality products at the lowest Economic geologists study the deposits of ores and ence- of substances like poisons, drugs and alcohol possible cost. Chemical engineers also work closely other mineral resources that are mined for commer- in the human body at post-mortems. with financial and marketing specialists to ensure that cial purposes. They conduct in-depth research into all projects are economically viable. the processes that have led up to the formation of the This information is then used by the police to assist deposits. This information is extremely useful to them in solving crimes, and by the legal profession to The safety of the environment and its protection are mining companies as it helps them to understand the secure convictions or prove someone's innocence. key areas of their concern because chemical engi- nature of the resource they are mining and also to Forensic analysts are often cross-examined in court neers work with life threatening chemicals and gases. locate it in a methodical fashion. in respect of their findings. Management and teaching are other fields of work for chemical engineers. As a manager it is the Economic geologists essentially apply geological Another branch of forensic analysis is in the field of engineer's responsibility to see that the chemical principles to solving practical problems in the mining preventive medicine where foods, beverages and plant operates at a profit and not at a loss. industry. The training that they receive enables them habit-forming drugs are tested to determine their to run the geology department on a mine, and to safety for human consumption. CHEMICAL LABORATORY TECHNICIAN organise a programme of prospecting in the field. Chemical laboratory technicians work with chemists FUEL TECHNOLOGIST and chemical engineers to develop, produce, sell and ENTOMOLOGIST The term 'fuel technologist ' is a general grouping for utilise chemicals and related products and equip- Entomologists are scientists specialising in the study a number of technically-oriented jobs concerned with ment. They set up and conduct tests on products or of insects. One aspect of an entomologist's work is the process of obtaining crude oil and manufacturing processes being developed or improved. They must conducting the detailed study of insects and their various products from it. Fuel technologists can be measure reactions, analyse results and carefully behaviour. Another aspect is the application of this employed in any one of the following areas of the record data from these tests and experiments. knowledge for the benefit of certain industries and petroleum industry: exploration, refining, research human beings in general. Entomologists develop and development, quality control, and technical Some technicians assist with design, equipment methods to control and manage insects that damage marketing. installation, and the training or supervision of crops or are destructive or harmful in any other way. operators on the production line. Others test They focus on methods that are environmentally- Geological fuel technologists are involved in the materials, production processes and final products to friendly and often use other insects as part of their search for new oil wells. Fuel technologists in the make sure they meet specifications and quality control strategy. They also identify insects that are extraction process research the different types of standards. A few technicians work as sales personnel. beneficial to humans. mud used to lubricate oil drill bits. Laboratory fuel technologists working in the refining process test and CHEMIST EXTRACTION METALLURGIST evaluate crude oil to determine its properties and classification. Laboratory fuel technologists in all A chemist's work revolves around examining the The primary function of an extraction metallurgist is composition, structure and properties of different to extract valuable metals from the ores in which they areas of the petroleum industry perform various materials, as well as the processes and changes they are deposited. Metallurgy combines the sciences of physical and chemical tests for quality-control undergo. They work in research and development as chemistry, physics and mathematics with basic purposes. Fuel technologists can also move into well as production and inspection. engineering principles, so as to concentrate, extract, marketing positions, which require a high degree of refine and manufacture metals. Often only a tiny technical knowledge in addition to marketing skills. In the research and development field, the properties amount of the precious metal is deposited in the ore. and composition of matter and the laws that govern The extraction metallurgist is expected to remove all GENETICIST the combination of elements are investigated. of the metal in an efficient and economical way. He Geneticists study the passing on of genetic traits from Chemists use their knowledge and research findings will select an extraction process according to the one generation to the next in plants, animals and to help create or improve products. Chemists have structures and properties of the metals. The two main humans. The study of genetics can be sub-divided been instrumental in fields such as the development classes of extraction process are: pyro-metallurgy into different fields and each looks at a different of new paint and drug products. which makes use of heating and smelting and hydro aspect of heredity: the qualities and behaviour of metallurgy, whereby metals are extracted in solution. chromosomes are studied in cytogenetics; the In the fields of production and inspection, instructions Extraction metallurgists constantly investigate molecular functioning of genetic material is studied in are prepared for plant workers, specifying the kind methods of improving metallurgical extraction molecular genetics and this information is used to and amount of ingredients to use and the mixing processes. change genes for commercialespecially agricultural time for each stage in the process. In the inspection and medicalpurposes; in the field of population area, chemists test samples to be sure industry and FOOD SCIENTIST AND TECHNOLOGIST genetics and plant and animal breeding scientists use government standards are met. The food scientist and food technologist are two their knowledge of genetics to predict the outcomes distinct careers but the day-to-day work is similar. of cross-breeding different animals and plant types; Chemists may specialise in one of the following doctors use their knowledge of human genetics to aid Food scientists and technologists are responsible for disciplines: organic, inorganic, physical, analytical, applying the findings of research in food processing them in diagnosing and treating hereditary diseases. and theoretical chemistry, as well as biochemistry and to the development and improvement of products industrial chemistry. and processes to be more beneficial to industry and GEOGRAPHER consumers. Geographers attempt to relate the earth's physical ECOLOGIST characteristics to the distribution and habits of Ecologists are scientists specialising in the study of Food scientists and technologists conduct research people. Geographical study focuses on questions, relationships between organisms and those between to solve problems in the food industry and to keep problems and issues arising from the inter- organisms and their environment, as well as the pace with new developments. They analyse samples relationship between people and their environments. impact on the environment of population size, to determine their physical, microbiological, chemical housing and recreational facilities, pollution, farming, or spectro-graphical nature. They undertake Many geographers teach at secondary schools, rainfall, temperature and altitude. inspection at places of manufacture to ensure that colleges and universities. Others are involved in hygienic and grading regulations and specifications research, studying and analysing natural and human Ecologists spend a lot of their time outdoors observ- are met. They analyse samples at various stages of resources, the distribution and structure of political ing and gathering information, including specimens processing to check quality. They determine whether organisations, transportation systems, urban from nature. Commercial utilisation of the ecologist's raw foodstuffs are suitable for processing, and seek systems, agriculture, industry, regional development, skills has increased along with media and public methods to make products usable. The food scientist maps, aerial photographs and data from satellites. interest in conserving our limited resources. Large and technologist also performs a fair amount of Maps, graphs and diagrams may be constructed. building projects, particularly in areas regarded as administrative work and supervision. Expertise in the fields of decision-making, environ- being ecologically sensitive, cannot go ahead in these
33 Occunations mental resources provide research backgrounds for finishing of the leather. Leather chemists learn to other jobs. A basic herpetologist studies the origin of these process any type of leather and how to use the tests animals, their interrelationships with other species, that determine the quality of the leather. GEOHYDROLOGIST relation to the environment, behaviour, growth and Geohydrologists apply their knowledge of geophysi- development, genetics, and distribution. Basic MARINE BIOLOGIST herpetologists also work in museums as taxonomists cal techniques to locating sources of underground Marine biologists study the animals and plants that where they are responsible for naming and classifying water and establishing its quality. They also locate the live in the sea. They look at how the organisms species. positions of waste-disposal dumps and evaluate interact with each other, their distribution and the ground water pollution. Underground water is an effect of various environmental factors both natural Applied herpetologists work as curators of reptile important resource in South Africa and geohydrolo- and those that can be attributed to humans on their parks or in the reptile sections in zoos, and in other gists offer expert advice to its users. The job involves environment. The aim of these studies is to reach an positions where they manage the breeding of reptiles both office work and fieldwork. understanding of marine life and, by doing so, ensure and amphibians. They also work in positions where that the sea continues to yield its valuable food they are required to educate the public in respect of GEOLOGIST supply. these species. Geologists study the structure, composition and history of the earth's crust. They locate and obtain The field of marine biology is roughly divided into HORTICULTURIST specimens they wish to investigate by drilling, research and technical work. Researchers study the collecting, or examining samples. The physical and Horticulturists seek to enrich the beauty of a city, marine system as a whole or focus on a particular chemical properties of these specimens are then town or suburb and provide better recreation marine species. Technical marine biologists are more examined in laboratories. When this is completed. facilities. They try to improve the quality of plant involved in tasks such as collecting samples, building geologists write reports on the results of their varieties such as fruit trees, vegetables and flowers. and testing equipment and analysing data Marine investigations. biologists are concerned with the effects of pollution Their work can be divided into four different on marine life, the effect of introducing commercially Geological research may help in locating mineral spheres:(l) in parks and decorativeareas where they imported species into the waters, identifying ecol- deposits, predicting earthquakes, and advising on the act as parks administrators and are concerned with ogically sensitive areas and assisting in establishing suitability of sites for buildings, dams and highways. layouts and cultivation of plants in landscapes, parks the ecological effects of projects like the construction Geologists usually specialise in one or more of the and public gardens, (2) in commerce where plants are of harbours and piers. following general areas: earth materials, earth propagated and seeds produced for marketing by processes, or earth history. nurseries, (3) in supplementary products where they MARKET RESEARCHER work as researchers, advisers and salesmen of Market researchers help companies to improve their chemicals, fertilisers and horticultural elements, (4) in Geology is a very broad-based science which draws products and increase sales potential. from virtually every other science including natural, research where they attempt to develop improved varieties. engineering and economic sciences. We can They are concerned with the factors affecting distinguish between the following careers within marketing activities, which may vary widely. They geology: general geologist, engineering geologist, collect, analyse and interpret data to determine the They also work on environmental and pest control. geohydrologist, palaeontologist and geophysicist. appeal of products or services, study the effectiveness The horticulturist scientist's work involves his The knowledge obtained from geological research is of company advertising and advise management on working closely with engineers, landscape architects, used in a wide variety of ways, from the plaster on sales and distribution policies. walls of buildings, where lime and other mixtures are environmental conservationists and town planners. used, to the discovery and refinement of oil and other They conduct surveys to determine the acceptability HYDROLOGIST energy sources. of new products, comparing these with existing and Hydrologists study and do research on the waters of competitive items, and making suggestions regarding GEOPHYSICIST the earth, and on their distribution on and below the packaging and product names. Market researchers Geophysicists study the earth's physical features surface of the earth, as well as in the atmosphere. also make detailed studies of sales records to including its atmosphere and hydrosphere. They determine peak periods and trends, to help plan sales examine and measure seismic, gravitational, They try to secure the optimal utilisation of the campaigns and set reasonable goals. electrical, thermal and magnetic forces, using the country's water resources by advising civil engineers principles of physics, mathematics and chemistry. on the flow of rivers and on where to build the most They analyse data to compute the earth's shape,to economical water schemes. They also advise design The market researcher works closely with the estimate its composition and the structure of its engineers on the frequency and magnitude of floods marketing manager. He provides the marketing interior, to determine the flow patterns of ocean tides in order to minimise flood risks and to ensure the manager with the information required for the and currents, and to help locate petroleum and best operational procedures for flood control and decisions-making process. At some companies the mineral deposits. They also investigate the origin and during drought periods. work of the marketing manager and market re- activity of volcanoes, glaciers and earthquakes. searcher is done by one person, who is usually called They identify underground water resources, evaluate the marketing manager. They compile data to prepare navigational charts and the effect of man's activities on the quantity and maps, predict atmospheric conditions, prepare quality of water. and study the interaction between MATERIALS SCIENTIST components within the hydrological cycle. environmental reports and establish water supply and Materials scientists study the structures and proper- flood-control programmes. Some may study other ties of various materials such as metals, alloys, ICHTHYOLOGIST planets. Solid earth, fluid earth and the upper ceramics, semiconductors and polymers, to obtain atmosphere are three general fields of study for Ichthyologists are life scientists specialising in the research data. The purpose of these studies is to geophysicists. Geophysics is connected to a number study of fish. They specialise in one of the following understand and characterise materials and to develop of techniques which can be employed to solve a areas: aquaculture which is the study or practice of new materials for commercial and scientific benefit. specific problem. The most important of these are fish farming and management; fisheries science, The financial yield of selling end-products or finished the gravity technique, the magnetic method, seismic which entails the study and management of harvest- products is generally much higher than selling natural techniques, electric and electromagnetic methods ing fish for human consumption; and conservation. resources that are still in ore form. The primary and radiomagnetic methods. Most ichthyologists have varied and interesting jobs, function of the materials scientist is to find and working both in the field and the laboratory. Less develop creative and economical ways of converting HERPETOLOGIST time is spent in the field in the more commercial natural resources into end-products. This covers a A herpetologist is a zoologist who specialises in the sectors of the industry, such as fisheries science. very broad spectrum and materials scientists are to study of reptiles and amphibians, for example be found performing a range of different functions in snakes, lizards, crocodiles and frogs. Herpetology can LEATHER CHEMIST various industries. be split into two broad categories: basic herpetology, A leather chemist applies his or her knowledge of which is the study of reptiles and amphibians for its chemistry, biochemistry and microbiology to the Materials scientists usually specialise since there is own sake, and applied herpetology, which entails process of tanning leather, that is converting raw such a wide variety of environments in which they can applying the information gained in basic herpetology animal hides into leather. The process entails the apply their knowledge and skills. Some of theses to a particular situation. preservation of the hides, tanning of the hides and areas include the following: guiding technical staff in
34 Occupations developing materials for a specific use in a projected academically and conversant with meteorological interest and the observation, measurement and product; mining and processing materials: extracting practice. control of radioactivity and radiation. certain elements from minerals; processing minerals into materials such as metals, ceramics and plastics; OCEANOGRAPHER using materials in engineering structures; disposing Meteorologists usually specialise in one of the The oceanographer studies the physical and chemical of waste materials; managing a fumace or rolling following disciplines: dynamic and synoptic meteor- properties of the ocean. This work comprises mill; and conducting laboratory experiments in the ology, numerical weather prediction, physical geological, geophysical and geochemical surveys, as production of materials to confirm the feasibility of meteorology, the microphysics of clouds and well as research into the dynamics of ocean currents, processes and techniques for potential users. climatology. the interaction between wind and waves, and temperature and humidity on the water surface. MATHEMATICIAN MICROBIOLOGIST / BIOTECHNOLOGIST Mathematicians fall into two broad categories. The work of the microbiologist/biotechnologist is to The five branches of oceanography and their fields of Theoretical mathematicians advance basic theoretical study microscopic organisms such as bacteria, algae, study are: knowledge in mathematics by developing new or fungi. These scientists isolate and grow organisms marine biology (study the occurrence, distribution concepts and principles and new relationships for close examination under microscopes to deter- and development of plant and animal life) between existing concepts and principles. mine where these organisms occur, what they do, -physical oceanography (studying the physical which are harmful and which are beneficial to man. properties of the ocean - such as the temperature, Applied mathematicians develop theories, techniques Tasks are determined by the type of employer. They salt content, waves and sea currents) and approaches to solving problems. They deter- may for example study the appearance and activities marine geoscience (studying underwater land mine the most effective methods for the solution of of harmful organisms in food to determine whether formation and physical composition of the ocean these problems by the application of relevant these foodstuffs are fit for human consumption. floor) mathematical principles. They may use mathematical marine chemistry (studying the chemical composi- theory to design and improve statistical methods for tion of sea-water and the reactions of chemicals on collecting and analysing numerical information and A medical microbiologist/biotechnologist may try to the sea environment; also looking at how pollution estimating unknown qualities. isolate an organism responsible for causing a certain influences the sea environment), and coastal and disease and, after research, try to develop a vaccine to ocean engineering (concentrating on the develop- The work in these two categories often overlaps. prevent the disease, or antibiotics to treat it. Microbi- ment and maintenance of harbours, inlet pipes for Mathematicians may teach in schools, colleges or ologists/biotechnologists employed by industries sea water and the management of coastal areas). universities. They try to find solutions for problems may be involved in product and process control. within a wide range, for example medical -, agricul- Some microbiologists/biotechnologist do research or ORNITHOLOGIST tural-, engineering-, ecological and genetics teach. Some are responsible for administrative duties An ornithologist is a scientist specialising in the study research. such as the supervision of laboratory personnel. of birds. Ornithologist study the behaviour of birds and fluctuations in bird populations. Most of the MEDICAL PHYSICIST MINERALOGIST information gained in this research is applied to see page 18 Mineralogists study minerals in terms of their form, conserving rare species of birds and educating the crystalline structure and physical and chemical public. Education can take the form of museum work METALLURGIST / METALLURGICAL ENGINEER properties. Apart from this study, they may also talks, displays and answering queriesor it can apply their knowledge in the applied fields of entail the ornithologist going into communities and Metallurgists are also known as metallurgical geological exploration, metallurgical extraction, civil educating farmers in respect of conserving or engineers or material scientists. Metallurgy is the art engineering, the fire-resisting materials industry, controlling the bird populations on their farms. of extracting metals from ore and forms an essential ceramic manufacture, cement production and part of the mining effort. building research. PAINT TECHNOLOGIST Extraction technology is able to determine whether a Paint technologists apply their knowledge of analytical mineral deposit is worth mining. This is the field of Petrographic microscopes are used in the research for chemistry to the tasks of analysing, testing and the metallurgist, or metals expert, who uses physical the analysis of reflected light from polished surfaces researching paint. of opaque minerals, and light shining through and chemical means to free metal from ore. He transparent/translucent minerals or finely ground refines the metal and ultimately blends it with other Technologists working in the analytical field need to mineral powders. If microscopic analysis does not metals to meet the alloy requirements of modem acquire an in-depth knowledge of the chemical and give exhaustive results, x-ray apparatus and electron industry. physical properties of the numerous colour pigments, micro-analysis are used. solvents and binding agents available. They also need The graduate metallurgist can choose between to be familiar with the equipment used in the NUCLEAR SCIENTIST / NUCLEAR PHYSICIST becoming an extractive metallurgist in the mining manufacture of paint. Paint technologists who work industry, or joining one of the metal-processing The field in which nuclear scientists and physicists on the testing side of this field test paints for various industries, though the dividing line between extrac- work covers a broad range of activities, from qualities, including their application, drying and tion and processing is not easily made. Apart from designing and monitoring nuclear power plants to resistance to water decay and corrosion:They also producing metal products the metallurgical engineer developing medicines and equipment to help test the success of substituting new elements in must also be able to determine the cause of defects diagnose and treat medical problems. The work in paints when materials become too expensive or in metals and prescribe possible solutions. this field is seldom routine and calls for a high degree difficult to obtain. of original thought. It is also highly complex, entailing METEOROLOGIST the use of very sophisticated electronic equpiment The most experienced paint technologists usually and computer-controlled systems, so scientists move into research, where they study existing and A weather service is basically a scientific service and generally specialise in one or other aspect. develop new products, for the benefit of both the the rendering of an efficient service is the primary aim consumer and the paint manufacturer. of the Weather Bureau. In this century of rapid The various specialisations in nuclear sicence and technological development, equipment with an physics include the following: basic and applied PALAEONTOLOGIST increasing degree of sophistication - such research in nuclear physics and chemistry, radiation meteorological satellites, automatic weather stations A palaeontologist is a scientist who specialises in the physics and biophysics, medical physics, health and powerful electronic data processing systems is investigation of fossils. By studying the markings on being used to capture and process meteorological physics and nuclear energy; the production of radio- stratified rocks and fossilised remnants, palaeontolo- data. The meteorologist is responsible for the isotopes by means of nuclear reactors for use in gists have been able to establish, with amazing operation of these computerised systems. medical treatment, the sterilisation of medical accuracy, a record of the evolution of life through equipment, the extension of the shelf life of fresh geological time. Management is therefore an important function of produce, determining position and size of organs and meteorologists who must ensure that the Weather tumours and investigation of the movement of air, Palaeontologists combine their findings with those of tides, sea currents and sand to control pollution; the Bureau keeps pace with scientific and technological other scientists such as geologists, geographers and purification of irradiated material; the development developments, that high standards are maintained meteorologists, to reconstruct a progressive history of techniques to analyse samples which are of and that its staff receives the necessary training. of life on earth since ancient times. Geologists have Meteorologists must therefore be well trained industrial, mining, geological or archaeological been able to use the fossils to work out the order and
35 arteltnatinnq 23 the age of the rocks. It is due to the work of palae- STATISTICIAN The wine-maker blends wines according to formulas ontologists that we now have some knowledge of Statisticians may work in either the academic or knowledge and experience in wine-making. what led to the extinction of certain species and the (research) or the practical (applied) field. Although modem wine-makers have access to origin of others, and that we have a fairly accurate laboratory equipment to assist them in blending, the picture of ancient plants and the great dinosaurs that Academic statisticians generally have exceptional sensory aspect of tasting for selection in blending still once roamed the earth. mathematical ability and usually possess doctoral remains a vital part of the process. Wine-making is degrees in statistics. They are primarily concerned therefore both a science and an art. PHARMACIST with the training of students and with basic statistical see page 19 research in a chosen specialised field.They are Wine-makers may also be called upon to present usually involved in developing or refining theories. their wines personally to various markets. PHYSICIST WOOD SCIENTIST A physicist is a scientist who studies the physical Practical statisticians work mostly in research world. Physicists study the fundamental properties of institutions and private organisations. where they A wood scientist conducts research into the composi- matter. These ranges from the microscopic world of help plan and devise experiments or projects to tion, properties, behaviour, utilisation, development, subatomic and molecular particles to the macroscopic collect and analyse information. They may work in treatments and processing of wood and wood world of cosmology and astrophysics. Systematic fields such as engineering, chemistry, medicine, products. observation and experimentation provide the data psychology and agriculture. Typical examples of from which theories describing the fundamental projects are the following: determining the efficiency He applies the knowledge gained from analysing the forces and laws of nature can be developed. of a certain drug in medicine, or a fertiliser in physical, chemical and biological properties of wood agriculture, or determining the profitability of a to developing and improving technologies for Physicists may specialise in nuclear physics, the particular breed of cattle in a special area. processing wood into pulp, paper, building and physics of condensed matter, environmental physics, construction timber, chip, fibreboard and laminated medical physics and biophysics,solar-terrestrial SYSTEMS ANALYST beams. Wood scientists usually specialise in specific physics, astronomy and astrophysics, and engineer- The systems analyst determines whether an under- areas such as research, quality control, marketing and ing physics, etc. They do basic research to increase taking can profit from the use of a computer. He sales, materials engineering, management, admini- scientific knowledge or do directed/applied research analyses the undertaking's requirements, in order to stration, manufacturing, production, and process to develop new/ improved materials or products. design a system, writes a comprehensive programme development. Many physicists combine physics and related sciences and system specifications, and consults the users of e.g. biophysics or geophysics. Physicists also teach in the system to ensure higher production. Systems ZOOLOGIST secondary and tertiary educational institutions. analysts develop methods of using computers to Zoologists study the origin, growth and development. solve problems. structure, environment, classification, behaviour and PHYSIOLOGIST life processes of animals. Because this field is so see page 19 First, they discuss needs or problems with manage- broad, zoologists usually specialise in a type of ment or with specialists to determine the exact nature animal or animal family, or in certain aspects of SILVICULTURIST of the problem. They collect, organise and evaluate animal life, such as in genetics or animal classifica- all relevant information for fulfilling these needs and tion. Silviculturists are managers dedicated to long-range solving these problems. conservation practices. They protect our natural flora With this knowledge they devise ways to get the data Some zoologists study live animals in controlled or and fauna and produce a sustained yield of timber by into the computer and define the computer process natural settings, while others dissect animals to study cultivating indigenous forests and through afforesta- needed to tum the raw data into useful information. their anatomy and physiology. Zoologists may do tion with species to ensure the country's self- Systems analysts also have to decide how the data research into the diagnosis, the prevention and the sufficiency in respect of its timber, wood and pulp will be stored and how to apply the results of treatment of both animal and human diseases. Some requirements. computer processing. Finally, they check the whole zoologists work as consultants or curators for zoos, operation to be sure it functions property and they aquariums or wild life parks. Tasks are determined Silviculturists manage state and private plantations, correct errors. In small organisations, systems by the zoologist's speciality and by the employer. nurseries and indigenous forests. They also plan and analysts may also perform programming duties. manage catchment areas, nature reserves, wilderness Ecologists study animals in their natural habitat to areas and drifting sands. They institute and manage WEATHER OBSERVER observe how they adapt to conditions, how their recreational facilities and hiking routes. Some are numbers are controlled and how they fit into the responsible for timber conversion plants and for The primary function of a weather observer is to observe weather conditions every day at scheduled community of other animals, plants and bacteria of research on all the aspects of forestry, such as timber which they form a part. Physiologists are interested in technology, tree breeding, forest entomology and times, compile the information into meteorological messages according to intemational codes and the way in which the organs of an animal's body tree pathology. Some may teach or advise on function. afforestation. transmit it to different centres. Weather observers measure temperature changes, humidity, atmos- SOIL SCIENTIST pheric pressure, and wind speed and direction twice a day. They use precision instruments to assist them in Nature (planteandeiiiiitals) A soil scientist applies his or her knowledge of soil their tasks and transmit the data by means of a properties to the task of determining what particular radiosondea sophisticated piece of equipment that types of soil are capable of yielding, and what effect makes soundings well into the stratosphere. Weather AGRICULTURAL EXTENSION OFFICER alternative practices will have on soil productivity. observers are also responsible for ensuring that this The primary responsibility of an agricultural extension Some of the duties he or she performs include precision equipment is kept in working order. classifying soils according to standard types, officer is to keep farmers informed in respect of new developments in the agricultural sector. He or she conducting experiments on farms to determine the WINE-MAKER best soil types for different plants, analysing soils to encourages the farmer to adopt new, improved establish their chemical and mineralogical relation- A wine-maker (oenologist) directs and co-ordinates methods of farming. The agricultural extension ships to plant growth, and investigating the effect on all the activities of the production of wine in a winery. officer uses a variety of methods to reach the farmer. different soil types of tillage, fertilisation, crop rotation He contracts with growers to provide grapes for These include organising study groups for farmers. and environmental factors, including pollution. processing or, if the winery is attached to a vineyard, 'farmer days', demonstrations, lectures and literature. works closely with the viticulturist (the person who as well as informing the media. He also makes A soil scientist works both in the laboratory and in the cultivates the grapes) to determine whether the personal visits to farmers to discuss new develop- field. He works closely with other agricultural experts grapes are ready for processing into wine. The ments. and with farmers, ensuring that his knowledge and winemaker is responsible for overseeing the testing research are utilised to improve soil-management and crushing of the grapes, for fermenting the juice. AGRICULTURAL INSPECTOR for fortifying, clarifying and ageing the wine, and for practices. Soil scientists can specialise in soil classifi- see page 14 cation, soil mineralogy, soil biology, soil chemistry, finishing the wine - which includes cooling, filtering soil physics, soil fertility and soil decay. and bottling.
36 24 Occupations AGRICULTURAL TECHNICIAN recreational activities like hiking and picnicking in Agricultural technicians assist agriculturists, farmers these areas. Foresters also conduct research to After a call has been received, these workers hasten and ranchers with a variety of tasks related to ensure the preservation of trees. Other foresters to the emergency scene observing traffic safety rules different aspects of agriculture. These include may work as security and training personnel, and legislation pertaining to emergency vehicles. planning, research and the application of agricultural educating the public about the importance of trees. Upon arrival at the scene they examine both the knowledge. They help farmers and other land patient and the situation to decide upon suitable managers to make the best use of their land without HORTICULTURIST treatment. They also make the site safe and manage damaging it. They may suggest terracing land in the see page 22 bystanders. The patient is then placed on a stretcher event of erosion or growing hedges to act as and taken to hospital. They supply a report of the windbreaks. Some serve as technical advisers to soil ICHTHYOLOGIST patient's condition and treatment. At the base station they clean the vehicle and replace emergency care and water conservation committees. On the cattle see page 22 farming side, technicians assist veterinary surgeons supplies. and guide and assist farmers and ranchers in the NATURE CONSERVATIONIST treatment of diseases and the general handling of DENTAL ASSISTANT animals. They also instruct on the classification and The primary objective of a nature conservationist is to Dental assistants work beside dentists while they grading of skins, wool and mohair. conserve and manage natural resources. This general examine and treat patients. They are not allowed to task may be broken down into the following aspects: work on their own and do not have their own There are three types of agricultural technicians: managing the animal populations and the environ- consulting rooms. research, extension and resource. The agricultural ment in designated nature reserves; enforcing research technician assists the agricultural researcher conservation laws, which includes dealing with Assistants see that patients are comfortable, prepare with research projects. The agricultural extension poachers; environmental education programmes; them for treatment and draw their records from the technician collects information to identify shortcom- creating inventories of fauna and flora resources; filing system. They hand dentists the proper ings in the farming industry and the misuse of conducting environmental-impact studies for instruments, keep the patient's mouths clear, and mix resources. The agricultural resource technician is developers; investigating wildlife management solutions, filling and impression materials. They are concerned with the classification and mapping of a problems; drafting management plans for conserva- responsible for the cleaning and maintenance of all region's natural resources, the planning of farms and tion areas; developing publicity material and liaising dental equipment. the misuse of resources. with the media; personnel administration, labour relations, administering relevant legislation and Dental assistants may not take X-rays but are permits, and financial administration. ECOLOGIST responsible for the developing and filling of the films. see page 21 Dental assistants also do the necessary clerical work ORNITHOLOGIST to keep patients' dental and personal details in order. ENTOMOLOGIST see page 23 DENTAL THERAPIST see page 21 TIMBER / WOOD TECHNOLOGIST see page 17 FARMER Timber technologists are essentially trained to function as line managers in saw mills or other FIRST-AID WORKER Farmers combine agricultural and business methods timber processing plants. They apply their practical A first-aid worker is essentially an industrial nurse in operating small or large farms. Their objectives are and academic knowledge of timber and timber to make their farming activities productive, profitable who renders first aid and subsequent treatment to processing technology to the process of converting injured or ill employees at factories, mines, construc- and professional. On small farms they may perform raw timber to saleable products like plywood or the actual labour and also plan and direct farming tion sites and other places of employment. Some of particle board, thus ensuring quality standards and the duties that first-aid workers can expect to operations. On large farms they perform a wide efficiency. range of duties, such as determining land use, perform include: sterilising, disinfecting, anointing and bandaging minor cuts and burns; applying planting, fertilising, spraying, cultivating and harvest- A timber technologist needs to acquire expertise in a ing procedures. artificial respiration or administering oxygen in cases number of different aspects of the industry, including: of suffocation or asphyxiation; administering the acquisition of timber, the storage of raw materials They direct the care and feeding of livestock. They medications such as aspirin or antiseptic solution to and end products, the conversion of raw materials, relieve pain or prevent infection until the patient can evaluate existing practices as well as suggestions for transport, the management and training of staff, cost improvement. They maintain financial records, receive professional care; and giving prescribed control, plant safety, quality control, and equipment medicines and treatments for illness. determine labour needs, and hire and supervise maintenance. Qualified timber technologists normally workers. The topography, climate and vegetation of begin their careers in junior management positions an area determine the type of farming practised. If the company or mine has an infirmary the first-aid and progress to senior management as they gain worker changes beds, cleans equipment and experience. generally keeps the infirmary in an orderly condition. First-aid workers also assist doctors who are called The farmer is also responsible for managing his work WINE-MAKER force and performing a number of administrative out to attend emergency situations on site and keep duties like bookkeeping, the buying of supplies and see page 24 personal and medical records of all employees. the selling of products. WOOL-CLASSER MASSEUR FORESTER The primary responsibility of a wool-classer is to The main responsibility of a masseur is to massage A forester's activities vary according to his working ensure that wool is sorted straight after shearing customers and administer other body-conditioning treatments. Modem masseurs are highly-qualified area.All foresters, however, aim to protect trees and according to the classifications set by the National help to manage their utilisation. Woolgrowers' Association of SA. In addition he must professionals; the work that they do is very similar to oversee and co-ordinate the whole shearing process that of health therapists. They use either electronic The majority of foresters are placed at forests or by liaising with the wool farmer, shearing team and vibrating equipment or manual techniques such as plantations where they initially serve as assistants and other woolworkers. kneading, rubbing and stroking flesh to stimulate later as foresters in charge. At a plantation their blood circulation, relax contracted muscles, relieve duties include the raising of seedlings in a nursery stress or pain and facilitate the elimination of waste and the planting of trees. They also co-ordinate and Sri: Nursing & matter. Masseurs who acquire skills in specialised assist with the pruning, thinning and felling of trees, massage techniques such as aromatherapy, reflexol- the sawing of felled trees into logs and their loading. ogy and manual lymph drainage are able to serve a wider client base. Masseurs also recommend They bum firebreaks and protect the forests against AMBULANCE AND EMERGENCY CARE WORKER fire and damage. They may have to maintain roads, particular diet and exercise routines for their clients. Ambulance and emergency care workers resuscitate erect buildings and maintain telephone lines. and stabilise the condition of critically ill or injured NURSE persons by applying emergency care prior to In a conservation area foresters are responsible for The activities of a male/female nurse include curative, transporting them, and ensuring the continuing care conserving the fauna and flora, as well as the soil and preventative, promotive and rehabilitative health care/ of patients en route to hospital. water resources. They also manage and plan for families, communities and individuals. Activitie'
nrrtiinationc such as the following serve as examples: taking blood Promotion &Persuasion -7-- .7-- pressures and temperatures, handling samples for Medical representatives need to build brand loyalty to laboratory tests, applying medication and giving ensure that products that have taken several years injections, putting in and removing stitches, prepar- DIPLOMAT and a great deal of expense to develop are continu:- ing patients for medical checkups and for operations, ously prescribed. They also need to create brand Diplomats are representatives of their own country in applying and changing dressings on wounds, awareness for new medicines and introduce them in a countries to which they are accredited. They note and assisting surgeons and anaesthetists during opera- highly competitive market that is also fraught with interpret objectively the political, military, social and tions, assisting obstetricians in maternity wards and controversial issues such as the possible introduction economic developments in foreign countries to acting as midwives, performing health examinations of policies to enforce the use of generic medicines in obtain information of interest to their own govern- at schools, caring for the mentally ill in psychiatric ment state medical institutions. sections, and acting as secretaries in doctors' consulting rooms. PUBLIC RELATIONS OFFICER They promote exports to the countries where they are stationed. They disseminate information about Public relations is a management tool aimed at Other duties indude the managing of wards or commercial, economic and industrial conditions and bringing people together to promote understanding. departments, the updating and keeping of records, opportunities back home. South African diplomats Public relations officers use every means of commu- and the ordering of medical supplies and equipment. may renew passports to South Africans abroad, nication at their disposal to establish efficient two- The qualified nurse also acts as supervisor of student grant visas to foreigners who wish to visit the way interaction between their companies and other nurses and other nurses who are in training. Nurses Republic or entry permits to immigrants who wish to groups of people. work long hours and in some hospitals are required settle here. They strive to build up contacts with to work shifts. foreign states to ensure a constant exchange of views Public relations officers (PROs) help people and and the establishment of mutual trust, and they organisations gain public acceptance by explaining OCCUPATIONAL THERAPIST negotiate agreements with other states. the aims, objectives and methods of their organisa- see page 18 tion, and by building and maintaining a favourable ESTATE AGENT image. They gather and give out information for ORAL HYGIENIST newspaper items, magazine artides and news spots Estate agents show and sell all types of immovable so that the public will be aware of that employer's Oral hygienists are concerned with the promotion of property such as houses, farms, factories, offices and projects and accomplishments. The PROs also oral health and the prevention of dental disease. workshops. The estate agent operates as a link arrange and conduct public contact campaigns which They work under the supervision of a dentist and may between the seller and buyer. work in a dentist's private practice, or for the Depart- may include setting up speaking engagements, writing speeches, speaking for employers at commu- ment of Health in hospitals, dinics or schools. They obtain lists of properties for sale by following nity functions, planning company conferences and leads obtained through newspaper advertisements managing fund-raising drives. They may prepare Oral hygienists may perform the following duties: and personal contacts. Once a property is listed, they stockholders' reports or work to improve em- removing stains and tartar (calculi) from teeth and must then become familiar with the property so that ployer/employee relations. polishing them; -applying decay-preventing agents they can show it to potential buyers.Estate agents to teeth; performing diagnostic tests for interpreta- interview potential buyers to determine their needs. tion by the dentist. They are also, capable of taking The public relations officer may work in a variety of areas or in one specific field. We can distinguish intra-oral and extra-oral X-rays. Another task is to Once a buyer has decided on buying a certain between the following fields: consulting, community assist the dentist during dental operations. property the agent negotiates a price and terms involvement, employee communication, industrial acceptable to buyer and seller. The estate agent affairs, media liaison, corporate advertising, videos, helps to arrange a mortgage or other method of speeches, organising of special events and crisis The oral hygienist is a professional health educator payment with a bank, building society or the seller. communication. with his own consulting rooms and should not be He does the follow-up work to ensure that the confused with the dental assistant, who merely transaction runs smoothly. Once the transaction is PUBLISHER assists the dentist. complete, the estate agent receive his commission. - see page 14 PHYSIOTHERAPIST INSURANCE AGENT TOUR GUIDE - see page 19 Insurance agents sell policies to individuals and businesses to provide protection against future losses The main responsibility of a tour guide is to escort PODIATRIST / CHIROPODIST and/or financial pressures. groups of tourists on bus or minibus trips and see page 19 provide them with factual and interesting information Agents must analyse the needs of their dients and about the sights they see. A group of tourists has SPEECH THERAPIST AND AUDIOLOGIST help them plan the protection that meets these probably previously been on several guided tours, so needs. Insurance protection may be for motorcar, a tour guide's presentation needs to be dynamic to see page 19 home, business or other property; for protection of a hold their interest. A tour guide may be allocated a family if the breadwinner dies; or for protection half-day sight-seeing tour or longer tours, in which VETERINARY NURSE against hospital and medical costs. Insurance agents case he will be responsible for ensuring adherence to The prime responsibility of a veterinary nurse is to also provide their clients with information on the tour itinerary. Tour guides also need to provide assist the veterinary surgeon. The duties that he or investment policies and funds. A client may, for tourists with information regarding currency, drinking she will be expected to perform indude the following: example, invest money for his child's education. water, restaurants and tipping. They should always be assisting at operations; preparing the theatre and the able to deal with enquiries from the tour group. instruments for operations and deaning them Insurance agents also help their clients to obtain afterwards; looking after animals recovering form claim settlements. In addition, they provide follow- TRAVEL AGENT anaesthetics; X-rays; physiotherapy; assisting at up services to keep their dients' insurance pro- Travel agents make travel arrangements based on the artificial insemination procedures; and dressing grammes up to date. needs, budgets and tastes of customers. Clients may wounds. include individuals, families or groups, and business MEDICAL REPRESENTATIVE people. Veterinary nurses are usually required to combine The main function of a medical representative is to their general nursing duties with reception work and market the medicines, diagnostic tests, dressings and Agents give information to customers and answer basic administration. They have to 'book' patients in, other medical supplies manufactured by the phar- any questions concerning transportation, passports, which means making all the necessary enquiries maceutical company at which he or she is employed. visas, currency regulations, tourist attractions, hotel regarding the animal's illness and completing the Representatives need to set up a disciplined and reservations and the booking of flights. The travel required documentation. This will usually be done on structured calling system to enable them to pay agent also makes other spedal arrangements which a computer. They also advise their patients' owners regular calls to doctors, pharmacies and hospitals, customers may request, such as car rentals, sight- on post-operative care and inoculations. since their target market is the professionals who will seeing trips, or traveller's cheques. prescribe and dispense their products. Increasing the size of the client base is an important aspect of this Some agents, especially those who are self- job. employed, do promotional work, such as meetings with business managers to suggest company- ing or decreasing the number of workers, setting new COST AND MANAGEMENT ACCOUNTANT sponsored trips. Travel agents work in independent standards of performance, or the most effective use The function of a cost and management accountant is travel agencies throughout the country. Some agents of accommodation. Recommendations based on to prepare and present accounting information, to own their own agencies. their research findings are presented to the manage- assist management in the formulation of policies and ment. the planning and control of the operations of a manufacturing industry. He is concerned with the Routine Clerical. economic viability and future planning of a company, Routine-Numerical with the emphasis on the manufacturing operations. ARCHIVIST Cost and management accountants apply accounting and costing principles, methods and techniques, as see page 11 ACCOUNTANT well as economic principles, to determine costs and Accountants are at the focus of all business activities. the analysis of savings/excesses compared with CHARTERED SECRETARY Their main responsibility is to analyse and evaluate previous experience or with budgets. Management financial information and effectively communicate the see page 15 will require an update of this information at regular results to senior management to enable them to pre-determined intervals. Compiling the information make good business decisions. Very often an RECEPTIONIST also entails examining factors such as the under- accountant is part of the senior management team, in utilisation of a plant, low productivity and the cost of Receptionists officially greet customers and visitors which case he or she will use the information to make holding excessive materials or stocks. The other and direct them as to where they have to go. Job decisions, convince his or her senior management aspect of cost and management accounting is to duties vary greatly, depending on where they work. colleagues of a certain course of action and then provide the management with analyses and figures The receptionists is usually the first person in a implement that action. The services of accountants that will enable them to make forecasts in respect of company the client sees or speaks to.It is therefore are indispensable in todays business world as they the profitability of new products, processes and important that the receptionist make a good impres- provide the knowledge and skills that enable expansions. sion on the client. businesses to run effectively. CREDIT MANAGER The general duties of a receptionists include answer-. This pivotal role in business is the reason that many ing telephone calls, making appointments, the accountants rise fairly quickly to senior management see page 15 handling of correspondence, answering enquiries and positions. Chartered accountants, because of their the filing and completing of documents. We can rigorous training, are the accountants most in INTERNAL AUDITOR distinguish between three different types of recep- demand. Accounting graduates with lower qualifica- An internal auditor is the person who examines and tionists. tions will probably work as accounting officers and vouches for the accuracy and completeness of will not usually rise to the same levels of seniority. bookkeeping records and the financial statements of Dental and medical receptionists arrange appoint- any business establishment. He independently ments and keep clients records. Some handle the Accountants can specialise in any one of the following appraises functions within an organisation to payment of accounts. In addition, they see to the fields of accountancy: auditing; pure accounting; examine and evaluate these activities as a service to sterilisation of medical instruments and keep them taxation: legal accounting; financial accounting; the organisation. ready for use. Receptionists in hotels welcome management accounting; computer accounting; cost visitors to the hotel, allocate rooms, and see to it that and management accounting. He provides the management of the organisation particulars such as names and periods of stay are with analyses, appraisals, recommendations, counsel, entered in the register. They are also responsible for BANK OFFICIAL and information about the activities he reviews. He room keys and the payment of accounts. Reception- analyses compliance with policies, procedures and ists (in general business) are the links between the Banking started because man needed to keep his practices, and also evaluates established controls, and firms and customers. They have to refer clients to the money safe. Presently it has expanded to fulfil man's appraises the efficiency, effectiveness and economy approptiate staff member. They usually work in every need in money management and financing. of operations. banking and financial institutions. People in banking thus work in a variety of capacities. In addition, he identifies, evaluates and handles risk. SECRETARY Bank tellers deal directly with the public in cashing cheques and handling deposits and withdrawals from He may prepare financial statements for a client, such Secretaries keep their employers' offices running accounts. Other staff members manage the different as profit and loss statements and balance sheets. He smoothly and efficiently. They do the routine tasks departments such as credit. trusts and wills, shares, also prepares detailed reports showing items such as so that their employers can attend to more demand- marketing, and foreign exchange, advising and operating costs, total assets, liabilities, volume of sale, ing duties. serving the public in these fields. Bank managers are net profits and depreciation costs. responsible for the functioning of the bank and the They take dictation, type letters and documents and development of new businesscorporate, retail and The auditor is able to act as a financial adviser due to handle incoming and outgoing telephone calls. They personal. his wide knowledge, experience and thorough keep record of office stocks and order anew when training. He acts as adviser when , for instance, new supplies run low. They file correspondence and open, CHARTERED ACCOUNTANT bookkeeping systems and computers are introduced read and direct mail. Some secretaries collect mail and advises companies and individuals on aspects The chartered accountant examines the financial from post offices and make bank deposits. They may conceming taxation, legal matters and finances. arrange dinners for management and make travel information of individual clients, corporate clients and other institutions. Based on his findings the and hotel reservations. Some may handle personnel STOCK CONTROLLER / INVENTORY AND chartered accountant suggests possible ways in files and arrange interviews between employees and STORES MANAGER management. The reception of clients and book- which his clients can run their business better, and see page 16 keeping are additional tasks. protect their investments.
STOCKBROKER WORK STUDY OFFICER When a company is in financial difficulty it is one of the chartered accountant's roles to see that the see page 16 The task of work study officers is to give advice on company pays all its outstanding debts and looks organisational and work procedures in order to raise after its employees. It is also his task to deal with the VALUER / APPRAISER efficiency. To do this they observe the workers and tax- and accounting systems of the company. work procedures to determine the amount of time In general, valuers or appraisers establish the monetary worth of property, merchandise, business and the movements needed to perform each task. His work setting may change from day to day. The assets, objects d' art, precious stones, motor vehicles They then analyse the data and recommend changes chartered accountant works in an office, but is also and household effects. In recent years the term to make the work simpler and more effective. involved with all the critical areas of a business 'valuer has been used to describe a person who operations, from accounting to the making and determines the value of immovable property, while They classify work and develop means of measuring selling of the product and even the marketing. productivity and suggest incentive schemes. They the term 'appraiser is used to describe a person who investigate computerisation, new filing systems and determines the value of any property, merchandise, labour-saving devices. They may suggest rearrang-
3 9 Occupations 27 goods and assets for purposes of managing de- increasing production and analysing the costs and ceased estates. benefits of distributing and consumable goods and ECONOMIST services. Economists analyse and describe the relationship Valuers and appraisers use the most readily available between the supply of and demand or goods and comparable facts and examine goods for conditions Conducting research on economic trends such as services. They also study how the goods are made, and authenticity. Valuers may provide information for energy costs, inflation, interest rates, imports and supplied and used. the parties concerned with the sale or expropriation exports and employment is another important aspect of property, establish the value of security offered for in this field of work. Agricultural economists are also Economists also describe, analyse and advise on a a loan or mortgage, assess the value of properties to responsible for marketing, production, financial wide range of economic data. Some work in specific enable local authorities to raise rates, ascertain the management and policy implementation and fieldssuch as tax or wage problems and economic value of company assets and shares, evaluate the evaluation. They specialise in the fields of production policies,while others attempt to develop theories amounts of cover and claims for insurance, and economics, financial management, agricultural explaining the causes of unemployment and inflation. estimates the value of plant and machinery. marketing, agricultural policy, agricultural develop- Some economists serve as consultants to businesses, ment, operational research and agricultural environ- individuals and government departments. Govern- mental economics. ment economists assess economic conditions in the Sales country and abroad and recommend changes in ANTHROPOLOGIST government policies, if necessary. Some economists Anthropologists study customs, judicial systems, the are attached to particular manufacturing organisa- BUYER (RETAIL) economies of human groups, social and political tions, where they advise management on production organisations and the changes that cultural and social and marketing. Buyers purchase merchandise that appeals to the groups undergo through contact with each other. public and which can be sold at a profit. To estimate Such data may be applied to solve problems in HISTORIAN the amount of merchandise needed, buyers examine human relations, social work, education, health, past and present sales records and keep up with Historians use their knowledge of the past to attempt poverty and underdevelopment. The anthropologist merchandise inventories. to explain current events. Historians involved in makes comparative studies relating to human origins, research evaluate any evidence they obtain, such as evolution, races, and the cultures they have created, Buyers study their market, confer with managers and photographs, letters or verbal accounts of events to as well as the distribution and physical characteristics sales clerks and watch reports of general economic determine their authenticity and value. They then of human beings . conditions to help them in ordering merchandise. develop theories about the evidence, and present Buyers must know the quality of the merchandise and their findings in teaching, lectures or writings. the business standards of firms with whom they may This occupation is further concerned with research do business. They work closely with advertising In addition to carrying out research, historians may into the cultural and social development of civilisa- people to plan sales campaigns and window and floor teach in colleges or universities or serve as consult- tions, as well as the cultural and social development displays. ants to editors, publishers or radio and television of specific peoples and changes that occur during shows or films. their historical development. Anthropology is the ESTATE AGENT total study of human origins, development and social HOME ECONOMIST see page 26 interaction using a holistic approach and mainly qualitative research by means of participant observa- see page 11 MEDICAL REPRESENTATIVE tion. INDUSTRIAL ECONOMIST see page 26 ARCHAEOLOGIST Economists study the way a society uses scarce resources such as land, labour, raw material and STOCKBROKER see page 20 machinery to produce goods and services. Industrial see page 16 economists focus on the effect that factors such as ATTORNEY government economic policy, international trade Attorneys, also known as lawyers, give legal advice to regulations and labour relations have on the sectors Social, Legal & Economic47,1.; their clients regarding rights and obligations. They in which their businesses operates. They consider all may also serve businesses, institutions, local authori- social, political and other factorslocally and abroad Sciences ties, the government or individuals. that have an effect on the economy.
Although attorneys' specialities determine their actual At least four different types of industrial economist ACTUARY duties, basic activities are performed by most lawyers. can be identified. Industrial economists employed by see page 20 An attorney or lawyer appear in court on behalf of his large corporations on a full-time basis gather client. He therefore needs to consult with clients to information, assess the impact of industrial economic ADVOCATE determine the nature of their problems and then give factors on the organisation and advise top manage- advice. These activities may fall into one of three Advocates conduct civil and criminal cases in various ment accordingly. Industrial economists at educa- main categories: acting as agents/representatives of courts of law by appearing either for a defendant or a tional institutions conduct on-going research and any person in an action in a court of law by pleading plaintiff in civil cases, or for the State or an accused in teach. Their approach to the subject is creative and or arguing a case whether civil or criminaldrafting criminal cases, and also before other bodies such as they may develop original economic theories based legal document, and administering deceased estates licensing boards. on their research. The professional advice of these and clients' affairs. economists is sometimes sought by large corpora- Civil action results when the private interest of two tions. An attorney can handle civil or criminal cases for his parties or persons causes a dispute but where the client. Civil cases are cases in which attorneys, for State and its laws have not directly been violated or Techno-ecnomists are research-orientated and are example, assist clients with contracts, leases, wills affected such as divorces and disputes over contracts normally employed by research institutions such as and trusts. Criminal cases are cases in which and insurance claims. the CSIR. They usually have additional qualifications in attorneys act on behalf of clients who are, for a technical or scientific field. Business economists are example, charged with murder or theft. Criminal cases are instigated by the State against employed by corporations in the private sector as someone who has allegedly violated or committed an financial, marketing, production and general manag- CRIMINOLOGIST offence against the law of the country. Clients do not ers. It is their responsibility to identify areas of generally contact an advocate directly, but are A criminologist is a sociologist who specialises in potential benefit and potential disaster and make referred to him by an attorney who puts the client's research into the relationship between criminal law recommendations to senior management. case to him with all the relevant information. and social order in the causes of crime and the behaviour of criminals. Sociological research entails LEGAL ADVISER AGRICULTURAL ECONOMIST the collection of information and the analysis and A legal adviser is a lawyer who is employed by a large interpretation of data that are collected through Agricultural economists are concerned with the company or organisation to provide legal advice and surveys, in-depth interviews, case studies and other economic aspects of the agricultural sector/industry. services to both the organisation and its employees. methods. Their main responsibilities include finding ways of
40 28 Occupations Lawyers are generally divided into attorneys and career adjustment difficulties or marriage problems. collection (by means of surveys, interviews, case advocates. (3). Educational psychology- the educational studies, etc.), analysis and interpretation of informa- psychologist work in an educational environment tion and data Attorneys are, in effect, general legal practitioners. where they advise pupils, students, parents and They offer their clients services on all legal aspects, teachers on topics such as academic performance The sociologist can work in a variety of fields: social including company law, criminal law, taxation, estate and development strategies. (4). Industrial psychol- psychology, clinical sociology, political, economic and planning and personal advice. Attorneys represent ogythe industrial psychologist work in the indus- applied sociology, and research. their clients in the magistrate's court and generally trial sector with the main objective of developing the prepare cases for presentation by an advocate in the workforce to achieve maximum production. (5). TOWN AND REGIONAL PLANNER High Court. Research psychology Research psychologists may see page 10 do research work, and devise, construct and stan- Advocates specialise in giving legal opinions and dardise psychological tests. They also present papers presenting cases in court. They generally participate or write reports based on research. in litigation only when they have been instructed or Technical-Engineering. briefed to do so by an attorney. PSYCHOMETRIST Related,Technologies, Psychometrists work under the supervision of a MAGISTRATE professional psychologist who is responsible for the Magistrates may be regarded as general practitioners eventual counselling, psychotherapy or job placement AERONAUTICAL ENGINEER of law. South Africa is divided into at least 300 of clients. Psychometrists carry out the testing and Aeronautical engineering can be regarded as a branch magisterial districts, with one magistrate's court per initial evaluation of clients by means of psychometric of mechanical engineering. Practically all aspects of district with at least one magistrate, who is responsi- measuring instruments such as aptitude tests, mechanical engineering are applied in a specialised ble for applying the law. interest questionnaires and personality inventories. way into aviation, for example internal combustion These evaluations enable the psychologist to select engines, fuel, air-conditioning and heating, strength They have two main functions, namely the judicial the most suitable procedures for counselling, of materials and hydraulics. function and that of district administration. Magis- psychotherapy and job placement for individual trates preside in both magistrates' and regional courts clients. Psychometrists conduct interviews, make The aeronautical engineer is regarded as competent and have jurisdiction over civil, criminal and juvenile summaries of test scores and keep records and and sufficiently specialised for the development of all cases. They try cases, return verdicts and impose statistical information up to date. They may partici- aeronautical products. From planning and designing penalties. Magistrates have no jurisdiction to try pate in personnel research projects and in the to manufacturing and testing, these engineers usually cases of high treason and murder. These cases are planning and evaluating of personnel enrichment specialise by area (such as structural analysis, referred to the High Courts. In cities and large towns programmes. aerodynamics, propulsion, systems, avionics, servo- magistrate's judicial functions are more specialised. In and power systems, country districts magistrates often act on behalf of One can conclude that psychomotrists play an thermodynamics or acoustics), production methods other government departments such as receivers of important role in the selection of people for a and type of product. They usually work as part of a revenue and registrars of birth and marriages. particular kind of job. This selection is done by team with each team member representing a conducting tests and interviews and consulting with a different area of specialisation. MARKET RESEARCHER supervising psychologist on the results of the tests see page 22 and interviews. AERONAUTICAL ENGINEERING TECHNICIAN Aeronautical (aircraft) engineering technicians work POLITICAL SCIENTIST PUBLIC PROSECUTOR with engineers and scientists to design and produce Political scientists study different aspects of political Public prosecutors represent the attorneys-general in aircrafts, missiles and spacecrafts. Technicians help behaviour, such as the origins, development, all criminal cases in magistrates' courts.It is their engineers to prepare layouts and models of struc- operations and interrelationships of political institu- duty to protect the public from alleged offenders. tures, control systems, or equipment installations by tions. They apply this knowledge to formulating and collecting information, making calculations and developing political theory. Using information They study police dockets brought before them, and performing laboratory tests. Some technicians available on governments, laws, political parties and often ask for additional police investigation to build prepare or check drawings for technical accuracy, international law, they conduct research into political up a complete case. On the basis of the evidence practicability and economy. Others work as manu- philosophy and theories of political systems. They before them they decide if the accused may reasona- facturers' service representatives and serve as a link analyse and interpret the results of studies and bly be charged and in terms of which law or regula- between their company and customers. There are compile reports setting out their findings. Conducting tion this should be done. If it is decided to prosecute technicians who prepare technical information for public opinion surveys and interpreting the results is the accused, they serve summonses on the accused manuals, bulletins, catalogues and other literature. another task that they will probably be called upon to and subpoena the witnesses to appear in court. perform. AGRICULTURAL TECHNICIAN Public prosecutors put the case to the court, explain- see page 25 PSYCHOLOGIST ing and arguing all relevant evidence, whether against or in favour of the accused, to ensure that justice Psychologists gather information about people's prevails. They try to prove the alleged transgression AIRCRAFT ELECTROPLATER interests, abilities and behaviour in order to be able to beyond reasonable doubt. Aviation electroplates have the responsibility of understand, explain and predict human actions. keeping all aircraft parts corrosion-resistant and Many psychologists are interested in adjustment salvaging worn parts. This is accomplished by problems and the results of prolonged stress. They The public prosecutor's work is done mostly in court depositing a specific type of metal onto the various gather information through interviews, experiments and in his or her office where research is done on a parts, through a process of electrolysis. Examples of and psychological tests. They may help individuals to case. He or she may sometimes accompany the metals which are deposited to protect against deal with the problems of daily living, provide witnesses to the scene of the crime to get more corrosion are cadmium plating, copper plating, silver psychotherapy or conduct behaviour modification information about the case. plating, nickel-cadmium plating and WE-cadmium programmes in mental clinics and hospitals, or study plating. Examples of metals which are deposited for human behaviour in terms of the environment or SOCIOLOGIST the purpose of salvaging worn parts are hard individual development. Sociology is the science of human relationships. chrome, nickel, silver and lead/tin plating. All aluminium parts are iodised to protect against It is clear that psychology covers a wide range of Sociologists study the origins, growth and interac- tions of human groupse.g. the family, the commu- corrosion. Aluminium can also be dyed (or coloured) topics each with its own distinct characteristics. We for identification purposes. identify the following fields in psychology: (I ). Clinical nity, social institutions such as religious, political and psychologythe clinical psychologist usually work in economic groupings, ethnic groups and social classes. hospitals or in private practice where they provide a Physics plays an important role in the life of an service to clients who are experiencing emotional aviation electro- plater since he has to analyse all the and/or mental distress. (2). Counselling psychology They also study social processes and phenomena such as social change, deviant behaviour, group electroplating solutions in the workshop. This is the counselling psychologist is responsible for done in the workshop's own laboratory. counselling clients with everyday problems, such as friction and migration. Research involves the
Occunations The aviation electroplater must ensure that regula- insulation blankets in the aircraft cargo compart- tions laid down by the manufacturing companies are ments. ASSAYER AND SAMPLER strictly adhered to. All procedures applied must be Assayers and samplers work in the laboratories of accurately documented. Aviation electroplaters may Survival equipment such as various slide rafts and life prospecting, mining, reduction and refining, munici- supervise apprentices. vests used on aircraft, are regularly serviced and if pal and industrial organisations. They determine the necessary, repaired to ensure the safety of the quantity and quality of elements in ores, process The prospective aviation electroplater will also be passengers. All procedures applied must be materials, base metals, non-metallic materials, introduced to 'selective plating' where electroplating is accurately documented. This trade offers a clean and concentrates, effluents and air samples. Their results being done outside a plating bath. This trade covers exciting career. help their organisations or clients to plan current and a wide field and because of the diversity of the various future operations more efficiently. processes the work is very interesting. ARCHITECTURAL METALWORKER Architectural metalworkers make steel doors, metal Assayers determine elements in samples using AIRCRAFT INSTRUMENT MECHANIC / AIR- patterns, fixtures, templates and railings for archi- various techniques. They use chemical processes CRAFT ELECTRONICIAN tectural purposes. They may make their own designs such as fire or dry assay procedures and wet chemical Aircraft instrument mechanics maintain and repair and sketches, but usually they work under assign- methods. The determination of trace elements mechanical, electrical, electronic and digital instru- ment of architects who supply them with drawings. requires an exceptional degree of accuracy. Analyses ments on an aircraft. They also maintain and repair are conducted for metallurgical accounting, process precision measuring instruments, pressure switches, They mark outlines off on the metal, which can be control, effluent control, environmental health and various types of gauges, transmitters, indicators, brass, copper, steel or alloys. They cut and forge quality control. compasses, engine power and control instruments metal to the desired shape by means of various and altimeters. In addition, they repair oxygen machine tools such as metal band saws, power AUTOMOTIVE BODY REPAIRER equipment, gyroscopic instruments, auto-pilot shears, fly presses and swage machines. The metal is Accidents involving cars, trucks and buses are components and air-conditioning systems. heated in a furnace to make it malleable. happening more frequently then ever before. These cars are repaired by an automotive body repairer or They join metals, apply cleansing agents and treat Architectural metalworkers use soldering, brazing or panel-beater. metals against rust and fatigue. They repair and welding techniques to join the different parts of the maintain certain aircraft parts such as instrument metal pattern together. The architectural metal- Automotive body repairers straighten bent frames, panels, pressure sensors, navigating systems and workers need to take all the necessary precautions to remove dents and replace damaged body parts under instrument landing systems. They maintain and use ensure that all the work is done in a safe and clean the direction of a supervisor. They use special measuring and testing equipment for the tracing of environment. They complete their task by fixing the machines to align damaged frames, body sections circuits and for measuring circuit values. door, pattern or template to the building. and unit bodies. In some cases badly damaged sections of body panels are removed and new ones AIRCRAFT RADAR TECHNICIAN / RADIOTRI- ARCHITECTURAL TECHNOLOGIST welded in their place. Small dents are repaired by CIAN see page 8 smoothing them out or by filling them with plastic or Aircraft radar technicians / radiotricians install, test, solder. Dents are then filled and sanded for painting.
repair and maintain radar and radio equipment for I ARMAMENT FITTER aircraft. They use components and materials such as Armament fitters are responsible for inspecting, Automotive body repairers are also responsible for resistors, capacitors, inductors, transformers, servicing and repairing firearms, artillery weaponry the final assembly and inspection for true fit, as well switches, generators, and insulators. They construct and weaponry equipment. as for the testing for proper connection and working and use circuits such as rectifiers, amplifiers and components in electrical fittings and lights. Although frequency modulators. They mount, connect and In the Defence Force they specialise in the types of it is expected from the automotive body repairer to tune-in various antenna systems. Testing equipment weapons used in the units or divisions to which they be able to repair almost any part of a vehicle, his and measuring instruments are used in tracing faults. are attached: artillery division you specialise in guns, work is becoming more specialised.In bigger These technicians often do the wiring of all the the armoured corps specialise in tanks equipped with workshops, the automotive body repairer may electrical equipment in an aircraft. The following guns, machine guns, bombs and mortars specialise, for example, in frame straightening, door must be checked, repaired and tested: radio and , the infantry division specialise in rifles, machine and fender repairing or the installation of glass. electronic equipment, computing equipment, guns, grenades and mortars, the air force specialise communication systems, radar and radio navigational in fighter aircraft armed with rockets, machine guns AUTOMOTIVE ELECTRICIAN equipment and air-traffic control equipment. and bombs, while the navy specialise in anti-aircraft Automotive electricians repair and maintain electrical artillery, torpedoes and missiles. systems in motor vehicles. Motor vehicles have two AIRCRAFT SHEETMETAL WORKER electrical systems, namely an ignition system and an Aircraft sheetmetal workers manufacture sheetmetal Armament fitters need a thorough knowledge of a accessory system. Automotive electricians are mainly components from which aircraft are assembled. They wide range of arms, ammunition, warheads, explo- concerned with the accessory system which com- mark off and cut sheetmetal according to engineering sives and specialised weaponry such as hydraulic and prises the starter motor, generator, lights, windscreen drawings. Various factors such as the metallic pneumatic weaponry systems. wipers, indicators, hooter, etc., as well as electrically- properties of the metal must always be taken into operated windows, aerials and radios. consideration. Various shapes are obtained by ARMATURE WINDER bending the sheetmetal into the desired form and by Wire coils are among the most important parts of any They should however also have a thorough knowl- joining components together using soldering, electrical machine. When the coils of motors burn out edge of the ignition system since defects in the brazing, welding, riveting or bonding techniques. or are damaged, armature winders locate the broken accessory system may have a detrimental effect upon parts, remove them and either replace them with new the vehicle's electrical system as a whole. Automotive Safety precautions should be strictly adhered to. ones or completely rewind all the coils. electricians do a fair amount of routine work such as Sheetmetal workers apply heat treatment to ensure replacing bulbs and setting regulators. Specialised the safe joining of sheetmetal components. They They use various kinds of testing instruments to trace work includes tracing faults with special equipment. treat all metals to protect them from corrosion. They burnt-out coils. Armature winders work from also shape and fit pipes to aircraft. diagrams that supply details of the arrangement of AUTOMOTIVE MACHINIST coils, the number of turns required of each, and so Automotive machinists are skilled metal workers who AIRCRAFT TRIMMER on. In order to wind coils to the correct number of perform a variety of machining operations on engines The aircraft trimmer has the responsibility of turns and shape, armature winders make use of coil- and engine components. They may also build and maintaining the high standards of an aircraft cabin winding machines. assemble engines for new vehicles. interior, in accordance with laid-down specifications, to ensure passenger comfort and safety. He per- They then check the coils, fit them into the slots of When the engine of a vehicle is wom out, it bums too forms scheduled maintenance, makes repairs and motors and generators and connect them according much oil and fuel and has to be rebuilt. This process completes inspections on aircraft interior-related to circuit requirements. They finally assemble these includes dismantling the engine, grinding various components such as: fabric covered panels, carpets, motors and take care not to damage the insulation parts and manufacturing and fitting others. The curtains, cockpit and cabin seat covers, safety belts in around the wires, after which the motors and automotive machinist's duties involve turning and the aircraft cabin, cargo webbing nets and aircraft generators are ready for use. fitting the different parts and assembling the sub-
30 2 Occupations structures of the engine, before the engine parts can material requirements from the drawings. They are operations are performed by hand. Other book- be balanced. also responsible for preparing, lighting and using binders make use of specialised machinery, such as open hearth, gas or oil-fired fumaces. folding, cutting, stitching, punching, indexing, AUTOMOTIVE SHEETMETAL WORKER assembling and binding machines. Automotive sheetmetal workers cut and shape BOATBUILDER AND SHIPWRIGHT sheetmetal components into the correct forms and The boatbuilder and shipwright is responsible for BRICKLAYER sizes for the body work of vehicles. They shape cut building, altering, renovating, repairing and main- Bricklayers build and repair walls, floors, partitions, and rivet sheetmetal, applying heat treatment. They taining boats and ships. He is usually provided with fireplaces. chimneys and all other structures made up often use electrical and gas welding techniques to a plan and specifications of the boat he has to build of brick, concrete block or masonry materials. They join soft steel of different thickness. Before the or repair. Sometimes however, he oniv receives may specialise in one type of masonry material, such welding can be done, the material has to be finished general instructions and has to work from his own as firebrick or cinder block work. off, which involves joining, filing, sanding and designs and sketches. smoothing the sheetmetal. Automotive sheetmetal Bricklayers first study the blueprints to check workers often have to draw plans, according to which The boatbuilder and shipwright discussed here works specifications and determine the most accurate the parts are cut and put together. It is important that mainly with wood. He selects the material he requires layout. Mortar is then mixed and a layer or bed of the components fit exactly. for the job, for example timber. plywood and mortar is spread as a base after which bricks are hardboard. He begins by marking off the design on positioned by hand to assure a neat, uniform AUTOMOTIVE TRIMMER the wood, and then cuts and assembles the various appearance. Excess mortar is cut off. Mortar joints These artisans upholster motor vehicle seats, line parts in conformity with the drawings. He must be are then finished off so that moisture cannot their roofs, floors and door panels and also install precise in using marking-off tools such as rules, penetrate. windows, windscreens, back-rest bolsters, trimmings centre punches, scribes and squares. and leather coverings in the interior. Bricklayers have a thorough knowledge of the When all the parts have been shaped, he assembles different types of bricks that are available, also of the They first remove the door handles and then detach them by making use of various kinds of joints such as correct mortar mixtures and of how to adapt their the upholstery and trimmings from the door panels, dovetailed, doweled, grooved, lapped and tongued methods to different weather conditions. Bricklayers floor, roof and seats. Thereafter they match, measure joints. Steam is used to bend the wood. He then may also weld metal supports for bricks. In addition, and cut new material to the required shapes, sizes glues the parts together and strengthens the joints they may supervise helpers. and patterns and reupholster the parts concemed. with nails, bolts, cleats and screws. Finally, they replace all hinges, handles and other BUILDING SURVEYOR trimmings, perform any finishing touches that may He also ensures that the boat is waterproof. He Building surveyors apply their measuring and be necessary to the interior of the vehicle and install applies filters, sealant and fibreglass and when the surveying skills to various tasks required by building seats in the correct positions. They may also work on construction work is complete all parts are varnished contractors and quantity surveyors. They measure the the interiors of vintage cars. or painted. The boatbuilder and shipwright also building work that has been completed on site by does repair work and replaces worn-out wooden means of a very specific system which is standardised AVIATION TURNER AND MACHINIST parts such as steps and masts. He can work throughout South Africa. The information that they outdoors on a boat that is afloat and. or indoors on a obtain from measuring the work is used to issue Aviation turners and machinists have the responsibil- boat which is in a workshop or dry dock. ity to do maintenance work on aircraft parts and monthly certificates and also to determine whether the company is running at a profit. components by applying tuming, milling, grinding, BOILERMAKER / PLATER and jig-boring skills. Machine plasma spray, plating and welding processes including ferrous and non- A boilermaker manufactures and builds structures of Before the commencement of a building project, an ferrous materials. In this occupation a person must steel plates, ranging from boilers for steam engines estimate as to the cost is made by a professional be able to manufacture parts from various types of and pressure vessels for power stations and petro- quantity surveyor. This estimate is presented in the materials including aircraft materials. The aviation chemical plants to mine head gears, bridges and oil form of a complete list of all the items necessary to turner and machinist must adhere to all the pre- drilling platforms. complete the project and is known as a 'bill of scribed rules and regulations laid down by manufac- quantity. The building surveyor then analyses the bill turing companies and vendors. All machining The boilermaker has to develop a drawing in separate of quantity and prices all the items such as materials, processes must be documented. All work done will sections and has to make many calculations in this labour and plant. In this way he arrives at a tender be subjected to comprehensive inspection to meet process. Once he has established his job procedure amount, which the building contractor's firm at which safety standards. he marks out the plate and cuts it to the correct he is employed submits as an offer for the building dimensions, using cutting torches or guillotines. He contract. BIOMEDICAL ENGINEER then bends it into the required shape. This is done manually using hand tools or mechanically by using A building surveyor can also work for a quantity see page 17 bending brakes, rolling machines and heating surveyor where he will assist the quantity surveyor in procedures. He then assembles the various parts and measuring the builders' work, compiling bills of BLACKSMITH prepares them for welding. quantity, issuing monthly valuation certificates, Blacksmiths make use of modern mechanical tools measuring variations and preparation of the final and other machinery to manufacture objects from It is estimated that boilers last for a very long time. account. steel and metal, for example architectural steel The work of a boilermaker is therefore mostly structures, crowbars and picks, to name but a few. devoted to maintain and repair boilers. Boilermakers CABINETMAKER are also responsible for the cleaning and inspection of Cabinetmakers build and repair wooden cabinets and Blacksmiths forge metal parts, to make them into boilers to ensure that these boilers work effectively. high grade furniture, using a variety of woodworking some object or to repair others. This is done by first machines and hand tools. They may work in a heating the metal to soften it. When softened, the BOOKBINDER workshop or on the site where the cabinets will be object is picked up with a pair of tongs and placed on Bookbinders operate machines which prepare books installed. the anvil where it is hammered or pressed into the and other publications for distribution. desired shape. Broken parts are rejoined by ham- They study blueprints, plan the order of operations. mering them together. Blacksmiths may have to Printed sheets are generally folded into sections of 16 mark outlines of parts on paper or timber according reheat the object while it is being shaped, repaired or or 32 pages, arranged into proper order, and plates to specifications and match materials for colour, grain finished to keep it workable. They may use this are inserted at the assigned places. Next, the book is or texture. They set up and operate machines such process to sharpen metal or hand tools. They also sewn together and/or the spine glued. Colouring or as power saws, jointers and mortisers to cut and temper or harden metal by heating the object to a gilding may be applied to page edges. Other workers shape wood. They trim parts to ensure they fit high temperature and then cooling it. may prepare the cover. The cover and book are then tightly, using hand tools. They drill holes for screws put together. or dowels and glue, and fit and clamp parts together to form complete units. They sand and stain articles Some blacksmiths (farriers) repair shoe horses using In hand binderies where they specialise in special and install hardware such as hinges, catches and ready-made or custom-designed shoes. Other bindings, original bindings, and the restoration of drawer knobs. aspects of their work include making drawings and rare and valuable books, the above-mentioned interpreting these. They should be able to estimate
4 3 Oncuontions 31 CARPENTER / JOINER include: the day-to-day planning, control and It is useful to understand programming before going The carpenter does the finer work of putting the supervision of civil engineering works and the into other areas of the computer industry. finishing touches to a building. He erects panels and selection, deployment and supervision of heavy picture rails, makes built-in cupboards and installs construction plant. COMPUTER SERVICE TECHNICIAN carved ornamental woodwork. Computer service technicians maintain and service COAL TECHNOLOGIST computer systems and related machines such as Work proceeds according to sketches made by Coal technologists are concerned with the recovery printers and magnetic tape readers. They perform draughtsmen or architects. The carpenter decides on and utilisation of all forms of coal and its by- preventive and maintenance tasks such as adjusting, the type of wood required and marks off, saws and products. The coal technologist works in the oiling and cleaning mechanical and electro- joins the pieces. As soon as the walls are high following four major areas: geology, mining, coal mechanical parts. They are also responsible for the enough to support doors and window frames they preparation and processing, coal analysis and upgrading of computer systems. are built into openings left for this purpose by the research. bricklayer. After the frames have been installed the They further check electronic equipment for loose carpenter fits the doors. The carpenter/joiner then A geologist specialising in coal technology conducts connections and defective components. They must completes the work by fitting locks and bolts. geological surveys of the extent and quality of coal determine the causes of breakdowns and repair deposits. The coal technologist specialising in them. Some technicians help to install new equip- He is required to lay down wood and block flooring, geology provides the management with valuable ment. Technicians must be familiar with technical fits kitchen dressers to walls, and does repairs to information which helps it to run the mine with a high and repair manuals for each piece of equipment. damaged woodwork in buildings. Carpenters work profit margin. closely with other construction workers like bricklay- In addition, they keep accurate records of mainte- ers, plasterers and tilers. Technologists regularly take and analyse samples of nance and repairs done on each machine. They fill in the coal face, and report results to the mine engineer time and expense reports and keep inventories, order CARTOGRAPHER and manager. They determine the presence of parts and in certain cases assist with training. see page 20 methane gas as well as other explosive coal deriva- tives. They assist in the washing plant and in grading. CONCRETE TECHNOLOGIST CHEMICAL ENGINEER A concrete technologist applies his knowledge of the They are also concerned with product evaluation, see page 20 properties of concrete to the task of ensuring that quality control and aspects related to the use of coal concrete is produced to a high standard of quality. in power stations. They are employed by Sasol, the CHEMICAL LABORATORY TECHNICIAN Concrete technologists spend part of their time in the petrochemical and metallurgical industry, and in the laboratory conducting tests, and part of their time on see page 21 fields of domestic heating and pollution control, site ensuring that concrete is being produced to the among others. correct specifications. This is a responsible position CIVIL ENGINEER since poor-quality concrete can negatively affect the Civil engineers are responsible for the planning, strength of a building. design, maintenance and management of construc- In addition, they conduct research to determine how tion projects. These projects are concerned with the this natural resource can be best utilised for the CONSTRUCTION MANAGER benefit of mankind. They are continually striving to construction of multi-storey buildings, roads, see page 15 bridges, harbours, airports, sports stadiums and improve existing techniques and methods in the coal mining industry. water and sewage purification. COPPERSMITH
Civil engineering involves the constant re-creation, COMPOSITOR Coppersmiths work mainly with non-ferrous metal improvement and conservation of the environment, Compositors and phototypesetters operate and tend such as copper and brass, manufacturing cylinders, as well as the establishment of the facilities required machines that provide typeset matter used to prepare pipes and cisterns. for the effective functioning of the community. Civil printing plates for pressroom workers who print engineers design major structures and oversee their newspapers, magazines and various other publica- Blueprints of the intended structure are studied and construction. They supervise surveyors, draughts- tions. the copper plates marked off accordingly. Copper men, technicians and other workers. plates are bent to prescribed angles, holes are drilled Compositors read from a copy clipped to the and edges smoothed. The copper plates are cut Civil engineers may also carry out research or teach at typesetting machine and operate a keyboard. either mechanically or by means of a gas cutter. The technikons and universities. Some serve as consult- Compositors may be grouped as follows: copper plates are then straightened, bent, rolled or ants for engineering, construction or architectural linotype compositor --: assemble letters into lines of dished to the required forms. The shaping is done firms. Civil engineering is a very broad field and words (slugs); monotype compositors feed perforated with heavy machines working on the cold copper engineers usually specialise in one of the subdivisions tape into a machine that reads and selects metal plates. Hot processing is sometimes required when or in one area of the work. The following fields can moulds for each letter; phototypesetters type the text difficult angles have to be shaped. Holes for rivets be distinguish: geotechnical-, transportation-, and produce a magnetic or perforated tape. They and stays are drilled into marked-off positions. marine-, municipal-, construction-, structural-, feed the tape into a computer that hyphenates, Overlapping sides are compressed together. hydraulic engineering, and project management. creates columns and makes a second tape, which is photographed. The modern trend is predominantly DENTAL TECHNICIAN CIVIL ENGINEERING TECHNOLOGIST phototypesetting. see page 17 A civil engineering technologists assists civil engi- neers in the construction of large structures such as COMPUTER PROGRAMMER DIAMOND SAWYER roads, bridges, airports, buildings and dams. His The computer programmer serves as a link between Diamond cutting involves a number of stages and function is to liaise with the engineer on a theoretical man and the computer. He writes programs, which each stage requires a specialised tradesman to do the and technical level and to liaise with the construction are detailed instructions that list the steps that the job. workers on a practical level. computer must take to solve a problem or handle information in a logical order. Diamonds are first sorted by a diamond-sorter into A civil engineering technologist's work will vary widely various shapes, sizes, colours and qualities.The according to the field of civil engineering he works in. The specifications of a particular task are provided by diamond marker than decides how the final product Civil engineering can basically be divided into two the systems analyst. The programmer writes the will look. The marker will mark the diamond for the basic activities: planning and design and construction program and translates it into a computer language diamond sawyer, who will saw the diamond using a and maintenance. These two activities can be further such as COBOL, FORTRAN, APL, PL/I or BASIC. He copper disc spread with diamond powder and oil. sub-divided into various fields of civil engineering, then checks the operation of the program and makes namely: structural, geotechnical, transport, water and sure that the instructions are correct and that they will A diamond cutter then shapes the rough diamond municipal. In the planning and design field his duties produce the desired information. If errors occur, the into the so-called 'rondist'. An industrial diamond is may include: survey, design, costing, estimating, program must be changed and rechecked until the used to cut the diamond. A crossworker then draiighting, traffic studies, and materials investigation desired results are produced. Instruction sheets to polishes eight facets on both the top and the lower and testing. In the field of construction duties could feed the tasks into the computer are then prepared. sections of the diamond. Any spots or cracks are
44 32 Occupations attended to. The diamond cutter then gives the final on a specific job. He uses the job card to bill the is complete, electricians test systems to be sure they rounding. client. are working properly.
A diamond crossworker then polishes the eight DRAUGHTSMAN Construction electricians must have a thorough equal-sized facets on the top and lower sections of Draughtsmen prepare detailed drawings based on knowledge of and follow national electrical codes as the diamond after completing the table on top and sketches and specifications made by architects, well as municipal requirements and specifications. the culet below. A diamond brillianteer divides each engineers or other designers. of the top and lower facets and then polishes the ELECTRICIAN:GENERAL triangular facets. To prevent damage from excessive Construction projects differ radically and specialisa- General electricians (sometimes known as electrical friction, borax solution is used. tion in preparing drawings in the various fields is repairers) keep electrical equipment in good working therefore necessary, for example, architectural order. Duties vary widely, due to the wide range of DIE SINKER AND ENGRAVER draughtsmen draw plans for all kinds of buildings; work settings. However, most of these electricians do The die sinker and engraver works from a picture or civil engineering draughtsmen draw plans for periodic inspections of equipment to locate and sketch of the item he is required to produce. He casts bridges, roads, irrigation and construction schemes; repair any defects before breakdowns occur. a mould and from this he makes a die. A die is an mechanical engineering draughtsmen would sketch engraved mould used to mint coins and medals, and plans for machines and engine parts;structural When trouble occurs they must find the cause and to do omamental lettering and embossing. He is also engineering draughtsmen draw designs for towers repair it quickly. Repairs may involve replacing fuses. able to manufacture the final product with this mould. and steel frames;town and regional planning switches or wires. Once the repair is complete they draughtsmen draw maps and build models for test the equipment to be sure it is working properly. The die sinker and engraver engraves block, script projects;and mining draughtsmen draw plans of General electricians sometimes install new equipment and ornamental letters, metal and plastic labels, steel the mines which can help with the upgrading of but this is usually done by construction electricians. imprint blocks, and digits and letters for adding and safety standards. typing machines. He engraves on moulds, plastic and ELECTRONICS ENGINEER metal advertising signs, metal attachments, clasps. ELECTRICAL ENGINEER Engineering is the application of scientific knowledge buckles, buttons, badges, medallions, and com- Electrical engineering is a comprehensive discipline and imagination to everyday problems. Electronics memorative medals. He embosses rollers for tinfoil comprising electrical and electronic engineering. engineers design systems, equipment and compo- or plastic, date stamps and plaques. Electrical engineers are involved in the design, nents that use light current electricity for application manufacturing, installation and management of in the fields of automation, communication, naviga- DIESEL MECHANIC various appliances and installations that generate or tion, data processing and entertainment. The duties of the diesel mechanic include diagnosing use electrical energy. Compare, for example, the use engine trouble, dismantling an engine when neces- of solar cells and wind turbines for the generation of Their services range from research into the develop- sary, replacing or repairing defective parts and electrical energy. ment of components and systems to their manufac- reassembling the engine. He is also responsible for ture, and the planning and setting in motion of repairing mechanical and electrical faults in construc- Heavy current electricity is used for electricity supply systems in industry and in the public sector. These tion machinery. and distribution, and subsequently for power, heating activities include the development of military arms and lighting. Electrical engineering, however, is the and communication systems, telephone and broad- His experience often helps him to locate a problem by title that covers all these aspects from power stations casting services, signalling systems, navigation and listening to the noise in the engine, although through digital computers to microradio communica- landing aids, instrumentation for measurement and electronic diagnosing equipment is normally used. tions systems. control of industrial production processes, computer Sometimes a complete part has to be replaced while and data-processing systems and equipment for at other times only a minor adjustment is sufficient.If Fields such as electronic, control, communications entertainment. it proves impossible to repair an engine on location it and computer engineering all form part of electrical is taken to the workshop where the mechanic has the engineering. The electrical (or electrotechnical) Modern management abilities are important. The use of modern tools and equipment. engineer makes a study of electrical supply and electronics engineer must be able to participate in control systems, digital and computer systems, planning, organisation and the control of proceed- The diesel mechanic also completes job cards, electronics and electrical machinery, as well as the ings. This is especially so for those electronics furnishes information on the parts that should be combination of two or more of these fields in order to engineers who work in large plants or installations ordered and assists in training apprentices. Diesel form a practical unit. such as power stations where there is a huge labour mechanics who have their own businesses perform force. administrative and managerial tasks as well. ELECTRICAL ENGINEERING TECHNICIAN Electrical engineering technicians use their special- DOMESTIC APPLIANCE MECHANICIAN ised knowledge in connection with the distribution The electronics engineer can specialise in the The domestic appliance mechanician tests appliances and application of electricity. They often act as a link following fields: electromagnetism, energy systems, and locates faults with the aid of various diagnostic between the electrical engineer and the artisan. computer -engineering, bio-engineering, electrical techniques and test equipment. Appliances can vary machinery, signal assimilation, telecommunication, from kettles to microwave ovens. The electrical engineering technician's duties include control systems, photonics, acoustics and micro- the designing, testing and implementation of new electronics. The mechanician adheres to basic safety measures in equipment. They may help electrical engineers to order to ensure safe working and a high standard of generate electrical energy, and with the task of ENGINEERING GEOLOGIST service from the appliance. This is done with the aid distributing this electrical energy to the consumer. Engineering geologists apply their knowledge of of electrical testing instruments and specialised tools. They also install new equipment at power plants and geological principles to the planning, design, He sometimes has to manufacture components or test this the equipment to see whether it functions construction, operation and safety of civil engineering attachments, using sketches and diagrams of effectively. projects. They examine the types and geological electrical circuits and mechanical components. and he structures of soils at construction sites to ensure that uses voltmeters, pressure gauges and temperature ELECTRICIAN: CONSTRUCTION large structures such as high buildings, dams, roads recorders. Construction electricians lay out, assemble, install and or new townships are designed to suit the soil test electrical fixtures, apparatus, control equipment conditions or strength of the rock, so that the Readings from these instruments are interpreted and and wiring used in electrical systems. They follow foundations are firm and safe and they are con- evaluated to assist him in diagnosing the problem. blueprints, drawings, diagrams, specifications or oral structed in the most cost-effective way. They also After repairing the appliance, the mechanician tests it instructions when performing their work. examine the materials used in the construction of to see if it is in proper working order. He listens for roads. Engineering geologists work very closely with excessive vibrations and makes sure the appliance They bend, fit and fasten conduits (pipe or tubing) civil engineers. does not overheat. In the case of automatic machines inside partitions, walls or other concealed areas. with programmes he lets the machine run through a Insulated cables or wires are then pulled through EXPLOSIVES TECHNOLOGIST programme to make sure it is in good working order. conduits. Wiring is then connected to circuit breakers, The explosives technologist is the person who He also fills out cards and the number of hours spent transformers or other components. When installation i manufactures, examines and tests commercial and military explosives. He may, for example, have the
Occunations 33 responsibility for the demolition of a building, using navigators who need to pin-point landing sites for scraper blade to remove excessive ink from the explosives. parachutists. surface of the cylinder. He then makes a trial run and checks the legibility and the uniformity of the The explosives technologist in the manufacturing FUEL TECHNOLOGIST printing. When everything is in order, he restarts the industry is responsible for the planning of production see page 21 machine and brings it to full speed to commence plants, processes and analytical methods for the printing. He ensures that printing, folding and manufacture of explosives. He prepares a scale FURNITURE MACHINIST cutting are proceeding correctly. model of the envisaged plant, plans down to the The furniture machinist produces furniture compo- finest detail and specifies processes. INDUSTRIAL ENGINEER nents for the making of furniture. In large furniture In the laboratory routine analytical processes and factories about 20 different machines are used and The industrial engineer or production engineer utilises knowledge and skills in the areas of mathe- development take place. Raw material is first the machinist should be able to operate them all. analysed, then the technologist ensures that produc- matics, statistics and the physical, social and eco- tion goes according to plan and final products The unprepared wood is sawn to the required shapes nomic sciences, coupled with engineering analyses and designs. measure up to expectations. Research is done to and sizes.It is then transported to the planing develop new techniques, processes and products. If machine, and if the joining of wood or panels of His function entails the following:- investigations to these are accepted, the technologist draws up wood is necessary, dowel pins are inserted. Details, specifications for their implementation. according to design specifications, are then marked improve work methods with regard to mechanisation off on the wood. The next machine is then set and and automation; -development of labour standards FITTER AND TURNER adjusted to obtain the required form. The wood is and manpower utilisation systems; -profit studies held firmly in place with set apparatus. Some of these and investigations into alternative capital expenditure; Fitters and turners are highly skilled craftsmen whose tasks require special skills, whilst others are com- -medium- and long-term planning with regard to all trade is essential to most industries. They manufac- pleted automatically by the machine. aspects of production. To carry out all these tasks the ture, construct, assemble and fit components for engineer will first define the problem, plan an machinery, vehicles, installations and other apparatus GEOTECHNICIAN investigation, process information and finally or articles. They are also responsible for their implement his plan. maintenance and repair. The function of a geotechnician is to carry out investigations of the crust of the earth for a variety of INDUSTRIAL ENGINEERING TECHNICIAN Fitters and turners first select and mark off the commercial purposes. Each aspect of this challenging Industrial engineering technicians are directly or material required according to exact measurements field is highly complex; geotechnicians therefore need indirectly concerned with the production of articles or on blueprints, drawings or a model. They then shape to specialise in a particular area. These specialised objects through the optimal utilisation of capital, the rough piece of metal into its final form with fields in geotechnology are described below. manpower and raw materials. Their main aim is to power-operated tools such as lathes, milling, drilling ensure that the highest possible profit margin is and planing machines. Finally they fit the parts to Mining companies employ geotechnicians to assist reached. complete the machine or article required and inspect them in pinpointing the location of ores and also to and test the final assembly for true fit. investigate underground conditions on a regular basis to establish the existence of potentially The term 'production technician' denotes many different occupations. These may involve many FLIGHT ENGINEER hazardous mining conditions. Exploration geologists work with a team of scientists to locate new mineral different areas of manufacturing, each of which may Flight engineers assist pilots and co-pilots on large resources for the purpose of mining or quarrying and be attached to research, or design and development, aircraft by monitoring and operating many of the also new water resources. or construction and installation, or industrial supervi- instruments and systems and watching for other sion and maintenance, or marketing, sales or aircraft. They carry out minor repairs and adjustments Geophysicists use sophisticated instruments to management. The metallurgical production techni- before take-off, while the aircraft is in flight and after ascertain conditions in the sub-surface of the earth cian could specialise in different aspects of metallur- landing to ensure the constant safety of the aircraft. and also apply these techniques to finding under- gical engineering, e.g. production of metal from raw ground water and ores and to establish bedrock material (iron from iron ore); refining (iron to steel); Before take-off the flight engineer carries out safety conditions for large constructions. Geohydrologists milling (rolling ingots into finished or semi-finished checks against a pre-flight check list. These checks apply their knowledge of geophysical techniques to products); or maintenance of machinery. include: inspecting for fuel or oil leaks; checking for locating sources of underground water and estab- electrical, hydraulic or pressurisation system mal- lishing the quality of this water. Engineering geolo- INDUSTRIAL TECHNICIAN - HYDROMETRY functions; and verifying that passengers. freight and gists conduct geological investigations into the sub- The primary responsibility of an industrial technician fuel do not exceed the weight limitations, and that surface of the earth to provide the constructors of in hydrometry is to support and assist the engineer the weight is evenly distributed. large construction projects -- including dams, and hydrologist. The work in this field can be divided bridges and tunnels -- with sufficient information to into two basic areas: the planning and design of While the aircraft is in flight the flight engineer needs design firm and safe foundations. They also need to various water- storage, and -transportation and to focus on the following tasks: monitoring fuel locate building material for the construction projects. pumping systems; and the construction and mainte- gauges and calculating the rate of fuel consumption; nance of these systems. keeping a log of fuel consumption and engine GLASS INSTRUMENT MAKER performance; monitoring aircraft speed; maintaining The duties that an industrial technician in hydrometry cabin temperature; carrying out minor repairs; and Glass instrument makers manufacture glass labora- can be expected to perform on the planning side taking emergency measures in the case of equipment tory apparatus by bending, shaping, blowing, include: surveying sites for proposed new dams, failure,for example, the autopilot, wing heaters and machining and melting glass components together. canals, tunnels pipelines and water-pumping plants; electrical and hydraulic systems. He logs repairs that They work to specifications given by the scientist, preparing and surveying sites for flood calculations; were not corrected during flight and reports these to usually in the form of a sketch, for whom the and assisting engineers and hydrologists in the the ground crew on landing. apparatus is being manufactured. Glass instrument makers also repair damaged apparatus. design of water-storage and transportation systems. Duties on the construction and maintenance side FLIGHT NAVIGATOR GRAVURE MACHINE MINDER include: advising irrigation boards, municipalities and The main responsibility of a flight navigator is to farmers on irrigation matters; supervising construc- The gravure machine minder is in charge of printing locate the position of other aircraft, ships or suitable tion work; and frequent checking on existing machines. The printing cylinders needed by gravure parachute-landing spots, and to direct the course of structures, systems and instrumentation to establish machine minders are prepared by photogravure the aeroplane. To do this he uses navigational aids whether repair work or improvement is required. such as charts, radar and sophisticated electronic engravers. equipment. Flight navigators fall into four categories: INSTALLATION ELECTRICIAN assault navigators whose primary task is to trace The gravure machine minder cleans the inking An installation electrician plans the layout of, and hostile aircraft; maritime navigators who watch over system and oils the machine. He locks the printing installs and repairs, electrical wiring in domestic the coastline; reconnaissance navigators whose main cylinder into position on the machine, fills the ink residences, offices and factories. He ensures that responsibility is to locate enemy aircraft without them trough and regulates the flow of ink. He also threads wiring is not unsightly, unreliable or hazardous and knowing that they are being watched; and airborne the paper through the machine guides and rollers, and adjusts the rollers and paper-folding and cutting that it complies with the safety standards laid down mechanisms. Before printing he sets and adjusts the by the SAGS Code of Practice for the Wiring of
46 Occupa Premises and the Occupational Health and Safety Act ready or 'overlay tympan sheets to cylinders, against therefore need to have equipment with them at all of 1993. which the printing paper rests. They study trial times. impressions and adjust the machine where necessary. The installation electrician works in a team, as well as They adjust the flow of ink during the printing MECHANICAL ENGINEER indoors and outdoors. He must take all the necessary process, ensure that the paper is fed in properly and The mechanical engineer is involved with the design, safety precautions because the work is very danger- that printing of a high standard is maintained. They development, production, marketing, installation, ous. oil, maintain and effect minor repairs to the machines maintenance and general research of machinery and and machine tools. mechanical equipment in almost every type of INSTRUMENT MECHANICIAN industry and technology. Instrument mechanicians play a vital role in ensuring Many modern plants have installed printing processes that automatic processes and plant systems operate that use computers and sophisticated instrumenta- The mechanical engineer usually specialises in one of correctly and efficiently. tion to control press operations. With this equipment, the following fields: transportation work on aeronau- the letterpress machine minder monitors a control tical, marine and automotive engineering equipment, They are responsible for measuring the pressure, panel that detects problems. To adjust the press he turbines and engines; power generation machinery temperature, position, level, mass and flow of solids, pushes the appropriate button on the control panel. such as steam, water and gas turbines used for fluids and gases. To do this they use a series of field driving power generators; agriculture machinery such and control instruments that ensure that plant LIFT MECHANIC as special tractors, harvesters, crop collectors, processes operate according to specifications. Should The lift mechanic is involved mainly with the con- packing machines; mining pumping plants, ventila- fluctuations occur they diagnose the faults and repair struction, erection, testing and maintenance of lifts, tion fans, conveyor belts, drilling machines; industry them as speedily as possible. escalators and hoists, in accordance with regulations manufacturing machinery; environmental engineering as decreed by legislation. creating the essential artificial environment man Regardless of their field, instrument mechanicians are needs in order to work comfortably (ergonomics); trained to manufacture and repair almost any kind of Lift mechanics work as part of the crew that installs biomedical engineering developing machines and instrument, whether electrical, mechanical, hydraulic, and repairs elevators, escalators and similar equip- devices such as the heart-lung machine, the iron chemical or optical. To design a specific research ment. When new elevator is installed, the shaft is lung, the artificial kidney machine, and realistic instrument they work according to sketches and constructed and prepared for use. The electrical artificial limbs and organs such as heart valves. instructions from scientists and engineers. wiring and controls are then installed. The elevator car is then assembled and finally the hoist that winds MECHANICAL ENGINEERING TECHNICIAN JEWELLER / GOLDSMITH and unwinds the cable is installed. Mechanical engineering technicians fill the gap see page 9 between the tasks performed by engineers and those When the elevator is operational mechanics check, performed by artisans. JOINER AND WOOD MACHINIST adjust and recheck it to be sure it is working properly. Once equipment has been installed, lift mechanics The machines that they develop range from moving The joiner and wood machinist is responsible for maintain and repair it. They may also replace old machinery to mechanical appliances. A few examples manufacturing and assembling the woodwork in a equipment with newer models. building, such as the doors, door frames, window of these types of machinery are ships, railways, aircrafts, air-conditioning units and automobiles. frames and built-in cupboards. He or she works with LITHOGRAPHER Mechanical engineering technicians assist engineers both hand and machine tools, and also spends his in design and development by making sketches and time making ornaments. Lithographers perform a wide range of duties, such as setting up the printing machine, including -setting rough layouts of proposed machinery and other equipment.The cost and practical value of designs LAND SURVEYOR rollers, cylinders, ink-flow, dampers and ensuring the smooth transport of printing material. is then analysed. Land surveying is the science and practice of recording and setting out the exact measurements of Specialised fields include the following:-photo- When planning and testing the performance of man-made and natural features of the earth's lithographers (camera operators) photograph and experimental equipment, technicians record data, surface. Surveying is basic to all construction develop negatives of the materials to be printed; plot graphs, analyse results and write reports. They planning, and development and involves the making lithographic artists retouch negatives to lighten or may sometimes recommend design changes. of maps and the determination of boundaries. darken certain areas; strippers arrange and paste Technicians help to prepare the layouts and drawings Surveyors participate in the planning and construction negatives onto layout sheets; -platemakers place of the assembly process and parts to be manufac- of roads, railways, power lines, canals, engineering sheet of film on the prepared metal plate and expose tured. They may test and inspect machines and structures, buildings and townships, and are both to bright lights, and then treat the plate with equipment. indispensable when it comes to preparing data on the chemicals to bring out the image to be printed; press measurements of lakes, rivers and the coastline. operators mount the developed plate on the off-set In addition, they may help engineers to solve press and monitor the printing process while production problems. Some mechanical engineering The land surveyor can specialise in one of the operating the press; metal decorators operate an off- technicians work in technical sales. The tasks of following fields: geodetic surveying (determining set press that prints on metal. mechanical engineering technicians are more or less markers or beacons according to the lines of latitude evenly divided between intellectual work and manual and longitude), cartography (the drawing of maps), LOCKSMITH work. cadastral surveying (this entails the measuring of Locksmiths install, repair, change and open locks and property for the planning of towns and cities), METALLURGICAL ENGINEERING TECHNICIAN engineering surveying (helping with the design of combination locking mechanisms. They also make The metallurgical technician bridges the gap between roads, bridges and tunnels) and hydrographic keys and duplicate them. the professional metallurgist and the artisan. His oceanographic surveying (surveying the marine training enables him both to communicate with the environment for the development of harbours). In emergencies, e.g. when customers are locked out of cars, homes or offices, locksmiths can pick the graduate on a technical and theoretical level, and guide the artisan on a practical level. LETTERPRESS / LITHOGRAPHIC MACHINE locks, to retrieve keys left inside, or make duplicate keys by impression or key code if the keys have been MINDER lost. Combination locks are opened by touch or by These technicians assist professional metallurgists in Press operators are designated according to the type use of a drill. Locksmiths repair damaged locks by the search for metals and alloys with improved, of press they operate: letterpress, gravure or offset. replacing tumblers, springs and other parts. desired properties. They also assist them to find the Letterpress machine minders operate and are most economic and practical ways of extracting responsible for the maintenance of letterpress Locksmiths also recommend security measures such metals from ores. They do this by studying and printing machines. Letterpress machine minders as periodical re-keying (changing the locking testing the structure and properties of metals to undertake printing done on 'flat bed' letterpress mechanism to fit new key codes) for businesses. determine such things as grain structure, soundness, printing machines. Some locksmiths, known as protective signal consistency and the physical properties and chemical repairers, install and repair burglar and fire alarm content of various metal objects. They receive special printing frames (called 'chases) systems. Most locksmiths work irregular hours containing the typesetting and blocks from the because they are on 24-hour emergency call. They They may supervise production work in foundries and compositor and lock them securely into position on other industries where metals are re-melted for re- the bed of the printing machine. They attach 'make-
Occupations 4 7 35 use. They also test the accuracy of instruments, Electrical installation is another aspect. The artisan The model techniques department has a specialised calculate necessary changes and must be sure that dismantles electric motors, tests them, checks their models and effects section that develops and the finished work meets the quality standards. The wiring and determines their power output and constructs electronic controls and innovations; a work of the metallurgical technician is visible in a wide consumption. Automation also requires skills in puppet effects section which produces marionettes, range of products.Metals are used in the construc- electronics as these skills are used in controlling and hand-, rod-, and electronic controlled puppets; tion of aeroplanes, chemical plants and cars. heavy, electrically powered equipment. and a specialised property section which makes puppet production sets, minute accessories and METEOROLOGICAL INSTRUMENT TECHNICIAN MINE SURVEYOR scenic models such as rural scenes with lakes, rivers, Meteorological instrument technicians are responsible Mining surveyors are responsible for determining the trees or urban scenes. for developing, installing and maintaining the direction of all the underground workings of a mine. sophisticated computer systems, radar, automatic They have to plot these and keep them regularly weather stations and electronic airport systems that updated, so that surface officials and management The model builder works in his own workshop. He is meteorological technicians use in gathering informa- can pinpoint any spot underground at any given time. also in close contact with all the departments involved tion for their weather forecasts. They need to liaise Mining surveyors are also responsible for measuring in the production of a television show or play. frequently with the meteorological technicians and the areas and volumes blasted by the underground the two should, ideally, work as a team with the same crew. Taking ore samples to establish which areas are MOTOR CYCLE AND SCOOTER MECHANIC goalwhich is to gather a high standard of informa- the most profitable to mine is also part of their duties. Motor cycles and scooters need periodic servicing to tion in order to achieve weather forecasts that are as Mine surveyors do their practical work underground operate at peak efficiency. This routine servicing of accurate as possible. in the mornings and spend the afternoons on the motor cycles and scooters represents a major part of surface, assimilating their findings and doing the the mechanic's work. METEOROLOGICAL TECHNICIAN necessary calculations. Man's health, security, food production, ability to These artisans also repair and overhaul motor cycles, work and transport systems are all dependent on the MINING ENGINEER scooters and similar vehicles and assemble new ones. weather. Meteorological technicians play a vital role in Mining engineers are both mining experts and They determine the nature and extent of malfunc- meteorological services. They collect meteorological engineers. They plan, design, construct, operate and tions. They connect a test panel to engines and information with the aid of computers, radar and manage the facilities that are used to get solid measure and adjust generator output, ignition timing, automatic weather stations. After checking this materials out of the earth. These engineers must have etc. They dismantle the engines and repair or replace information they supply short-, medium- and long- a background in geology and in civil, mechanical and defective parts. They remove cylinder heads, grind range weather forecasts to aviation, shipping and the electrical engineering since they must be prepared to valves and scrape off carbon. At times, unobtainable public via radio and television broadcasts and the supervise any phase of mining. parts must be manufactured. newspapers. They also forward the information to the most important weather stations using meteorologi- They are responsible for the economical and efficient They replace worn valves, pistons and cylinders and cal codes. operation of mines and for mining safety. They may put back and test repaired engines. They repair and work with geological and metallurgical engineers to adjust clutches, brakes and drive chains. They also Meteorological technicians are responsible for the locate and appraise new ore deposits. Others may repair or replace headlights, starters, mufflers and maintenance of the instrumentation that they use to develop new equipment or processes for mining. various other parts. They hammer out dents in aid them in making observations. Practically all Mining engineers may also work on problems related frames, weld tears, put in spokes and align wheels. meteorological services are supplied by technicians. to protecting the environment. MOTOR MECHANIC MILLER It is important to note that, although most of the Old and new cars sometimes experience problems in The miller is responsible for the processing of mining engineer's time is spend in the office, he also starting or functioning well mechanically. It is the different types of grain, particularly wheat and maize. works on the site to see whether the instructions are task of the motor mechanic to find, examine and The wheat milling process consists of three stages, followed as planned. repair breakdowns and damages. each with its specific type of machinery. The breaking, scraping and reduction processes take MODEL BUILDER (ARCHITECTURE) After determining the cause of the problem motor place during these stages. The process of maize Model builders (architecture) build scale models of mechanics prepare a quotation for cost of repairs (in milling is much the same as that of wheat, but not as buildings drafted by architects. They construct small shops), or have other workers perform this duty many production stages are required. To ensure that different types of models to depict particular features (in larger shops or dealerships). the correct standard and quality is maintained, millers of the building. These include block models to show are required to test their products. only the extemal form of the building; works models Their tasks include: taking out broken or damaged to represent the plans in concrete form to builders; parts of vehicles, ordering new parts, repairing or In addition the miller supervises the work of mill detailed completed models to show what the actual replacing broken or damaged parts, -utting the workers. Today the milling process is highly mecha- building will look like; interior models showing the vehicle back together in good working condition, nised. The task of the miller consists chiefly of setting internal set-up complete with scale-model furniture. adjusting brakes, tightening body bolts, aligning wheels, and performing routine services to prevent milling machines and supervising their operation.It In this case the roof of the model may lift off, to show is important that millers obey all the relevant health the inside arrangement. Scale models of buildings are problems. regulations. This will ensure a food product of the necessary to obtain practical information as to how highest quality. the building will look when finished, how much MOULDER sunlight will fall through the windows and how the Moulders cast molten metal into moulds to produce MILLWRIGHT / ELECTROMECHANICIAN building fits in with its surroundings. solidified castings. They first prepare and shape the This trade covers mainly mechanical and electrical sand in which the mould is to be formed. They then maintenance work. Tasks include dismantling, fault- prepare the core or inside of the casting by means of finding, repairing and in some cases manufacturing Models are useful because they can help the architect a core box before they place the pattern into the parts, as well as the maintenance, reconstruction and and his client to decide whether the proposed moulding box and pack sand firmly around the installation of machinery. building should be constructed or not. Developers pattern to impress its form in the sand. The top faces also make use of models to illustrate precisely how are covered by moulding boxes. Heavy castings are
, formed by holes being dug in the ground and lined With modern developments towards automation, this the proposed building will look. This enable them to with sand or brickwork. The pattern is then removed trade also requires a knowledge of electronics as sell the buildings before the project has even started. applied in the control of heavy electrically driven and the mould dusted with plumbago. When dry, equipment. The artisans must also have a thorough MODEL BUILDER (TV) molten metal is poured through runners into the mould. After the cast metal has cooled down, the knowledge of the manufacturing of machine Model builders (TV) are responsible for visual effects, mould is broken away and the edges of the solidified components. Although fault- finding is one of their especially those used in children's programmes casting are smoothed, before it is finally machined. major responsibilities, they are mainly concerned with screened on television or presented on stage. They the installation of new machinery. This requires also make specialised props and create unique effects specialised knowledge in fitting. which are utilised extensively in variety and drama NAVIGATING OFFICER (NAVY) productions. The main responsibility of a navigating officer is to determine the ship's position by means of the sun,
48 36 Occupations moon, stars, landmarks, magnetic compasses and PAPER TECHNOLOGIST Most of the work that photolithographers do is done radar, and to keep the ship on course by continually A paper technologist is responsible for controlling the before the printing takes place. They first arrange the referring to these landmarks and equipment. The processes involved in the conversion of the raw photographic film in the processing camera. A captain, chief officer and third officer are all navigat- material,- namely wood,- into paper, cardboard and knowledge of the factors that could influence the ing officers and they take turns to keep watch at sea related products. These processes include the negative of the material to be printed such as the set from the bridge. The navigating officer's skills are manufacture of pulp from the raw materials; supply- copy, line drawings and similar material, is necessary. particularly necessary in situations such as passing ing the chemicals for the various processes; the They develop the film either manually in a darkroom, through narrow waterways and entering and leaving design, manufacture and operation of the paper or by means of a machine, to produce negatives or harbours. He is also responsible for the ship's machines; paper and board making; converting and positives, which are used to imprint the lithographic refuelling and ensuring that the ship's navigational coating; research and development; and project plates that are used on the printing press. They equipment is correctly maintained and used. management. Paper technologists apply their reproduce colour photographs by means of four knowledge of chemical and mechanical engineering negatives (or positives) which are developed sepa- OPTICAL TECHNICIAN and paper factory technology to these processes to rately and transposed onto metal plates. When all of Optical technicians prepare glasses prescribed by ensure high standards of quality in the final product. these plates have been printed, the result is a four- optometrists or ophthalmologists. They study the South Africa is a world leader in paper-manufacturing colour (known as full-colour) picture. They also prescription carefully to decide on the raw materials technology and research. operate photo-composition machines. to be used, and the processes to be followed. Optical technicians (surfacers) select the right kind of lens PATTERN-MAKER PLASTERER blanks and polish them according to the prescrip- The work of the pattern-maker entails the manufac- The plasterer's work generally entails protecting, tions. Finishers measure, mark and cut lenses to fit ture of durable patterns from materials such as wood, strengthening, covering and decorating brickwork the frames, finish lenses and mount them in the plastic, fibreglass or metal. These patterns are the and concrete by plastering the surface. This includes frames. Optical technicians also repair damaged starting point for a chain of activities leading to the tasks such as the completion of concrete ceilings and glasses and frames and prepare contact lenses. The manufacture of castings for products such as pumps the making and fixing of plaster-board ceilings. surfacing, setting of curves, smoothing and polishing, and bearings. shaping of lenses, glazing of lenses and the final Plasterers not only apply but also prepare the checking can all be done automatically. The pattern-maker works from drawings. After the coatings. Sometimes they also lay the finishing material has been selected and marked to size it is surfaces for cement floors. Plasterers may cut and fix ORTHOTIST-PROSTHETIST cut or sawed, finished off and assembled into the tiles in sequence to a plastered dry, wet wall. Some see page 18 pattern or model which is used by the moulder to plasterers do complex decorative and ornamental form moulds for castings. work using moulds or designs. PAINT TECHNOLOGIST PLASTICS AND FIBREGLASS WORKER see page 23 PETROLEUM TECHNOLOGIST Petroleum technologists assist in the exploration of Sectional buildings, bathroom units, tanks, pipes, PAINTER AND DECORATOR and drilling for oil and gas. They make an important canopies and bodies for vehicles and swimming pools are manufactured by plastics and fibreglass Painters and decorators paint, varnish or stain the contribution to the manufacture of fuel, lubricants and other petroleum products. workers. Most of these products are made of indoor or outdoor walls of buildings. fibreglass because it offers a high resistance to rust and corrosion. They measure surfaces to be treated and determine During exploration they do research on different quantities of the materials needed before preparing types of mud used to lubricate bore tips. They also keep daily records of drilling progress. The primary Plastics and fibreglass workers manufacture forms, the surfaces by sanding, scraping or burning away models or moulds old coverings .Sometimes special chemicals need to function of a petroleum laboratory technologist is quality control in a refinery or a lubricant manufac- .They treat the form or mould with a releasing agent be used. Nail holes, cracks or other problem areas to prevent the product from sticking are filled in with plaster, putty or other compounds. turing plant, or in the field of petroleum product application and use. These products are those With a brush or spray-gun they apply successive obtained from crude oil by refining processes and layers of polyester resin until the required thickness When new surfaces are painted, a primer or sealer is obtained and they allow the product to dry and coat may first be applied.Painters and decorators include liquid petroleum and gas, as well as aviation, motor, diesel and furnace fuels, keroseines. solvents, cure mix paints and match colours. They may use rollers They then release the product from the mould and or spray guns rather than brushes as these tools lubricating oils, greases, waxes, bitumen and special products. sandpaper, wash and polish it where necessary. allow paint to dry more quickly. Painters and They also manufacture and fit wooden and metal decorators put up scaffolding or swinging chairs PHOTOGRAVURE ENGRAVER beams for reinforcing cabs, cabins, etc., for pleasure when working on tall buildings or other structures. craft and boats. A photogravure engraver is responsible for the PANEL-BEATER / AUTOMOTIVE BODY RE- reproduction of all material on a copper plate which is The plastics and fibreglass worker must take special PAIRER used in the gravure printing process. He uses care to protect himself from the fibreglass and resin Panel-beaters repair and finish the damaged bodies cameras and screens to photograph the material (this which are difficult to remove from skin and clothing. of vehicles. The damaged parts are first aligned, then may include photographs, text that has been set, line They must wear gloves, aprons and facemasks at all beaten into shape and finally filed for smoothness. drawings, etc.) to be reproduced. He develops a times. The facemasks also protect their lungs from Parts that cannot be reached from the outside are negative and then a positive on a transparent. light- the fibreglass particles, which can be damaging. reshaped using special techniques. Dents that cannot sensitive celluloid or plastic material, which is placed be taken out are filled up with a body filler or lead, beneath pigmented paper in a frame. The pigmented PLASTICS TECHNOLOGIST paper is finally transposed on to a slowly rotating and smoothed. Panels that have been stretched are Plastics technologists do highly skilled work in the heated and then hammered in a special way which copper cylinder in a trough containing hot water, to develop the image or picture. A photogravure plastics industry, which is linked to the chemical has a shrinking effect on the metal. Irreparable parts industry. Initially coal, natural gas and oil are are replaced with new ones, or with used parts from engraver may also develop colour photographs by using three separate colour filters. processed to yield chemicals. Inorganic components scrapyards. Panel- beaters are also responsible for such as salt, water and air are also used in the the final assembly and inspection for correct fit, as preparation of the raw materials. This is only the well as for all the fastening components. PHOTOLITHOGRAPHER / ELECTRONIC ORIGI- NATOR starting point in the manufacture of plastics.
The work of the panel-beater is very demanding Photolithographers are responsible for all the Various techniques and processes are used to because he is expected to continuously hammer the photographic work related to the lithographic printing produce the different types of plastics known. damaged parts of a motor vehicle.In bigger process. The technological developments in the Technologists, sometimes called polymer scientists, workshops the panel-beater works closely with printing industry have taken place at a rapid pace and test these processes and put them into operation. tradesman such as the spray-painter, automotive most of the work is now done by computer.Part of They oversee these processes and the production of trimmer, automotive machinist, automotive sheet the work done by the photolithographer is often done plastics, and test the quality of the plastics and the metal worker and motor mechanic. by desk-top publishing. ultimate consumer product. They locate and correct
49 Occupations 37 factory faults. to size and mounted on wood. The blocks are then accident, or installing or moving heavy machinery. mounted and composed in page form. Riggers play an important role in all branches of heavy industry. The plastics technologist is not only responsible for QUANTITY SURVEYOR the development and testing of plastic products, but A quantity surveyor is a highly qualified member of a ROLL TURNER may also participate in the marketing, production, profession that plays an indispensable role in the The trade name of 'roll turner is descriptive of the sales. services and management activities. building, construction and allied industries, including work by means of which a metal blank is formed mining. His work involves the control of the financial (turned) to a specific shape required for the rolling of PLUMBER aspects of the planning, design and construction of steel in a rolling mill. Railway rails are one of the Plumbers install water, gas and waste-disposal buildings. products roll turners make. systems in homes, factories and other buildings. The quantity surveyor is also described as a 'building At rolling mills metals are shaped by passing heated When installing new systems or modemising old economist'. He acts mainly in the area of cost metal blocks or 'ingots' back and forth between the ones, plumbers take measurements and make- (particularly cost to the client) and is a member of a specially formed rolls of a mill stand, until the desired drawings to show where the pipes will connect with professional team which may include architects, shape and length have been obtained. The roll tumer outside lines and where fixtures will be placed. They engineers, and electrical and mechanical engineers, forms and shapes these sets of rolls by means of a then measure, bend, cut and thread pipes according all of whom are appointed to advise their client on lathe and specially prepared tools such as templates to the drawings. Pipes are joined by bolting, blazing, various aspects of a particular building project. (patterns) until they conform to the specified shape. gluing, screwing or soldering them together. Working from a blueprint the roll turner clamps a RADIO AND TELEVISION MECHANIC steel block in a giant lathe and cuts the desired They also repair weathered and leaky roofs. When The most important tasks of radio and television grooves into the steel block, using cutting tools. The doing repair or maintenance work, plumbers must mechanics are fault- finding and effecting repairs to roll turner constantly checks the shape and size of the locate the cause of the problem and replace broken radio and TV sets, as well as to other devices. These grooves on the roll against a template (pattem). In or wom-out valves, and clear pipes and taps. devices may be defective for various reasons, for this way he manufactures the rolls to be used in Qualified plumbers may own their own businesses example parts that have become worn, faulty parts, rolling mills to shape other steel blocks. and employ and supervise other plumbers. and bad connections as a result of heat and damp- ness. These mechanics find the source of the ROOFERS PRINTERS' MECHANIC problem by checking tubes, observing the picture Roofers are specialist building workers. They use Most large printing concerns are equipped with and sound, and looking for broken connections. their special skills to erect roof structures. They also modem engineering machinery such as lathes, Mechanics may make simple adjustments in cus- apply water proofing and install rainwater equipment grinders, milling machines, etc. A career in this field tomers' homes or use wiring diagrams and special and flashings. offers tremendous scope and includes the mainte- testing equipment to find and fix more complex nance and rebuilding of all classes of printing problems. Research and development has resulted in an machinery. increase in the types of materials the roofer has to Mechanics may set up, install and adjust TV antennas install. Some workers work with traditional materials. and receivers and instruct customers in the proper Other roofers work with very sophisticated water- Printers' mechanics mount, re-install, maintain and use of this equipment. These mechanics also install proofing systems. repair a wide variety of machines and equipment that and repair components in stereo systems, video-tape is used in the printing industry. They assemble, machines, car radios and public address systems. The renovation of buildings is a common practice install and test a new machine, or part of a machine today and requires the special skills of a roofer. so as to integrate its operation with that of the already Roofers work closely with carpenters, bricklayers, existing machines. Most of the radio and television mechanic's work is plasterers and other tradesmen in the building done indoors in a workshop, but it is also expected industry. It is important that the work done by the printers' from him to do extensive travelling to clients' homes. mechanic be completed in as short a time as possible ROTARY MACHINE MINDER because downtime on a printing machine can lead to REFRIGERATION MECHANIC These artisans properly fasten the cylindrical surfaces, huge production losses. The printers' mechanic also The industrial refrigeration mechanic installs, repairs which do the printing, in their fixed positions, after needs to be extremely cautious because negligence and maintains the air-conditioning and refrigeration which they set the rotary machine in motion. They can lead to injuries. equipment used in a wide range of applications. This ensure that stereotypes or lithographic metal plates fit involves reading and understanding mechanical, properly and contact the paper evenly. They place PRINTERS' WAREHOUSING (INCLUDING CUT- electrical and architectural drawings and the use of the huge paper rolls into the rotary machine, set the TING) WORKER hand and workshop tools, brazing and soldering ink rollers, fill the ink holders and make proofs to Before the actual printing of books, newspapers, equipment and measuring instruments. The artisan ensure that all letters and images print properly onto periodicals and other printed matter takes place, the installs the unit and makes the necessary electrical the paper. They examine proofs and adjust the paper must be prepared and submitted in the connections. A good knowledge of electrical machine and the ink until the printing is done appropriate forms and sizes. Printers' warehousing principles is essential. The refrigeration mechanic also properly. They test the colour and ink quantities and (including cutting) workers measure and cut the undertakes the maintenance and repair of units. In check the machine at regular intervals throughout the paper according to specified dimensions. doing this he must be able to trace a fault and make printing process to ensure accuracy and quality repairs and adjustments. These faults may be printing. For cutting they operate power-driven guillotines. electrical or mechanical. The paper is then arranged in batches and prepared RUBBER TECHNOLOGIST for the subsequent printing operation. These RIGGER The rubber technologist applies his knowledge of workers must therefore be well acquainted with Riggers erect hoisting tackle, assemble and erect physics, chemistry and engineering to the process of receiving and despatching procedures. derricks or sheer legs for construction purposes and converting raw rubber material into saleable products install and maintain steel cables and ropes. They like tyres and elastic bands. PROCESS ENGRAVER assist in erecting chimney stacks, large buildings, Process engravers prepare all types of illustrations heavy machinery, etc. Rubber technologists usually specialise in specific that cannot be typeset. They operate process areas of the rubber industry, namely drawing up cameras and produce negatives of photographs and Before objects are handled, riggers calculate their standard formulas for the production of rubber other artwork. These negatives are developed to weight and ascertain the best way of securing and products based on on-going laboratory experimen- make light impressions (exposures) on metal plates moving them. They are responsible for the inspec- tation; designing new rubber products; controlling that are highly sensitive to light. Sections of the tion, lubrication and maintenance of all types of lifting the rubber manufacturing process and ensuring that plates that have been exposed to light become tackle, including cranes, derricks, driving winders, quality standards are maintained throughout; and resistant to acid. When the plate is immersed in a jacks, hoists and manually operated lifting equip- marketing and sales of rubber products. nitric acid bath, the acid etches away the unexposed ment. They usually have a good knowledge of sections of the plate and reveals the sections in full scaffolding, platforms and tripods. They do ground- relief. As soon as a print is ready, it is ruled according work such as clearing up tracks after a railway
50 Occupations SAILMAKER AND UPHOLSTERER In the final stage, the excess soldering or welding is apprenticeship training may still register as appren- Sailmakers and upholsterers use canvas and PVC removed and the article cleaned. Sometimes a tices. sheets to make or repair a variety of articles like tool product has to be treated against rust by galvanising, bags, blinds, camping beds, tents, army webbing, tinplating or treatment with certain chemicals. STONEMASON sails, tarpaulins, garden chairs and sunvisors. Workers install these by hanging or securing them to Stonemasons work predominantly with two types of ceilings or walls. stonenatural cut such as marble, granite and Sailmakers cut canvas and PVC sheets according to limestone, and artificial stone made from cement. the patterns and stack them. They stitch the various SHOPFITTER marble chips or other masonry material. Stonema- pieces together by hand or machine and add the Shopfitters make, assemble and fit display boards, sons cut, shape and clean these stones to build and necessary accessories, like PVC windows, eyelets, showcases, counters, shelves and cupboards in shops repair stone structures such as piers, walls and ropes, zips, press studs and buckles for fastening. or businesses. abutments. They also lay pavements and paths, kerbstones and special types of masonry for vats, Sailmakers also manufacture or repair large items like They interpret architects' drawings for exact specifi- tanks and floors. They may work from drawings in tents, sails and tarpaulins. When articles are made cations and order the required quantities and types of which each stone has been marked for placement. with PVC sheetings only modem apparatus is used to material; they shape the wood and fittings with power fuse the seams together. These artisans also cut and tools in a machine shop, or hand tools at the SYSTEMS ANALYST stitch material lining or stiffening into certain articles. workbench: they build, assemble and fit these see page 24 components into the required positions in the store: SCALE FITTER they paint, stain or polish the finished articles and add TELECOMMUNICATIONS MECHANIC / ELEC- Scale fitters repair and recondition the various the necessary trimmings; they manufacture metal TRICIAN OR TECHNICIAN fittings like grilles, banisters and hand rails in a metal working parts of lever systems and fit replacement Telecommunications mechanics or technicians are parts. They assemble, set up, test and adjust the shop and fit these; and they do minor repairs and fittings. responsible for the maintenance and repair of various types of beam, counter and platform scales. underground and aerial telecommunications lines, These include the Robersval and Beranger level mechanical aids, power installations, satellite earth SIGNWRITER systems fitted with semi- or self-indicating mecha- stations, radio stations, and telegraph offices. nisms. They unpack, erect, set up and adjust self- Signwriters do the lettering for various signs on indicating and partially self-indicating scales. windows, building contractor signboards, walls of They manufacture and repair equipment and parts in buildings, and trucks, etc. workshops where the cabling, wiring and assembling They are also trained to erect, maintain and recondi- of equipment are done. Mechanics or technicians are tion road and rail mass bridges fitted with self- They prepare rough sketches from specifications and supported by telecommunications assistants or indicating and non-self-indicating mechanisms. Parts plan the lettering. They measure the surface on which technical personnel. of scales which cannot be repaired or replaced may the lettering is to be done and mark the height and be made by scale fitters. The measuring of weights, position of the letters in chalk to ensure correct whether of foodstuffs or any other product that is spacing. They then paint the sign, spreading the Their duties may include the following: telephony (the sold according to weight, must be accurate. The paint evenly and making good outlines. A second installation and maintenance of computer controlled authorities act strictly against those who do not abide coat of paint is usually required when the first is dry. equipment), transmission (the installation and by the regulations. The scale fitter must see to it that Signwriters are frequently called upon to do gold maintenance of telephone lines), telegraphy the regulations are not violated. signs on shop windows. Different techniques are (installation and maintenance of telegraphic equip- used to paint on glass. Gold leaf is applied for gold ment), field equipment (the installation and mainte- SCIENTIFIC GLASS BLOWER lettering, which is usually backed with paint. Sign- nance of underground and above-ground telephone The scientific glass blower manufactures glass writers also paint logos and simple illustrations. lines), mechanical or electrical (the repair and instruments and apparatus for use both in laborato- maintenance of equipment in workshops) and the ries and in fieldwork by scientists and engineers in SPRAY-PAINTER application of existing technology (design of new their research, development and tutorial duties. These artisans use spray guns to spray paint onto the advance equipment like the Disa telephone). body work of a vehicle to change its colour or to The glassblower also works in industry, particularly in repaint scratched or damaged paint work. They TEXTILE TECHNOLOGIST the pharmaceutical and chemical industries. The prepare the body work by removing dirt or grease, or Textile technologists have been trained to have a scientific glass blower is often required to assist in the smoothing panelbeater parts, and remove paint good overall knowledge of textile technology, of the design of prototype equipment and thus plays a already on the section, with sandpaper or paint- manufacture and processing of all types of textiles major role in the success or failure of a project. removing chemicals. They cover the rest of the body and their properties. Many have specialised knowl- work with paper in order to protect it. A preliminary edge of a particular field, such as spinning, weaving, His work entails the shaping and forming of a variety coating of primer is applied and this is followed by a knitting, dyeing, testing or quality control. of types and shapes of glass according to specifica- thin layer of primer filler. Spray-painters mix and tions given. The glass can be machined, ground, match paints until exactly the same shade as the rest In industry the textile technologist may be engaged in drilled, blown, bent, fused (welded), twisted, drawn of the vehicle is obtained before the final four or five the quality control of products or processes, or he and parted. coatings of the required colour are applied. Paint has may be involved in supervising the production of to be applied evenly and each coating allowed to dry textiles at various levels of management requiring his SHEETMETAL WORKER thoroughly. particular skills. As a manager the textile technolo- Sheetmetal workers manufacture various types of gists will be concerned, in addition to production articles and components out of sheet metal less than STEREOTYPER problems, with organisational and personnel three millimetres thick, mainly for the construction Stereotypers manufacture the surfaces (stereos) problems associated with the running of a factory. and engineering industries. These artisans make and which are fixed to printing machines to do the install sheet metal ducts for air-conditioning, heating printing. Stereotypers receive the set type in steel He may also assist with technical advice in organisa- and ventilation systems. They make and install flat frames or (forms) from the compositor and manu- tions concerned with the supply of many products metal for kitchen walls and counters and stamped facture stereo plates for the printing machines. The used by the textile industry or assist in technical sales metal for roofing and siding. They also install roof type form is pressed into a moist substance, called advising customers on the best use of suitable gutters and down pipes for rainwater drainage and 'flog', which hardens after the impression is secured products. They also conduct research to develop make skylights and vents for industrial buildings. and the moisture extracted. This negative impres- new or improved materials while laboratory technolo- sions is placed in a casting box and molten metal gists analyses the structure and components of the They manufacture most metal components at the poured on it under slight pressure. It is then rapidly material. shop. They measure, cut, bend, shape and join most cooled and trimmed. A number of plates or casts are of the pieces they will use. After the metal has been manufactured from one mould or matrix. After THEATRE TECHNICIAN cut they cement, bolt, rivet, solder or weld the seams passing through the final stages of production the Theatre technicians are responsible for the smooth and joints together to form ducts, pipes, tubes and stereotypes are sent to the rotary machine minder running of theatrical performances as far as technical other items. who fixes them to the printing machine. Stereotyping aspects are concerned. They usually work in a team is a designated trade but prospective candidates who and are managed by a stage-manager. find employment with an employer providing
Occupations 51 39 Each technician has his own task according to his field ! maintenance of all forms of construction and VEHICLE BODY BUILDER of expertise. We have the following technical fields: development. The work is satisfying and offers a Vehicle body builders design and build chassis and lighting technician, sound technician, property good balance of field and office work. Surveying bodies for vehicles like trucks, trailers, caravans, panel master, scene-painter. costumier and the make-up comprises mainly two fieldstopographical survey- vans and buses. Working from plans, drawings and artist. ing and engineering. specifications, materials are measured out, sawn or cut to size and fitted and welded together to chassis. Lighting technicians use lighting to interpret the Topographical surveying entails the gathering of The floor of the bodywork is then manufactured and moods that artistic directors wish to convey in their information to map the forms of the earth. This is bolted onto the chassis. Metal beams are cut, welded productions. They install and position the correct done by means of triangulation (measuring of together and reinforced to form a sturdy frame for lighting equipment and operate it during produc- angles), traversing, levelling (determining of heights), the body. The panels of the body-work are made tions. aerial photographs, calculating positions and heights, from various sizes and thicknesses of sheet metal establishing place names, and annotating aerial panels which are welded or riveted together onto the The sound technician installs and maintains all sound photographs by indicating the topographical features. framework. Different materials are used for the inside equipment such as microphones and loudspeakers Back in his office, the surveyor applies all of this panels and to insulate/soundproof where necessary. and positions them as required. He is also responsi- information to the task of preparing a detailed land The vehicle body is then cleaned and painted and ble for the pre-recording of the sound effects needed map. He uses a photogrammetric machine to assist in windows are installed and fitted. Finally, the electrical for various productions. the process. fittings and other trimmings are installed.
The property master designs, creates or acquires Engineering surveying entails the collection of all WALL AND FLOOR TILER authentic properties or requisites and places them relevant information on the site of a proposed correctly for use during stage productions. He fixes construction project and mapping out the area. Once The wall and floor tiler applies tiles to floors, walls and all decor elements onto sliding stages or trucks. the design of the project is complete, the surveyor ceilings according to design specifications. He pegs it out on the actual site and also monitors examines plans, measures and marks surfaces to be construction in progress to ensure that it does not tiled, and lays out the work. Metal laths are measured The costumes needed are usually produced by the exceed his layout. and cut to size for walls and ceilings with tin snips costumier. This technician must do research to and tacked to surfaces with staple-guns or ham- determine the type of costume that should be TRACTOR AND AGRICULTURAL MACHINERY mers. The tiler then spreads plaster base over the produced for the play. MECHANIC laths with a trowel, and levels it to a specified thickness. Concrete is spread on sub-floors with a Tractor and agricultural machinery mechanics are trowel and then levelled with a screed. After the tiles The scene-painter is responsible for painting the required to maintain, repair and overhaul farm decor and the make-up artist must ensure that the have been cut and shaped with tile-cutters and biters, machinery, equipment and vehicles such as tractors, the tiler positions them and taps them with a trowel actors portray the character he is acting - for example harvesters, pumps and tilling equipment. a clown. handle to affix them to plaster or adhesive base.
They examine and listen to machines, motors and WEAVER TIMBER / WOOD TECHNOLOGIST engines for defects. They dismantle defective units see page 25 and repair or replace parts using various tools. They see page 11 then reassemble, adjust and lubricate these parts to TOOL, JIG AND DIE MAKER ensure that they operate efficiently. They may install WELDER These artisans are master craftsmen whose products and repair farm irrigation systems and maintain farm The welder plays a key role in the manufacturing are used by operators to mass-produce other electrical systems. Mechanics must be able to work process. His work varies from repair and mainte- products and parts. In tool-making the artisans with both petrol and diesel engines and may nance to welding, construction and manufacture. produce devices that hold metal while it is shaved, occasionally have to do welding. They often have to stamped or drilled. work very quickly since farmers cannot afford to have The welder's skills are used in the construction and important machinery out of order for long. maintenance of pipelines, boilers, nuclear reactors, They make gauges and measuring devices used in pressure vessels, motor cars, oil rigs and turbine manufacturing precision parts. Jigs are devices used UPHOLSTERER castings. The welder must be competent in welding to clamp pieces of metal or other material in a Upholsterers repair and rebuild sofas, chairs and many types of metal, for example mild steel, stainless required position and to guide the tools being used. other upholstered furniture. They remove the steel or aluminium, using various processes. This eliminates marking and positioning pieces of covering and padding from the seat, arms, sides and Recognising welding defects and being able to work individually. The artisans construct dies (forms) back of the piece being redone. The webbing is correct them is also part of his job. to shape metal used in stamping and forging removed and replaced with new webbing. Any operations. They also make moulds for diecasting defective springs are removed and replaced with new The welder must also be able to identify welding and for moulding plastics. Tool, jig and die makers or retied springs. Material is measured and cut for electrodes and filler wire compositions and know how may also build and repair worn or damaged dies, the new covering. The material is then sewn and to store and dry electrodes and fluxes. The three gauges and fixtures. attached to the frame. Finally, upholsterers add most common types of welding are electric arc, trimming, such as braid or buttons. resistance and gas welding. Other methods include TOPOGRAPHICAL AND ENGINEERING SUR- the use of electron beams and laser beams. VEYOR In addition, upholsterers may be required to refinish WOODCARVER Surveying is the science of representing the layout of any wooden surfaces. Some upholsterers work with the land accurately on maps or plans, and indicating interior designers and others work directly with see page 11 the exact position of any structure or other man- customers in determining the amount of work to be made or natural object, above or below ground. It done and the type of fabric to be used. plays a vital role in the planning, provision and
40 52 Occupations BUILDING MANAGER, 15 ENVIRONMENTAL HEALTH LETTERPRESS / LITHOGRAPHIC Index According BUILDING CONTRACTOR, 15 OFFICER, 14 MACHINE MINDER, 35 to Occupation BUILDING SURVEYOR, 31 ESTATE AGENT, 26, 28 LIBRARIAN AND INFORMATION BUYER (RETAIL), 28 EXPLOSIVES TECHNOLOGIST, 33 A WORKER, 11 C EXTRACTION METALLURGIST, 21 LIFT MECHANIC, 35 ACCOUNTANT, 27 CABINETMAKER, 31 F LITHOGRAPHER, 35 ACTOR / ACTRESS, 8, 12 CAREERS IN THE NAVY, 14 FARMER, 25 LOCKSMITH, 35 ACTUARY, 20, 28 CARPENTER / JOINER, 32 FASHION ARTIST, 9 M ACUPUNCTURIST, 16 CARTOGRAPHER, 20, 32 FASHION DESIGNER, 9 ADULT EDUCATOR, 11 MAGISTRATE, 29 CARTOONIST, 8 ADVOCATE, 28 FINANCIAL AND INVESTMENT MAKE-UP ARTIST, 9 CATERER, 13 MANAGER, 15 AERONAUTICAL ENGINEER, 29 MARINE BIOLOGIST, 22 CERAMIST / CERAMIC DESIGNER, FIREMAN, 14 AERONAUTICAL ENGINEERING MARKET RESEARCHER, 22, 29 8 FIRST-AID WORKER, 25 TECHNICIAN, 29 MARKETING MANAGER, 16 CHARTERED ACCOUNTANT, 27 FITNESS / HEALTH CONSULTANT, AGRICULTURAL ECONOMIST, 28 MASSEUR, 25 CHARTERED SECRETARY, 15, 27 11 AGRICULTURAL EXTENSION MATERIALS SCIENTIST, 22 CHEF, 13 FITTER AND TURNER, 34 OFFICER, 24 MATHEMATICIAN, 23 CHEMICAL ENGINEER, 20, 32 FLIGHT ENGINEER, 34 AGRICULTURAL INSPECTOR, 14, MEAT-CUTTING TECHNICIAN / CHEMICAL LABORATORY FLIGHT NAVIGATOR, 34 24 BUTCHER, 13 TECHNICIAN, 21, 32 FOOD SCIENTIST AND AGRICULTURAL TECHNICIAN, 25, MECHANICAL ENGINEER, 35 CHEMIST, 21 29 TECHNOLOGIST, 21 MECHANICAL ENGINEERING CHIROPRACTOR, 17 FOOD SERVICE MANAGER, 15 AGRICULTURIST, 20 TECHNICIAN, 35 CIVIL ENGINEER, 32 FORENSIC ANALYST, 21 AGRONOMIST, 20 MEDICAL LABORATORY CIVIL ENGINEERING FORESTER, 25 AIRCRAFT ELECTROPLATER, 29 TECHNOLOGIST / BIOMEDICAL TECHNOLOGIST, 32 FUEL TECHNOLOGIST, 21, 34 AIRCRAFT INSTRUMENT TECHNOLOGIST, 18 CLERGYMAN /MINISTER, 11 FURNITURE MACHINIST, 34 MECHANIC / AIRCRAFT MEDICAL PHYSICIST, 18, 23 CLOTHING DESIGNER, 8 ELECTRONICIAN, 30 MEDICAL PRACTITIONER COAL TECHNOLOGIST, 32 AIRCRAFT RADAR TECHNICIAN / GARAGE MANAGER, 15 (DOCTOR), 18 COLOUR CONSULTANT, 8 RADIOTRICIAN, 30 GENETICIST, 21 MEDICAL REPRESENTATIVE, 26, COMPANY SECRETARY, 15 28 AIRCRAFT SHEETMETAL WORKER, GEOGRAPHER, 21 COMPOSITOR, 32 30 GEOHYDROLOGIST, 22 METALLURGICAL ENGINEERING COMPUTER PROGRAMMER, 32 AIRCRAFT TRIMMER, 30 GEOLOGIST, 22 TECHNICIAN, 35 COMPUTER SERVICE TECHNICIAN, METALLURGIST / METALLURGICAL AMBULANCE AND EMERGENCY GEOPHYSICIST, 22 32 CARE WORKER, 25 GEOTECHNICIAN, 34 ENGINEER, 23 CONCRETE TECHNOLOGIST, 32 ANAESTHETIST, 17 GLASS INSTRUMENT MAKER, 34 METEOROLOGICAL INSTRUMENT CONSTRUCTION MANAGER, 15, ANALYTICAL CHEMIST, 20 GRAPHIC DESIGNER, 9 TECHNICIAN, 36 32 ANIMAL SCIENTIST, 20 GRAVURE MACHINE MINDER, 34 METEOROLOGICAL TECHNICIAN, COPPERSMITH, 32 ANIMATOR, 8 GYNAECOLOGIST, 17 36 COPYWRITER, 13 ANTHROPOLOGIST, 28 H METEOROLOGIST, 23 CORRECTIONAL SERVICES AQUATIC SCIENTIST, 20 HAIRDRESSER, 13 MICROBIOLOGIST / OFFICER, 14 ARCHAEOLOGIST, 20, 28 HERBALIST, 18 BIOTECHNOLOGIST, 23 COST AND MANAGEMENT ARCHITECT, 8 HERPETOLOGIST, 22 MILLER, 36 ACCOUNTANT, 27 ARCHITECTURAL METALWORKER, HISTORIAN, 28 MILLWRIGHT / COSTUME DESIGNER, 8 30 HOME ECONOMICS TEACHER, 11 ELECTROMECHANICIAN, 36 CREDIT MANAGER, 15, 27 MINE SURVEYOR, 36 ARCHITECTURAL TECHNOLOGIST, HOME ECONOMIST, 11, 13, 28 CRIMINOLOGIST, 28 8, 30 HOMOEOPATH, 18 MINERALOGIST, 23 ARCHIVIST, 11, 27 D HORTICULTURIST, 22, 25 MINING ENGINEER, 36 ARMAMENT FITTER, 30 DENTAL ASSISTANT, 25 HOTEL / MOTEL MANAGER, 16 MODEL BUILDER (ARCHITECTURE), ARMATURE WINDER, 30 DENTAL TECHNICIAN, 17, 32 HUMAN RESOURCES 36 AROMATHERAPIST, 13 DENTAL THERAPIST, 17, 25 MANAGER/PERSONNEL MODEL BUILDER (TV), 36 MOTOR CYCLE AND SCOOTER ART TEACHER, 8, 11 DENTIST, 17 MANAGER, 16 ARTIST, 8 DERMATOLOGIST, 17 HYDROLOGIST, 22 MECHANIC, 36 DIAMOND SAWYER, 32 MOTOR MECHANIC, 36 ASSAYER AND SAMPLER, 30 1 MOULDER, 36 ASTRONOMER, 20 DIE SINKER AND ENGRAVER, 33 ICHTHYOLOGIST, 22, 25 MUSIC TEACHER, 9, 12, 13 ATTORNEY, 28 DIESEL MECHANIC, 33 INDUSTRIAL ECONOMIST, 28 MUSICIAN, 9, 13 AUTOMOTIVE BODY REPAIRER, 30 DIETICIAN / NUTRITIONIST, 17 INDUSTRIAL ENGINEER, 34 AUTOMOTIVE ELECTRICIAN, 30 DIPLOMAT, 26 INDUSTRIAL ENGINEERING N AUTOMOTIVE MACHINIST, 30 DISC JOCKEY, 12 TECHNICIAN, 34 NATURE CONSERVATIONIST, 25 AUTOMOTIVE SHEETMETAL DISPLAY ARTIST, 9 INDUSTRIAL TECHNICIAN NAVIGATING OFFICER (NAVY), 36 WORKER, 31 DOMESTIC APPLIANCE HYDROMETRY, 34 NEUROLOGIST, 18 AUTOMOTIVE TRIMMER, 31 MECHANICIAN, 33 INSPECTOR OF WORKS, 14 NEWS REPORTER, 14 AVIATION TURNER AND DRAMA TEACHER, 9, 11, 13 INSTALLATION ELECTRICIAN, 34 NUCLEAR SCIENTIST / NUCLEAR MACHINIST, 31 DRAUGHTSMAN, 33 INSTRUMENT MECHANICIAN, 35 PHYSICIST, 23 B E INSURANCE AGENT, 26 NURSE, 25 BAKERY TECHNOLOGIST, 13, 20 ECOLOGIST, 21, 25 INTERIOR DECORATOR, 9 0 BANK OFFICIAL, 27 ECONOMIC GEOLOGIST, 21 INTERNAL AUDITOR, 27 OCCUPATIONAL THERAPIST, 18, BEAUTY TECHNOLOGIST / ECONOMIST, 28 INTERPRETER, 13 26 EDITOR, 13 SOMATOLOGIST, 11, 17 J OCEANOGRAPHER, 23 BIOCHEMIST, 20 ELECTRICAL ENGINEER, 33 JEWELLER / GOLDSMITH, 9, 35 OPTICAL TECHNICIAN, 37 BIOKINETICIST, 17 ELECTRICAL ENGINEERING JOINER AND WOOD MACHINIST, OPTOMETRIST, 18 BIOMEDICAL ENGINEER, 17, 31 TECHNICIAN, 33 35 ORAL HYGIENIST, 26 BLACKSMITH, 31 ELECTRICIAN JOURNALIST, 13 ORNITHOLOGIST, 23, 25 CONSTRUCTION, 33 BOATBUILDER AND SHIPWRIGHT, L ORTHOTIST-PROSTHETIST, 18, 37 GENERAL, 33 31 LAND SURVEYOR, 35 ELECTROENCEPHALOGRAPH (EEG) BOILERMAKER / PLATER, 31 LANDSCAPE ARCHITECT / PAEDIATRICIAN, 18 TECHNICIAN, 17 BOOKBINDER, 31 LANDSCAPE TECHNOLOGIST, 9 PAINT TECHNOLOGIST, 23, 37 ELECTRONICS ENGINEER, 33 BOTANIST, 20 LEATHER CHEMIST, 22 PAINTER AND DECORATOR, 37 ENGINEERING GEOLOGIST, 33 BRICKLAYER, 31 LEGAL ADVISER, 28 PALAEONTOLOGIST, 23 ENTOMOLOGIST, 21, 25
53 Occupations 41 PANEL-BEATER / AUTOMOTIVE PRODUCTION MANAGER, 16 SECONDARY (HIGH) SCHOOL TIMBER / WOOD TECHNOLOGIST, BODY REPAIRER, 37 PROFFESSIONAL DANCER, 10, 13 TEACHER, 12 25, 40 PAPER TECHNOLOGIST, 37 PSYCHIATRIST, 19 SECRETARY, 27 TOOL, JIG AND DIE MAKER, 40 PATHOLOGIST, 18 PSYCHOLOGIST, 29 SHEETMETAL WORKER, 39 TOPOGRAPHICAL AND PATTERN-MAKER, 37 PSYCHOMETRIST, 29 SHOPFITTER, 39 ENGINEERING SURVEYOR, 40 PATTERN-MAKER (CLOTHES), 9, PUBLIC RELATIONS OFFICER, 26 SIGNWRITER, 39 TOUR GUIDE, 26 13 PUBLIC PROSECUTOR, 29 SILVICULTURIST, 24 TOWN AND REGIONAL PLANNER, PETROLEUM TECHNOLOGIST, 37 PUBLISHER, 14, 26 SINGER, 10, 13 10, 29 PHARMACIST, 19, 24 PURCHASING MANAGER, 16 SOCIAL WORKER, 12 TRACTOR AND AGRICULTURAL PHOTOGRAPHER, 9 Q SOCIOLOGIST, 29 MACHINERY MECHANIC, 40 PHOTOGRAVURE ENGRAVER, 37 QUANTITY SURVEYOR, 38 SOIL SCIENTIST, 24 TRAFFIC OFFICER, 15 PHOTOJOURNALIST, 10 R SPECIAL EDUCATION TEACHER, TRAINING OFFICER, 12 PHOTOLITHOGRAPHER / RADIO AND TELEVISION 12 TRANSLATOR, 14 ELECTRONIC ORIGINATOR, 37 ANNOUNCER, 14 SPEECH THERAPIST AND TRAVEL AGENT, 26 PHYSICIAN, 19 RADIO AND TELEVISION AUDIOLOGIST, 19, 26 U PHYSICIST, 24 MECHANIC, 38 SPORTS ADMINISTRATOR / SPORT UPHOLSTERER, 40 PHYSIOLOGIST, 19, 24 RADIO PROGRAMME WRITER, 10, ADVANCEMENT OFFICER, 12 V PHYSIOTHERAPIST, 19, 26 13, 14 SPRAY-PAINTER, 39 VALUER / APPRAISER, 27 PLASTERER, 37 RADIOGRAPHER, 19 STAGE MANAGER, 10, 16 VEHICLE BODY BUILDER, 40 PLASTICS AND FIBREGLASS RECEPTIONIST, 27 STATISTICIAN, 24 VETERINARIAN, 19 WORKER, 37 REFLEXOLOGIST, 19 STEREOTYPER, 39 VETERINARY NURSE, 26 PLASTICS TECHNOLOGIST, 37 REFRIGERATION MECHANIC, 38 STOCK CONTROLLER / VETERINARY TECHNOLOGIST, 20 PLUMBER, 38 REMEDIAL TEACHER, 12 INVENTORY AND STORES VIDEO EDITOR, 10 PODIATRIST / CHIROPODIST, 19, RIGGER, 38 MANAGER, 16, 27 STOCKBROKER, 16, 27, 28 26 ROLL TURNER, 38 WALL AND FLOOR TILER, 40 STONEMASON, 39 POLITICAL SCIENTIST, 29 ROOFERS, 38 WEATHER OBSERVER, 24 PRE-PRIMARY SCHOOL TEACHER, ROTARY MACHINE MINDER, 38 SURGEON, 19 WEAVER, 11, 13, 40 SYSTEMS ANALYST, 24, 39 12 RUBBER TECHNOLOGIST, 38 WELDER, 40 PRESS PHOTOGRAPHER, 10 S T WINE-MAKER, 24, 25 PRIMARY SCHOOL TEACHER, 12 SAILMAKER AND UPHOLSTERER, TAXIDERMIST, 10 WOOD SCIENTIST, 24 PRINTERS' MECHANIC, 38 39 TELECOMMUNICATIONS WOODCARVER, 11, 40 PRINTERS' WAREHOUSING SALES MANAGER, 16 MECHANIC / ELECTRICIAN OR WOOL-CLASSER, 25 (INCLUDING CUTTING) SCALE FITTER, 39 TECHNICIAN, 39 WORK STUDY OFFICER, 27 WORKER, 38 SCHOOL COUNSELLOR, 12 TEXTILE DESIGNER, 10 PROCESS ENGRAVER, 38 TEXTILE TECHNOLOGIST, 39 SCIENTIFIC GLASS BLOWER, 39 ZOOLOGIST, 24 PRODUCER FILM AND TV, 10, THEATRE TECHNICIAN, 39 16
54 42 Occupations Traditionally universities provide a broad general background to subjects that are more theoretical than practical, the aim being to provide an understanding of fundamental concepts in a particular discipline. The title "degree" is the qualification awarded at the end of a three or four-yearcourse of study at a university.Most universities however also offer shorter diploma and certificate courses in certain fields of study. The minimum entrance requirement to a degree course at all universities is a Senior Certificate with Matriculation Endorsement. Entry to some degree courses requires specific essential subjects and the attainment of certain minimum symbols.Most diploma courses require a Senior Certificate (Std 10/Grade 12) for the purpose of admission. For all degree courses there are more applicants than there are places and it is necessary for universities to employ selection procedures.These procedures may include a rating system, questionnaires, interviews and/or auditions.
Course informationis listed in alphabetical order by field of study. Use the index of fields of study at the end of this section to trace the field of study in which you are interested. The index will refer you to the relevant page number. Apply in time.Don't wait for your matric results! The application form must be obtained, completed and submitted before a particular closing date. Enrolment dates are determined annually.
Universities 43 e y:to7
Institution Names General Terms
DURBAN University of Natal (Durban) Acc Accounting EDGEW Edgewood College of Education Admin Administration FORT University of Fort Hare Afr Afrikaans HUG Hugenote-Kollege Wellington Agric Agricultural/Agriculture MEDUNSA Medical University of Southern av average Africa Biol Biology NORTH University of the North Cert Certificate NWEST University of the North West Chem Chemistry OFS University of the Orange Free State Dip Diploma PMB University of Natal Econ Economics (Pietermaritzburg) Eng English POTCH Potchefstroom University exam examination PTA University of Pretoria f/t full time QWAQWA University of the North (QwaQwa) Geog Geography RAU Rand Afrikaans University HG higher grade RHODES Rhodes University Info Information SALD Saldanha Military Academy LG lower grade STEL Stellenbosch University M Matric TRANS Transkei University Math Mathematics UCT University of Cape Town Mgt Management UDW University of Durban-Westville Microbiol Microbiology UNISA University of South Africa mths months UPE University of Port Elizabeth Physiol Physiology VENDA University of Venda Phys Sc Physical Science VISTA Vista University Psyc Psychology WCAPE University of the Western Cape p/t part time WITS University of the Witwatersrand Sc Science ZULU University of Zululand Scs Sciences Sec Secondary sem semester sems semesters SG standard grade subj subject subjs subjects Tech Technology UM University Matric Univ University yr year yrs years
44 5G Universities Univ Course Duration Entry Requirements
Accounting - see also Commerce, Accounting- see also Commerce, Finance & Economics Finance & Economics
NORTH B.Compt. 3 yrs UM + Math OFS B.Compt. 3 yrs f/t or 4 yrs p/t UM: Math HG 6096or SG 80% PMB BAccounting 3 yrs UM with Math HG 40% or SG 60% or the Certificate in Business Mgt RHODES B.Accounting 4 yrs UM: Math HG (F) or SG 40% STEL BAccounting 3 yrs UM (70% av) with Acc or Math HG or 60% SG OR UM (60% av) with Acc or Math HG 70% TRANS B.Compt. 3 yrs UM: Math or Acc HG 40% or SG 50% UDW BAccounting 3 yrs UM with Math HG or 50%5G or UM (60% av) UNISA Associate Programme in Treasury Mgt 2 yrs M UNISA B.Compt 3 yrs UM: Math HG 40% or SG 50% UNISA Cert in Fundamental Accounting 10 mths No formal qualifications UNISA Cert in Intermediate Financial Accounting 6 mths The Cert in Fundamental Accounting UNISA Course in Cost Accounting & Quantitative 9 mths M Methods UNISA Course in Practical Accounting 9 mths M UPE B.Com.(Rationum): Commercial Computer 4 yrs UM: Math HG 40% or SG 50% Sc, Econ/Business Mgt, Law VISTA B.Compt 4 yrs UM: Math (F) HG or SG WITS B.Accounting 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + Math HG or, for curricula that do not include Math, Math SG 60%
Administration Administration
FORT BAdmin.: Public Sector Human Resources yrs UM with Matric Math Mgt, Public Sector Mgt & Admin NORTH B.Admin. 3 yrs UM NORTH Dip in Municipal Admin 3 yrs M NORTH Dip in Public Admin 3 yrs (students attend M classes full-time for 1 sem every yr) NWEST B.Public Admin.: Public Admin & Econ, 6 sems UM Public Admin & Industrial Psyc, Public Admin & Political Studies OFS B.Admin. 3 yrs UM PTA BAdmin.: Aviation Mgt, International 3 yrs UM Relations, Public Mgt PTA Univ Dip in Public Admin 2 yrs M with sufficient administrative and managerial experience in the public sector QWAQWA BAdmin. 3 yrs UM STEL B.Admin. 3 yrs f/t or 4 yrs p/t UM (50% av): Math HG or 50%SG TRANS BAdmin.: Personnel Mgt, Public Affairs 3 yrs UM: Math HG 40% or SG 50% UDW BAdmin.: Public Admin, Social Sc 3 yrs UM UNISA B.Admin. 3 yrs UM UNISA Dip in Advanced Public Admin 2 yrs UM. Candidate should be a senior official with 3 yrs appropriate practical experience in the public sector UPE Dip in Advanced Public Admin 2 yrs M + adequate admin experience VENDA B.Admin.: General, Econ, Personnel Admin 3 yrs UM: Eng HG 40% or SG 50%. Econ & Personnel Admin options: Math HG 40% or SG 50%. Students with a pass in Acc, Econ or Business Mgt may be considered WCAPE BAdmin. 3 yrs f/t or 4 yrs p/t UM ZULU BAdmin. 3 yrs UM (40% av)
Agriculture Agriculture
FORT BAgric.: Agric Econ, Extension/Agric 3 yrs UM Production FORT B.Sc.(Agric.): Agric Econ, Agric Production, 4 yrs UM with Math SG 50% Animal Production, Animal & Pasture Sc, Crop Sc & Horticulture, Crop Sc & Soil Sc, Soil Sc FORT Dip: Agric Extension & Rural Development2 yrs p/t UM NORTH B.Agric.Admin. 3 yrs UM + Phys Sc HG (F) or SG 40% NORTH B.Sc.(Agric): Agric Econ, Animal Production, 4 yrs UM + Math HG (F) or SG 40%. Alternatively successful completion of the Unify Business Econ, Chemistry, Econ,_Soil Sc Programme, the Foundation Year in Math and Science will also be acceptable
1J niversities 57 45 Univ Course Duration Entry Requirements Agriculture Agriculture
NWEST B.Agric.: General, Animal Production, Crop 3 yrs UM Production NWEST B.Sc.(Agric.): Animal Production, Crop 4 yrs UM: Math HG or 50% SG + Biol or Phys Sc or Geog HG Production NWEST Dip in Animal Health 3 yrs OFS B.Agric.: Animal Production Mgt, Mixed 3 yrs UM with Math SG. Biol + Phys Sc are strongly recommended Farming Mgt, Plant Production Mgt OFS B.Sc.(Agric.): Agric Econ, Agrometeorology, 4 yrs UM: Math HG or 40%5G. Soil Sc + Genetics (Plant Breeding) options: Math HG 50% or Agronomy, Animal Sc, Food Sc, Genetics SG 60%. Agrometeorology option: Math HG 50% or SG 60%+ Phys Sc SG (Plant Breeding), Pasture Sc, Plant Pathology, Soil Sc PMB BAgric.Mgt. 3 yrs UM: Math HG 40% or SG 60%+ 1 other natural science subj HG 33% or SG 40% PMB B.Sc.(Agric.): Agric Econ, Agric Production, 4 yrs UM: Math HG 40% or SG 60% + 1 other natural science subj HG 40% or SG 50% Animal Sc, Biochemistry, Biometry, Crop Sc, Entomology, Genetics, Grassland Sc, Horticulture, Microbiol, Plant Breeding, Plant Pathology, Poultry Sc, Soil Sc, Wildlife Sc PTA B.InstAgrar: Agric Econ, Agric Extension, 4 yrs UM Agronomy, Animal Production or Horticulture, Food Processing, Land Use Planning, Pasture Sc or Agronomy, Plant Protection PTA B.Sc.(Agric.): Agric Econ, Biochem, Entomol, 4 yrs UM: Math + Phys Sc HG 50%. Lengthened course: Math + Phys Sc HG 40% or SG 50% Food Sc & Tech, Genetics, Meat Sc, Microbiol & Plant Pathology, Pasture Scs or Animal Sc, Soil Sc & Plant Production, Zoology STEL BAgric.Admin.: Mgt, Rural Development 3 yrs UM (50% ay): Math HG 40% or SG 50% + a natural science subj SG 40% STEL B.Sc.(Agric.): Agric Econ, Agric Production, 4 yrs UM (50% av): Math HG 40% or SG 50% + a natural science subj SC 40% Agronomy, Animal Physiol, Animal Sc, Biochemistry, Entomology, Genetics, Horticulture, Microbiol, Plant Pathology, Soil Sc, Viticulture & Oenology VENDA BAgric. 3 yrs UM: Eng HG 40% or SG 50%. Math, Phys Sc + Agric or Biol HG (F) orSG 40% VENDA B.Econ.(Agric) 3 yrs UM: Enq HG 4096or SG 50% VENDA B.Sc.(Agric.) 4 yrs UM: Enq HG 40% or SG 50%. Math, Phys Sc + Agric or Biol HG 40% or SG 50% ZULU B.Sc.(Agric.) 4 yrs UM (40% av): Math HG 40% or SG 50%
Architecture Architecture
DURBAN B.Sc.(Arch.) 4 yrs UM OFS B.Arch.Stud. 3 yrs UM: Math HG or 50% SG + another natural science subj, peferably Phys Sc HG or SG. Portfolio of work PTA B.Arch. 5 yrs _ UM: Math + Phys Sc HG 40% or SG 50% UCT B.Arch.Stud. 3 yrs UM: Math or Science HG 40% or SG 50% or other qualifications such as a technikon dip or creative work or drawings UPE B.Arch. 5 yrs UM with Math SG + special entrance exam WITS B.Arch.Stud. 4 yrs UM + proficiency in Eng Language: Math HG or 60%SG
Biological Sciences Biological Sciences
PTA B.Sc.(Biological Sciences): Biochemistry, 3 yrs UM: Math + Phys Sc HG 50%. Lengthened course: Math + Phys Sc HG 40% or SG 50% Botany, Ecology, Entomology, Food Sc, Genetics, Human Genetics, Human Physiol, Microbiol, Microbiol or Plant Pathology, Molecular Biol, Population Genetics, Soil Sc, Zoology
Building & Construction Building & Construction
DURBAN B.Sc.(Construction Mgt) 4 yrs UM: Math HG 40% or SG 70%
5 8 46 Univer Univ Course Duration Entry Requirements Building & Construction Building & Construction
OFS B.Sc.(Construction Mgt) 4 yrs UM: Math HG or 50% SG + a pass in 1 of the following subjs: Phys Sc, Econ, Business Econ or Acc PTA B.Sc.(Construction Mgt) 5 yrs UM: Math + Phys Sc HG 40% or SG 50% UCT B.Sc.(Construction Mgt) 4 yrs UM: Eng 1st Language HG 40% or Eng 2nd Language HG 60%+ Math HG 40% or SG 60% UPE B.Building Arts 3 yrs UM with Math SG + special entrance exam UPE B.Sc.(Construction Mgt) 4 or 5 yrs, depending on UM with Math HG 40% or SG 50% + special entrance exam curriculum VVIIS B.Sc.(Building) 4 yrs UM + proficiency in Eng Language: Math HG or 60%SG + 1 the following subjs (HG or 60%SG): Biol, Geog, Phys Sc or Physiol
Commerce, Finance & Economics - see Commerce, Finance & Economics - see also Accounting also Accounting
DURBAN B.Com.: General, Acc (CA), Economics, 3 yrs UM: Math HG 40% or SG 7006 Finance, Law, Marketing, Personnel Mgt, Systems Mgt FORT B.Com.: General, Acc, Business Econ & 3 yrs UM with Math SG 40% Industrial Psyc, Business Mgt, Law NORTH B.Com.: Acc, Agric Econ, Auditing, Business 3 yrs UM + Math Mgt, Commercial Law, Econ, Financial Acc, Industrial & Organisational Psyc, Info Systems, Private Law, Statistics NORTH Dip in Municipal Finance 3 yrs NORTH Dip in State Finance 3 yrs (students attend M classes full-time for 1 sem every yr) NWEST B.Com.: Acc & Auditing, Acc & Info Systems, 3 yrs UM: Math SG 40% Acc & Mgt, Acc & Mgt & Education, Mgt & Econ & Education, Mgt & Econ, Mgt & Info Systems, Mgt & Industrial Psyc, Mgt & Statistics, Statistics & Econ or Info Systems OFS B.Com.: Acc, Banking, Econ, Finance, Law, 3 yrs UM: Math SG Marketing OFS B.Econ. 3 yrs UM: Math SG PMB B.Business Admin 3 yrs f/t or 4 yrs p/t UM or the Certificate in Business Mgt PMB B.Com.: General, Acc, Agric Econ, Business3 yrs f/t or 4 yrs p/t UM with Math HG 40% or SG 60% or the Certificate in Business Mgt Finance, Business Info Systems, Business Logistics & Purchasing, Econ, Human Resources Mgt, Law, Marketing & Advertising Mgt POTCH B.Business Admin 3 yrs UM with Math SG 40% POTCH B. Business Communication 4 yrs UM POTCH B.Com.: General, Acc, Accountantship, Acc 3 yrs UM: Math HG 40% or SG 50%. Accountantship option: Math + Acc HG 50% or SG 60% & Informatics, Business & Mgt Acc, Business & Mgt Acc & Informatics, Business Mgt, Communication Mgt, Econ & Informatics, Econ & Money & Banking, Econ & Statistics, Econometrics & Informatics, Human Resources Mgt, Labour & Personnel Relations, Law & Acc, Law & Business Mgt, Law & Econ, Recreation & Tourism Mgt, Sport & Recreation Mgt, Tourism Mgt POTCH B.Com.(Business Communication): 4 yrs UM: Math HG 40% or SG 50% Industrial & Personnel Psychology; Industrial Sociology PTA B.Com.: General, Acc Scs, Agric Econ, 3 yrs UM: Math HG 40% or SG 50%. Econometrics & Insurance option: Math HG 60%. Aviation Mgt, Banking, Business Mgt, Statistics option: Math HG 50% Communication Mgt, Econ, Econometrics, Financial Acc, Financial Mgt, Human Resources Mgt, Informatics, Insurance, Internal Auditing, Law, Marketing Mgt, Recreation & Sport Mgt, Statistics, Tourism Mgt, Taxation QWAQWA B.Com.: General 3 yrs UM: Math
59 Universities Univ Course Duration Entr Requirements
Commerce, Finance & Economics - see Commerce, Finance & Economics- see also Accounting also Accounting
RAU B.Com.: General, Acc, Communication, 3 yrs f/t or 4 yrs p/t UM: Math HG or SG 40% or N5 Math or T2 Math. Afr 1st Language HG 50% or Afr Econ, Financial Mgt, Informatics, Industrial 2nd Language HG 6096. Math, Informatics or Statistics option: Math HG 50% Psyc, Logistics Mgt, Marketing Mgt, Sport Mgt, Transport Econ RHODES B.Business Sc.: Economics, Information 4 yrs UM: Math HG (F) or SG 40% Systems, Management RHODES B.Com.: General, Acc, Econ, Info Systems, 3 yrs UM: Acc option: Math HG (F) or SG 40% Law, Mgt, Social Scs, Statistics RHODES B.Econ.: Business Scs, Mineral Econ, Social 3 yrs UM Scs STEL B.Com.: General, Actuarial, Agric Econ, 3 yrs f/t or 4 yrs p/t UM (50% av). Mgt Acc option: UM (70% av) or Acc or Math HG 60% or SG 80%. Law Financial Acc, Law subjs, Math, Mgt Acc option: UM (60% av) + 1st Language HG 6096 Financial Acc option: UM (60% av). Actuarial + Math option: Math HG 50% or SG 70% STEL B.Econ. 3 yrs f/t or 4 yrs p/t UM (50% av): Math HG or 50%SG TRANS B.Com.: General, Acc 3 yrs UM: General option: Math HG 40% or SG 5096 Acc option: Math or Acc HG 40% or SG 50% UCT B.Business Sc.: Actuarial Sc, Business 4 yrs UM: Math HG 50%. Actuarial Sc option: Math HG 80% + Eng 1st Language HG 60% Finance, Computer Sc, Econ, Human Resources Mgt, Info Systems, Law, Marketing, Organisational Psyc, Quantitative Mgt UCT B.Com.: General 3 yrs UM: Math HG 40% or SG 50% UDW B.Com.: General 3 yrs UM with Math HG or 50%5G or UM (60% av) UNISA Advanced Executive Programme (AEP) 15 mths M with 10 years appropriate experience + ablility to join a study group UNISA Advanced Programme in Human Resource18 mths Cert in Human Resource Managment Mgt UNISA Advanced Programme in Purchasing Mgt 1 yr M (preferably with purchasing or stores experience) UNISA Advanced Programme in Risk Mgt 2 yrs (study school of 5 M days) UNISA Advanced Programme in Tourism, Travel & 2 yrs M Hospitality UNISA Advanced Taxation Cen 18 mths A qualification at B. Degree level UNISA African Mgt Programme 1 yr (study school of 5 M or suitable experience days) UNISA B.Com.: General 3 yrs UM UNISA Cert in Taxation 1 yr No formal qualifications required UNISA Cert in Taxation & Financial Planning for Life 16 mths No formal qualifications required Assurance Consultants UNISA Cert Programme in Basics of Business 1 yr M UNISA Cen Programme in Marketing & Marketing 1 yr M or at least 45 yrs of age Research UNISA CIS Mgt Programme 2 study schools per M or equivalent qualification with a numeric subj eg. Math academic yr UNISA Course in Business Computing 10 mths M or applicable experience UNISA Course in Business Environment & 9 mths Information Technology UNISA Course in Economic Environment 9 mths M UNISA Course in the Basic Principles of Financial 10 mths M or applicable experience Statement Analysis & Interpretation UNISA Development Programme in Labour 1 yr M with 3 years appropriate experience + ablility to join a study group Relations (DPLR) UNISA Fundamental Mgt Programme (FMP) 9 mths M with 3 years appropriate experience + ablility to join a study group UNISA Mgt Development Programme (MDP) 1 yr M with 3 years appropriate experience + ablility to join a study group UNISA Mgt Programme for Trade Unions 1 yr (2 study schools M or relevant work experience during the yr) UNISA Programme in Advanced Marketing Mgt 1 yr A university degree, relevant technikon dip or a cert such as the IMM or the Programme in Marketing or Industrial Marketing UNISA Programme in Business Communication 1 yr M or relevant experience UNISA Programme in Business LogisticS: A 1 yr M Transport Approach UNISA Programme in Entrepreneurship & Small 9 mths M or relevant experience Business Mgt UNISA Programme in Financial Mgt & Investments1 yr M UNISA Programme in Human Resource Mgt 1 yr M or equivalent qualification UNISA Programme in Industrial Marketing 1 yr M or equivalent qualification UNISA Programme in International Business 1 yr M or equivalent qualification UNISA Programme in International Freight Mgt & 1 yr M or equivalent qualification Admin for Importers & Exporters
60 48 Universities Univ Course Duration Entry Requirements Commerce, Finance & Economics - see Commerce, Finance & Economics - see also Accounting also Accounting
UNISA Programme in Marketing Mgt 1 yr M or equivalent qualification UNISA Programme in Purchasing Mgt 1 yr M (preferably with purchasing or stores experience) UNISA Programme in Retail Mgt 1 yr M or 5 years relevant experience or 45 yrs of age UNISA Programme in Road Transport 1 yr M UNISA Programme in Total Quality Mgt 1 yr (with a study school)M or equivalent qualification UNISA Short Course in Estate Agency Mgt 6 mths M or relevant experience UNISA Short Course in Multi-cultural Sensitivity for 6 mths M or suitable experience Managers UNISA Short Course in Practical Project Mgt (PPM) 6 mths (workshop of 4 M or appropriate experience and a half days) UPE B.Com.: Acc (CA), Business Mgt & Acc, 3 yrs f/t or 5 yrs p/t UM: Math HG 40% or SG 50% Commercial Computer Sc, Econ & Business Mgt, Econ & Acc, Econ & Econometrics, Econ Statistics, Industrial & Organisational Psyc, Law, Public Admin, Regional Development, Social & Natural Scs, Sport & Recreation Mgt, Teaching VENDA B.Com.: Acc, Business Mgt, Cost & Mgt Acc, 3 yrs UM: Eng + Math HG 40% or SG 50%. Students with a pass in Acc, Econ + Business Econ, Industrial Psyc, Industrial Sociology, Mgt may be considered Law VISTA B.Com.: General 3 yrs UM: Math HG or SG (F) WCAPE B.Com.: General, Acc, Computer Sc, Econ, 3 yrs f/t or 4 yrs p/t UM: Math HG or SG. Computer Sc option or Math as a subject choice: Math HG 40% Education, Human Resources or SG 50% WITS B.Com.: General 3 yrs f/t or 4 yrs p/t UM + proficiency in Eng Language. Eng 1st Language HG or Eng 2nd Language HG 40%+ Math HG or, for curricula that do not indude a course in Math, Math SG 60% WITS B.Econ.Sc. 3 yrs UM + proficiency in Eng Language: Math HG + Eng 1st Language HG or Eng 2nd Language HG 40% ZULU B.Com.: General 3 yrs UM (40% av): Math HG 40% or SG 50%
Counselling Counselling
UNISA Advanced Programme: Externship 1 yr (practical work included) UNISA Cert in Career Guidance 1 yr (workshop induded) M + the ablility to communicate in English UNISA Cert: Basic Counselling Course 1 yr (practical work included) UNISA Cert Christian Counselling 1 yr (practical work induded) UNISA Cert: Counselling the young child & 6 mths (practical work adolescent included) UNISA Cert: Fadlitator Skills 7 mths (practical work induded) UNISA Cert: Lay Counsellor Programme 1 yr (workshops included) Any primary, secondary or tertiary education UNISA Intoductory Programme: Extemship 1 yr (practical work induded)
Dentistry & Oral Hygiene Dentistry & Oral Hygiene
MEDUNSA B.Dental Science (BDS) 5 yrs + 6 mths UM: Math + Phys Sc (preferably HG) MEDUNSA B.Dental Therapy 3 yrs UM: Math + Phys Sc (preferably HG) MEDUNSA B.Oral Hygiene 3 yrs UM: Math + Phys Sc (preferably HG) PTA B.Ch.D. 5 yrs + 6 mths UM: Math + Ftrys Sc HG 6096 PTA Univ Dip in Oral Hygiene 2 yrs UM: Phys Sc and/or Biol HG or 50%SG STEL B.Ch.D. 5 yrs + 6 mths UM (50% av): Math HG or 60%5G STEL Dip in Oral Hygiene 2 yrs UM UDW B.Dental Therapy 3 yrs UM with Biol UDW Univ Dip in Oral Health 2 yrs UM with Biol WCAPE B.Ch.D. 5 yrs + 6 mths UM: Math + Phys Sc or Biol HG 40% or SC 50% WCAPE Dip in Oral Hygiene 2 yrs M: Biol, Phys Sc or Physiol HG 40% or SG 50% WITS B.Dental Science (BDS) 5 yrs + 6 mths UM + proficiency in Eng Language: Math HG or 60%SG + 1 of the following subjs (HG or 60%5G): Biol, Phys Sc, Physiol
61 Universities 1 49 Univ COurSe DUration Entry Requirements Dentistry & Oral Hygiene Dentistry & Oral Hygiene
WETS B.Sc.(Oral Biology) 4 yrs UM + proficiency in Eng Language: Math HG or 60%SG + 1 of the following subjs (HG or 60%SG): Biol, Phys Sc, Physiol WITS Dip in Oral Hygiene 2 yrs UM + proficiency in Eng Language
Dietetics & Food Science Dietetics & Food Science
MEDUNSA B.Sc.(Dietetics) 4 yrs UM: Math + Phys Sc (preferably HG) NORTH B.Nutrition 4 yrs UM with a rating of 30 points on the selection scale. Math HG (F) or SG 40% + Biol and/or Phys Sc OFS B.Sc.(Dietetics) 4 yrs UM: Math SG PMB B.Sc.(Dietetics) 3 Yrs UM: Math HG 4096 or SG 60%+ 1 other natural sdence subj HG 40% or SG 50% POTCH B.Sc.(Dietetics) 4 yrs UM: Math HG or a natural science subj HG (preferably Phys Sc) + Math SG PTA B.Dietetics 4 yrs UM: Math + Phys Sc HG 50% STEL B.Sc.(Dietetics) 4 yrs UM (50% av): Math + Phys Sc, one on HG (Math SG at least 4096) or Math + a natural science subj HG or 60%5G STEL BSc.(Food Sc): Food Sc & Biochem, Food Sc 4 yrs UM (50% ay): Math HG 40% or SG 506I6 + a natural science subj SG 40% & Chem WCAPE B.Sc.(Dietetics) 4 yrs UM: Math + Biol or Phys Sc HG 4096 or SG 5096
Drama & Dance Drama & Dance
OFS BA(Drama & Theatrical Arts) 3 yrs UM PTA BA.(Drama) 3 yrs UM STEL B.Drarna 3 yrs UM (50% av) UCT BA & Performers Dip in Speech & Drama 4 yrs UM + a successful audition: Eng HG 50% or SG 70% or both Eng + Math HG 40% or (Combined) SG 60% plus 4 of the following subjs (HG or SG): African Languages, Afr, Arabic, Art, Biblical Studies, Biol, Drama, Econ, Eng, French, Geog, German, Greek, Hebrew, Hindi, History, Italian, Latin, Math, Music, Nederlands, Phys Sc, Portuguese, Spanish UCT Dip in Ballet 3 yrs M + the Royal Academy of Dancing or the ISTD Cecchetti Elementary Cert or ability to profit from the instruction, notwithstanding the requirements of the rules UCT Performers Cert in Dance 2 yrs Std 9 + the Royal Academy of Dancing or the ISTD Cecchetti Intermediate Cert or ability to profit from the instruction, notwithstanding the requirements of the rules UCT Performers Dip in Speech & Drama 3 Yrs M + a successful audition UDW B.Drama 4 yrs UM WITS BA(Dramatic Art) 4 yrs UM + proficiency in Eng language: Eng 1st Language HG or Eng 2nd Language HG 40% + 2 of the following subjs (HG): A Language, Art, Biblical Studies, Bid, Drama, Econ, Geog, History, Math, Music, Phys Sc, Physiol, Speech & Drama ZULU B.Dramatic Art 3 yrs UM (4096 ay)
Education Education
DURBAN B.Prim.Ed. 4 yrs UM DURBAN B.Science Education 4 yrs UM with Math + Biol or Phys Sc HG 40% or SG 7096 DURBAN Univ Dip in Adult Education 2 yrs M + 3 yrs relevant experience in the field of adult education, training and development or any person who_has received permission of the Senate to register for the Diploma DURBAN; Higher Dip in Education: Human Scs, 4 yrs M with 6 subjs (no LG subjs) + an ay of 900 marks: 1st Language HG + 2nd EDGEW Science, Technika Language HG (F) or SG 40% + 1 additional subj on HG DURBAN; Higher Dip in Education: Art, Econ Scs, 4 yrs M with 6 subjs (no LG subjs): 1st Language HG 50%+ a pass in the 2nd Language + Technikon Home Earn, Technika (Electrical, Electronics 1 additional subj at HG (official Languages excluded). Acc option: Math HG 40% or Natal or Mechanical) SG 50% and/or Acc HG 50% or SG 6036. Technika option: Math + Phys-Sc HG or SG 70% FORT B.Ped.: Agriculture, Commerce, Fine Art, 4 yrs UM: Commerce option: Math SG 4096. Science option: Math SG 50% or HG 4096, Human Movement Studies, Humanities & students with Math (F) can only major in Botany or Geog Social Scs, Music, Science NORTH BAgric.(Ed.) 4 yrs UM + Eng HG 4036 or SG 5(1% plus 2 of the following subjs: Math HG (F) or SG 40%, Phys Sc HG (F) or SG 40%, Biol HG 40% or SG 50%, Geog HG 40% or SG 50%, Agric Sc HC 4096 or SG 50% NORTH B.Com.(Ed.) 4 yrs UM + Math HG 40% or SG 50% NORTH &Information Studies (Ed.) 4 yrs UM
62 Universities Univ Course Duration Entry Requirements Education Education
NORTH B.Sc.(Ed.) 4 yrs UM with a rating of 30 points on the selection scale. Math HG (F) or SG 40%. Alternatively successful completion of the Unify Programme, the Foundation Year in Math and Phys Sc will also be acceptable NWEST BA(Ed.) 4 yrs UM NWEST BA(Ed.)(Fine Art) 4 yrs UM NWEST B.Agric.(Ed.) 4 yrs UM NWEST B.Com.(Ed.) 4 yrs UM: Math 40% NWEST B.Sc.(Ed.) 4 yrs UM: Math HG or Math SG 50% + 1 of the following subjs at HG: Biol, Geoq or Phys Sc NWEST Dip in Education: Human Scs, Science 3 yrs M: Science option: Math HG or SG 50% OFS BA(Ed.): General, Drama & Theatrical Arts,4 yrs (5 yrs for the UM: Music option: Music HG 50% or SG 60% or Grade 7 (UNISA) or equivalent Fine Fine Art, Human Movement Sc, Languages,BA(Ed.) with Fine Art) Art option: portfolio of art work Music subjs OFS BAgric.(Ed.) 4 yrs UM: Math HG or 40%SG OFS B.Com.(Ed.) 4 yrs UM: Math SG OFS B.Econ.(Ed.) 4 yrs UM: Math SG OFS B.Mus.(Ed.): General, Jazz 4 yrs UM: Music HG 50% or SG 60% or Grade 7 (UNISA) or equivalent OFS B.Prim.Ed.: Junior Primary, Pre-primary, 4 yrs UM Senior Primary OFS B.Sc.(Ed.) 4 yrs UM: Math SG + Phys Sc SG 40%or Biol HG 5096 or SG 60% OFS B.Sc.(Home EconXEd.) 4 yrs UM (50% av): Math SG + Phys Sc SG 40% or Biol HG 50% or SG 60% OFS B.SecEd. 4 yrs UM: Math SG + Phys Sc SG 40%or Biol HG 5096 or SG 60% OFS Higher Dip in Education: General, Art, 4 yrs UM: Industrial Arts/Graphics option: 50% in Woodwork or Wood + Metalwork or Commercial subjs, Drama & Theatrical Arts, Craftsmanship or Farm Mechanics or an ability test in Industrial Arts. Natural Scs Home Econ, Industrial Arts/Graphics, option: Math SG + Phys Sc SG 40% or Biol HG 50% or SG 60%. Art option: portfolio of Natural Scs art work PMB Cert for Adult Educators 2 sems M with Eng reading + writing proficiency. Candidates with lower Educational qualifications, may be admitted provided they have appropriate experience or other qualifications PMB Undergraduate Dip for Adult Educators 4 sems M or the Cert for Adult Educators + 3 yrs relevant experience POTCH B.Mus.(Ed.) 4 yrs UM: Matric Music HG or SG 60% or Grade 7 in one instrument + Grade 5 Theory (UNISA) POTCH B.Prim.Ed. 4 yrs UM POTCH Higher Dip in Education (Sec): Econ Scs, 4 yrs M: 2 of the official languages one thereof must be Mr. Afr 2nd Language HG or Afr Human Scs, Natural Sa 1st Language 5G. A total of 3 subjs on HG (Languages may be induded) are required PTA BA(Ed.): General, School Guidance 4 yrs UM: Afr + Eng PTA BA(Ed.)(M) 4 yrs UM + an aptitude test PTA BA.(Ed.)(PhYs Sc) 4 yrs UM PTA B.Home Econ (Ed.) 4 yrs UM: Math + Phys Sc HG 50% PTA B.Mus.(Ed.) 4 yrs UM: Music HG 50% or SG 60% or Grade 7 Practical + Grade 5 Theory (UNISA) PTA B.Prim.Ed.: junior Primary, Pre-primary, 4 yrs UM: Afr + Eng HG 40% or SG 50% Senior Primary PTA B.Sc.(Ed.) 4 yrs UM: Math + Phys Sc HG 50% PTA Higher Dip in Education: General, 4 yrs M with Eng + Afr of which the 1st language + 1 other subj must be on HG Commential.subjs; Home Econ, Physical (languageseicduded). Home Econ option: Phys Sc or.:Mattvl:&: Educatioh* RAU B.A.(Ed.) 4 yrs UM RAU B.Com.(Ed.) 4 yrs UM with Math HG or SG 4036 or N5 Math or T2 Math. Afr 1st Language HG 5096 or Mr 2nd Language HG 60% RAU B.Inf.(Ed.) 4 yrs UM RAU B.Sc(Ed.) 4 yrs UM with Math HG 50% RAU Higher Dip in Education 4 yrs M with Afr or Eng + another official SA language + an av of 50% for the final total. The 1st Language + another subj (official languages excluded) should be passed on HG. Afr or Eng 1st Language HG 50% or Afr or Eng 2nd Language HG 60% or Afr or Eng SG 60%. In addition the specific requirements for the school subjs concerned must be met RHODES B.Prim.Ed. 4 yrs UM RHODES Higher Dip in Education (Sec) 4 yrs UM RHODES Univ Education Dip (Sec) 4 yrs UM STEL BA(Ed.)(Fine Art) 4 yrs UM (50% av) STEL BAgric(Ed.): Agric Production, Education 4yrs UM (50% av): Math HG 40% or SC 50% + a natural science subj SG 40% STEL B.Home Econ (Ed.) 4 yrs UM (50% av): Math SG or a natural science subj HG or 60%SG STEL B.Mus.(Ed.): Class Music, Instrumental or 4 yrs UM (50% av): Music MG 50% or SG 60% or Grade 7 Practical + Grade 6 Harmony Vocal ( UNISA) or an admission exam STEL B.Prim.Ed.: Junior Primary, Senior Primary 4 yrs UM (50% av): Afr 1st Language + Eng 2nd Language HG 50% STEL B.Sc.(Home EconXEd.) 4 yrs UM (50% av): Math + Phys Sc with 1 on HG (Math SG at least 40%) or Math HG + a natural science subj HG or 60%5G STEL Dip in Education (Sec): Commercial Scs, 3 yrs M: Two official Languages HG + 1 other subj on HG Human Scs, Natural Scs STEL Higher Dip in Education (SecXTech) 4 yrs M: 1st + 2nd Language HG + 1 other subj on HG. Math or a natural science subj SG
63 Universities 51 Univ COur se Duration Entr Requirements
Education Education
STEL Licentiate in Music Education 3 yrs M (50% av): Music HG 50% or SG 60% or Grade 7 Practical + Grade 6 Harmony (UNISA) or an entrance exam TRANS B.A.(Ed.) 4 yrs UM TRANS B.A.(Mus.)(Ed.) 4 yrs UM: Grade 5 Music Theory TRANS B.Com.(Ed.) 4 yrs UM: Math HG 40% or SG 50% TRANS B.Sc.(Ed.) 4 yrs UM: Math HG 40% or SG 50% UDW B.Mus.(Ed.) 4 yrs UM with Matric Music 60% or Grade 7 Practical (UNISA) + a comparable theoretical standard. Audition UDW B.Paed.: Commerce, Human Scs, Natural 4 yrs UM: Natural Sc option: Math HG or 50%SG + Biol or Phys Sc HG or 50%5G. Scs, Primary Education Commerce option: Math HG or 50%SG or UM (60% av) UNISA B.Prim.Ed. 4 yrs UM + 2 official languages, 1 of which must be Eng or Mr as First Language HG 40% + another HG subj 40% (languages excluded) UNISA Cert Course for Adult Basic Education & 1 yr Std 8 Training (ABED UNISA Cert Course for Distance Education 1 yr M or appropriate experience Practitioners UNISA Cert Course: Reception Year Teaching 1 yr A recognised Teacher's Dip or a level 2 NGO-Cert in Early Childhood plus (Grade 0) experience. Students with M + 2 yrs experience of early childhood development will also be considered UNISA Cert Courses in Peace Education & ConflictShort courses - 6 mths; Mgt Cert9 mths; Programme - 1 yr UNISA Cert for Environmental Educators 6 mths Completion of secondary schooling UNISA Cert for Trainers 1 yr M or appropriate experience UNISA Cert: Student Development 7 mths No formal educational requirements UPE BA(Ed.) 4 yrs UM UPE B.A.(Ed.XHuman Movement Sc) 4 yrs UM UPE B.Com.(Ed.XSecondary Teaching) 4 yrs UM: Math HG 40% or SG 50% UPE B.Mus.(Ed.) 4 yrs UM: Music HG 50% or SG 60% or Grade 7 Practical + Grade 5 Theory UPE B.Prim.Ed.: Junior Primary, Senior Primary 4 yrs UM UPE Dip in Education (Secondary Teaching) 3 yrs M with 2 official Languages. A candidate must have passed 3 subjs on HG which may include the Languages UPE Higher Dip in Education 4 yrs M with 2 official Languages. A candidate must have passed 3 subjs on HG which may include the Languages VENDA B.A.(Ed.): Music, Primary, Secondary 4 yrs f/t or p/t. Music UM: Eng HG 40% or SC 50%. Music option: Matric Music HG 40% or Cert in Music only f/t from Venda Univ 60% or ABRSM Grade 6, Trinity College Grade 6 or UNISA Grade 5 VENDA' B.Agric.(Ed.) 4 yrs UM: Eng HG 40% or SC 50%. Math, Phys Sc + Agric or Biol HG (F) or SG 40% VENDA Dip in Early Childhood Education 1 yr p/t M: Eng + the mother tongue language VISTA BA(Ed.) 4 yrs UM VISTA B.Com.(Ed.) 4 yrs UM: Math HG or SG (F) VISTA B.Sc.(Ed.) 4 yrs UM: Math HG 40% or SG 50% VISTA Dip in Education (Secondary Phase: Natural3 yrs M: Math HG (F) or SG 40% Sc) WCAPE BA(Ed.) (Human Ecology) 4 yrs UM: 40% HG or 50%SG in 1 of the following subjs: Biol, Phys Sc, Physlol or Math WCAPE B.Bibl.(Ed.) 4 yrs UM WCAPE B.Sc.(Ed.) 4 yrs UM: Math + Biol or Phys Sc HG 40% or SG 50% WCAPE Cert for Educators of Adults 2 yrs p/t Std 8 + an adequate level of competency in written and spoken Eng or Afr plus at least 2 yrs experience in Adult Education or related field WCAPE Higher Dip in Education (Non-graduate): 4 yrs M: 1st Language (official) HG 40% or SG 50% + 2nd Language (official) HG 33,3% + 1 Human Ecology, Human Movement Studies, other subj on HG. Math is required when science subjs are induded in the Human Scs curriculum. Human Ecology option: 40%HG or 50%5G in 1 of the following subjs: Biol, Phys Sc, Physiol or Math. Human Movement Sc option: physically fit and not older than 30 yrs of age WITS B.A.(Ed.) 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + 2 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys 5c, Physiol, Speech & Drama WETS B.A.(Ed.XFine Art) 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40%+ 2 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys Sc, Physiol, Speech & Drama WITS B.Mus.(Ed.) 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + 2 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys 5c, Physiol, Speech & Drama VATS B.Phys.Ed. 4 yrs UM + proficiency in Eng Language WITS B.Prim.Ed. 4 yrs UM + proficiency in Eng Language wrrs Higher Dip in Education: Math, Phys Sc 4 yrs UM (M may be considered) + proficiency in Eng Language: Phys Sc option: Math + Phys Sc HG or 50% SG. Math option: Math HG WITS Univ Education Dip: Math, Phys Sc 4 yrs UM (M may be considered) + proficiency in Eng Language: Phys Sc option: Math + Phys Sc HG or 50%5G. Math option: Math HG
64 52 Universities Univ Course Duration Entri"Requirernents Education Education
ZULU B.Paed.: Agriculture, Commerce, Home 4 yrs UM (40% av): Commerce + Natural Sc options: Math HG 40% or SG 50% Econ, Human Movement Sc, Human Scs, Natural Scs, Primary ZULU Senior Secondary Teacher's Dip: Commerce, 3 yrs UM (40% av). Commerce -- Natural Science options: Math HG 40% or SG 50% Human Sciences, Natural Sciences
Engineering Engineering
DURBAN B.Sc(Engineering): Agricultural, Chemical, 4 yrs UM: Math + Phys Sc HG 60% Civil, Electrical, Electronic, Mechanical PMB B.Sc.(Engineering): Agricultural, Chemical, 4 yrs UM: Math + Phys Sc HG 60% Civil, Electrical, Electronic, Mechanical POTCH B.Engineering: Chemical, Chemical 4 yrs UM: Math + Phys Sc HG 50% or Technikon students with Math T2 60% and/or Chem (Minerals Processing), Electrical, Electronic, + Physics T2 50% Mechanical, Material (Physical Metallurgy) PTA B.Engineering: Agricultural, Chemical, Civil,4 yrs UM: Phys Sc + Math HG 60% Electrical, Electronic, Industrial, Mechanical, Metallurgical, Mining RAU B.Engineering: Civil, Electrical & Electronic, 4 yrs UM. Candidates should comply with a specific minimum requirement for admission, Mechanical and apply for admission to the Deputy Director, Faculty of Engineering STEL B.Engineering: Chemical, OW, Electrical & 4 yrs UM (50% av): Math + Phys Sc HG 50% Electronic, Industrial, Mechanical UCT B.Sc.( Engineering): Chemical, C.Nil, Electrical, 4 yrs UM: Math + Phys Sc HG 50%. Eng 1st Language FIG 50% or 2nd Language HG 60% Materials, Mechanical UDW B.Sc.(Engineering): Chemical, Civil, Electrical, 4 yrs UM: Math HG 50% Mechanical UPE B.Sc.(Engineering) Only the 1st -yr course for UM with Math SG this degree is offered. After completion of the l st -yr course students can apply to another SA University to continue their studies WITS B.Sc.(Engineering): Aeronautical, Chemical,4 yrs UM + proficiency in Eng Language: Math + Phys Sc HG Civil, Electrical, Industrial, Mechanical, Metallurgy & Materials (Physical Metallurgy, Minerals Processing), Mining
Environmental Science Environmental Science
VENDA B.Environmental Science 3 yrs f/t or 4 yrs p/t UM or professional experience: Eng + Geog HG 40% or SC 50% + 1 of the following subjs (HG 40% or SG 5030: Biol, Econ, Phys Sc or Agric
Fine Art Fine Art
FORT B.Fine Art 4 yrs UM FORT Dip in Fine Art 3 yrs UM NWEST B.A.(Fine Art) 8 sems f/t UM or a Post-Matric Dip + 3 yrs teaching experience OFS BA(Fine Art) 4 yrs UM + portfolio of art work PMB B.A.(Fine Art) 4 yrs UM PTA BA(Fine Art): Fine Art, Info Design 4 yrs UM RHODES B.Fine Art: Graphic Art, Painting, 4 yrs UM Photographic Arts, Sculpture RHODES Dip in Fine Art Graphic Art, Painting, 4 yrs M or suitability to take the course Photographic Arts, Sculpture STEL B.A.(Fine Art): Applied Graphics, Creative 4 yrs UM (50% av) Jewellery & Metal Design, Fine Art UCT BA(Fine Art) 4 yrs UM + a successful portfolio: Eng HG 50% or SG 70% UDW B.A.(Fine Art) 4 yrs UM UNISA B.A.(Fine Art) 4 yrs UM. Ability to attend 2 workshops per year
Universities Univ Cour-se Duration ' Entry Requirements Fine Art Fine Art
WITS B.A.(Fine Art) 4 yrs UM proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% - 2 of the followingsubjs(HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys Sc, Physiol, Speech & Drama
Forestry & Wood Science Forestry & Wood Science
STEL B.Sc.(Forestry): Forest Sc (Harvesting), Forest 4 yrs UM (50% av): Math SG 50% + a natural sciencesubjSG Sc (Nature Conservation) STEL B.Sc.(Wood Sc) 4 yrs UM (50% av): Math SG 50% + a natural sciencesubjSG
Health Education Health Education
TRANS Dip in Health Education & Promotion 3 yrs
Home Economics Home Economics
OFS B.Sc.(Home Econ) 4 yrs UM: Math SG + Phys Sc SG 40% or Biol HG 50% or SG 60% POTCH B.Home Econ: Education, Natural Sc, Socio- 4 yrs UM: Math HG or a natural sciencesubj(preferably Phys Sc) HG + Math SG Econ PTA B.Home Econ: General, Clothing Mgt, Food4 yrs UM: Interior Design option: Math + Phys Sc HG 40% or SG 6096. Food Mgt option: Mgt, Interior Design Math HG 4096 Clothing Mgt option: Math HG 40% or SG 50% STEL B.Home Econ: General, Housing 4 yrs UM (50% av): Math SG or a natural sciencesubjHG or 6036SG. Food option: Math SG Sc /Clothing, Development, Food + a natural sciencesubjHG or 60%SG. Phys Sc is a strong recommendation STEL B.Sc.(Home Econ) (Food) 4 yrs UM (50% av): Math + Phys Sc with one thereof on HG (Math SG at least 4096) or Math + a natural sciencesubjHG or 60%SC ZULU B.Home Econ 4 yrs UM (40% av)
Human Ecology Human Ecology
WCAPE B.A.(Human Ecology) 4 yrs UM: Biol, Math or Phys Sc: HG 40% or SC 50%
Human Movement Science Human Movement Science
PTA BA(Phys Sc) 3 yrs UM RHODES BA.(Human Movement Studies) 3 yrs UM UDW BA(Human Movement Studies) 3 yrs UM WCAPE B.A.(Human Movement Studies) 3 yrs UM + report of physical fitness
Human Sciences- see also Social Human Sciences - see also Social Sciences Sciences
DURBAN BA: General 3 yrs UM FORT B.A.: General 3 yrs UM NORTH BA: Education; Human Scs; Law, Political &3 yrs UM Administrative Scs; Social Scs WEST BA.: General 6 sems UM or a Post-M Dip + 3 yrs teaching experience OFS BA: General, Geog, Human Movement Sc,3 yrs UM Languages, Lawsubjs,Theology PMB B.A.: General 3 yrs UM
66 54 Universities Univ Course Duration Entry Requirements Human Sciences - see also Social Human Sciences - see also Social Sciences Sciences
POTCH BA: General, Art, Behavioral & 3 yrs f/t or 4 yrs p/t UM Environmental Scs, Communication subjs, Languages, Law subjs, Music subjs, Nursing subjs, Political Sc, Theology subjs PTA BA: General, Info Sc, Music, Political Scs, 3 yrs f/t or p/t UM Publishing Sc QWAQWA BA: General 3 yrs f/t or 4 yrs p/t UM RAU BA.: General, Admission, Communication, 3 yrs UM: Communication option: Eng 1st Language HG 50% or Eng 2nd Language HG Development Studies, Humanities, Info Sc, 60% or Eng SG 60%. Law option: Eng + Afr HG 50% or SG 60% Languages, Law, Metropolitan & Regional Admin, Personnel Mgt, Political Studies, Theology RHODES BA: General 3 yrs UM STEL BA: General, Drama, Human Movement Sc, 3 yrs UM (50% ay): Law option: (UM 60% av) + 1st Language HG 60%. Industrial Psyc Industrial Psyc, Law subjs, Music, Theology option: Math SG 50% or HG 40%. Music option: Music HG 50% or SG 60%0R Grade 7 subjs, Values & Policy Studies Practical + Grade 6 Harmony OR an entrance exam. Values & Policy Studies option: (60% av) Afr or Eng 1st Language HG 60% + Math SG 50% TRANS BA: General 3 yrs f/t or 4 yrs p/t UM UCT BA: General 3 yrs UM: Eng HG 50% or SG 70% or both Eng + Math HG 40% or SG 60% plus 4 of the following subjs (HG or SG): African Languages, Afr, Arabic, Art, Biblical Studies, Biol, Drama, Econ, Eng, Drama, French, Geog, German, Greek, Hebrew, Hindi, History, Italian, Latin, Math, Music, Nederlands, Phys Sc, Portuguese, Spanish UDW BA: General 3 yrs UM UNISA BA: General 3 yrs UM UNISA Dip in Development Studies 2 yrs M + 5 subjs on SG or HG UPE BA: General, BA for Theology Students, 3 yrs f/t or 4 yrs p/t UM Music VENDA BA: General, Music, Religious Studies, 3 yrs UM: Eng HG 40% or SG 50%. Music option: Grade 5 Theory from UNISA; ABRSM or Theology TCL or the Cert in Music from the University of Venda + pass an aptitude test for competence in Music VISTA BA: General 3 yrs UM WCAPE BA: General 3 yrs f/t or p/t UM WITS BA.: General 3 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + 2 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys Sc, Physiol, Speech & Drama ZULU BA: General 3yrs UM (4096 av)
Information Systems Information Systems
RHODES B.Sc.(Info Systems) 3 yrs UM: Math HG 40% or a pass in the Science Foundation Programme UNISA Dip In Datametrics Not more than 5 yrs UM: Math HG 406 or SG 5036
Journalism / Communication Journalism / Communication
FORT B.Soc.Sc.(Communication) 3 yrs UM NWEST BA(Communication) 3 yrs UM OFS BA(Communication) 3 yrs UM RHODES 13Joum. 4 yrs UM ZULU BA(Communication) 3 yrs UM (40% av)
Land Surveying Land Surveying
DURBAN B.Sc.(Land Surveying) 4 yrs UM: Math + Phys Sc HG 6096 UCT B.Sc.(Surveying) 4 yrs UM: Math + Phys Sc HG 5096, Eng 1st Language HG 50% or 2nd Language HG 60%
67 Universities 55 Univ Course :Duration Entry Requirements Landscape Architecture Landscape Architecture
PTA B.Landscape Architecture 4 yrs UM: Math + Fhys Sc HG 40% or SG 5096
Law Law
DURBAN B.Proc. 4 yrs f/t or 5 yrs p/t Full or mature age conditional matriculation exemption DURBAN Dip in Paralegal Studies 2 yrs Candidates with UM who have been selected from rural communities by the Community Law Centre or other organisations FORT B.Juris 3 yrs UM FORT B.Proc. 4 yrs UM NORTH B.luris 3 yrs UM NORTH B.Proc 4 yrs UM NWEST B.Crim Justice 6 sems UM NWEST Bjuris 6 sems UM NWEST B.Proc. 8 sems f/t UM OFS B.luris 3 yrs UM OFS B.Proc. 4 yrs UM PMB B.luris 8 sems p/t Full or mature age conditional matriculation exemption PMB B.Proc. 4 yrs f/t or 5 yrs p/t Full or mature age conditional matriculation exemption POTCH Bjuris 3 yrs UM POTCH B.Proc. 4 yrs UM PTA B.luris 3 yrs UM PTA B.Proc. 4 yrs f/t or p/t UM PTA BLC 3 yrs f/t or p/t UM RAU B.Proc. 4 yrs UM: Mr 1st Language ± Eng 2nd Language HG 50% or Eng 1st Language HG 50% 4.- Afr 2nd Language HG 60% TRANS Bjuris 3 yrs UM: Eng HG 40% or SG 50% TRANS B.Proc. 4 yrs UM: Eng HG 40% or SG 50% UDW BA(Law) 3 yrs UM UDW B.luris 3 yrs UM UDW B.Proc. 4 yrs UM UNISA Advanced Labour Law Programme 9 mths M + a course in labour law offered by a tertiary institution or participation in suitable training courses + experience in the application of labour law principles UNISA B.luris 3 yrs UM UNISA B.Proc. 4 yrs UM UNISA Cert Course in Practical Labour Law 6 mths (practical training No formal qualifications, but a high level of language proficiency is essential induded) UNISA Cert Programme in Women and the LaW 11 mths (workshop M included) UNISA Cert Programme in Law 1 yr M UNISA Dip furls 3 yrs M with 5 subjs on HG or SG UPE I3juris 3 yrs UM UPE B.Proc. 4 yrs UM VENDA BA.(Criminal justice) 3 yrs -UM (60% av): Enq 50% VENDA BA.(Law) 3 yrs UM (60% av): Eng 50% VENDA B.luris 3 yrs UM (60% av): Eng 50% VENDA B.Proc. 4 yrs UM (60% ay): Eng 50% VISTA B.luris 3 yrs UM VISTA B.Proc. 4 yrs UM WCAPE BA(Law) 3 yrs UM WCAPE B.luris 3 yrs UM WCAPE B.Proc. 4 yrs UM ZULU Bjuris 3 yrs UM (40% av) ZULU B.Proc. 4 yrs UM (40% av)
Library & Information Science Library & Information Science
FORT B.Bibl. 4 yrs UM NORTH B.Information Studies 4 yrs UM POTCH B.Bibl. 4 yrs UM PTA B.Bibl. 4 yrs f/t or p/t UM RAU &inf. 4 yrs UM STEL B.Bibl. 4 yrs UM (50% av) TRANS B.Information 4 yrs f/t or 5 yrs p/t UM
66 56 Universities Univ Course Duration Entry Requirements Library & Information Science Library & Information Science
UNISA B.Bibl. 4 yrs UM WCAPE B.Bibl. 4 yrs UM WCAPE Lower Dip in Library & Info Science 3 yrs M: 2 Languages + 1 other subj on HG ZULU B.Bibl. 4 yrs UM (40% av)
Medical Sciences Medical Sciences
DURBAN B.Medical Sciences 3 yrs UM: Math, Phys Sc, Biol + Eng HG (Math SG may be considered) NORTH B.Sc.(Medical Sciences) 4 yrs UM with a rating of 30 points on the selection scale. Math HG (F) or SG 40% PTA B.Sc.(Medical Sciences) 3 yrs UM: Math, Phys Sc + 2 languages HG 50% STEL B.Medical Sciences 4 yrs Only selected 3rd-yr M.B., Ch.B. students UDW B.Medical Sciences 4 yrs UM: Math + Biol or Phys Sc HG or 50%SG
Medicine Medicine
DURBAN M.B., Ch.B. 6 yrs UM with Math HG or SG. A pass in Phys Sc and Eng HG will strengthen the application MEDUNSA M.B., Ch.B. 6 yrs UM: Math + Phys Sc (preferably HG) OFS M.B., Ch.B. 6 yrs UM: Math SG PTA M.B., Ch.B. 6 yrs UM: Math, Phys Sc + 2 languages HG 50% STEL M.B., Ch.B. 6 yrs UM: Math HG 5096 or SG 60% TRANS M.B., Ch.B. 6 yrs UM (60% av) and younger than 35 yrs of age: Eng, Math, Phys Sc + Biol HG 50% or SG 60% UCT B.Sc.(Med) 1 yr The completion of at least the 2nd yr or the M.B., Ch.B. curriculum UCT M.B., Ch.B. 6 yrs UM: Math + Phys Sc HG 40% or SG 50% + Eng WITS M.B., Ch.B. 6 yrs UM + proficiency in Eng Language: Math HG or 60%5G + 1 of the following subjs (HG or 60%SC): Biol, Phys Sc or Physiol
Meteorology Meteorology
PTA B.Sc.(Meteorology) 4 yrs UM: Math + Phys Sc HG 60%
Music Music
DURBAN B.Mus.: Composition, Ethnomusicology, 4 yrs UM Jazz Studies, Music Education, Music Tech, Musicology, Orchestral Performance, Performance DURBAN Univ Dip in Music Performance: General, 3 yrs M or on the basis of evidence that the candidate posesses the abilities necessary for Jazz, Western Classical Music the completion of the Diploma: Western Classical Music option: Music Grade 7 OFS B.A.(Mus.): General, Jazz 3 yrs UM: Music HG 50% or SG 60% or Grade 7 (UNISA) or equivalent OFS B.Mus.: General, Jazz 4 yrs UM: Music HG 50% or SG 60% or Grade 7 (UNISA) or equivalent OFS Church Organ Dip 2 yrs (1 yr for graduated UM with Music HG 50% or SG 60% or Grade 7 (UNISA) or equivalent OR an candidates) appropriate degree POTCH B.Mus. 4 yrs UM: Matric Music HG or SG 60% or Grade 7 in I instrument + Grade 5 Theory (UNISA) POTCH Univ Dip in Music 3 yrs UM + music potential PTA B.Mus. 4 yrs UM: Music HG 50% or SG 60% or Grade 7 Practical + Grade 5 Theory (UNISA) RHODES B.Mus. 4 yrs UM: Music or music skills and knowledge at Matric level RHODES Cert in Change Ringing 2 yrs M or suitability to take the course plus a high level of practical ability RHODES Licentiate Dip in Music: Performers of an 3 yrs M or suitability to take the course plus a high level of practical ability Instrument or Singing, Teachers of School Music, Teachers of an Instrument or Singing STEL B.Mus.: Composition, Music Sc, Practical 4 yrs UM (50% av): Music HG 50% or SG 60% or Grade 7 Practical + Grade 6 Harmony (UNISA) or an admission exam STEL Licentiate in Music Performance 3 yrs M (50% av): Music HG 50% or SG 60% or Grade 7 Practical or Grade 6 Harmony (UNISA) or an entrance exam TRANS Univ Licentiate in Music Education 3 yrs M (5G 40% av). Grade 5 Music Theory Certificate from a recognised Music Institution
6"9 Universities 57 Univ Course Duration Entry Requirements
Music Music
UCT B.Mus.: General, Dance, Education, Jazz 4 yrs UM: Music HG 60% or SG 70% or Grade 5 Theory + Grade 7 Practical (UNISA) or a Studies, Library & Info Sc, Musicology, successful practical audition + theory exam (Admission Board) Orchestral Studies, Practical UCT Performers Cert in Music 2 yrs Std 9 plus Grade 5 Theory + Grade 7 Practical exam (UNISA) or a successful practical audition and theory (Admission Board) UCT Performers Cert in Opera 2 yrs Std 9 plus Grade 5 Theory ± Grade 7 Practical exam (UNISA) or a successful practical audition and theory (Admission Board) UCT Performers Dip in Music: Solo & 3 yrs M: Music HG 50% or SG 60% or Grade 5 Theory + Grade 7 Practical (UN5A) or a Accompanying, Jazz Studies, Orchestral successful audition + theory exam (Admission Board) Studies UCT Performers Dip in Opera 4 yrs M: Music HG 50% or SG 60% or Grade 5 Theory + Grade 7 Practical (UNISA) or a successful audition + theory exam (Admission Board) UCT Teachers Licentiate Dip in Music & Jazz 4 yrs M: Music HG 50% or SG 60% or Grade 5 Theory + Grade 7 Practical (UNISA) or a Studies successful audition + theory exam (Admission Board) UDW B.Mus. 4 yrs UM with Matric Music 60% or Grade 7 Practical ( UNISA) + a comparable theoretical standard. Audition UNISA B.Mus. 4 yrs UM: A sound knowledge of the rudiments of musk, equivalent to Grade 3 Theory ( UNISA). Harmony + Counterpoint option: Matric Music or Grade 5 in a keyboard instrument. An entrance examination is available for students who doriot meet the requirements above UPE B.Mus.: Music Education, Musicology, 4 yrs UM: Music SG 60% or HG 50% or Grade 7 Practical + Grade 5 Theory Performers (Music) UPE Dip in Music Education 3 yrs M + adequate music potential VENDA Cert in Music 1 yr f/t or p/t UM: Eng HG 40% or SG 50% + pass an aptitude test for competence in Music WCAPE BA(Mus.) 3 or 4 yrs UM + an entrance examination. Grade S Theory + Grade 6 Practical' WCAPE Dip in Music Teaching 3 or 4 yrs M + an entrance examination. 2 Languages + I other subj on HG. Grade 5 Theory + Grade 6 Practical (UNISA) WITS B.Mus.: Composition, Musicology 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd language HG 40% + 2 of the following subjs (HG): A language, An Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Musk, Phys Sc, Physiol, Speech & Drama ZULU B.A.(Music) 3 yrs UM (40% av) + interest and aptitude in Music ZULU B.Mus.: Academic, Education, Performance4 yrs UM (40% av) with Matric Music or Music Grade 5 (UNISA) or equivalent
Natural Sciences Natural Sciences
DURBAN B.Sc.: General 3 yrs f/t or 4 yrs p/t UM: Math + Phys Sc or Biol HG 40% FORT B.Sc.: General 3 yrs UM. Certain courses will require Matric Math or Math HG 40% or SG 50% MEDUNSA B.Sc.: General 3 yrs UM: Math HG + Phys Sc or Biol HG NORTH B.Sc.: Biological Scs, Geog, Mathematical 3 yrs UM with a rating of 30 points on the selection scale. Math HG (F) or SG 40%. Scs, Physical Scs, Psyc Alternatively successful completion of the Unify Programme, the Foundation Year in Math and Science will also be acceptable NWEST B.Sc.: General 6 sems UM or a 3 year Dip in Education + 2 yrs teaching experience: Math HG or 50%SG + 1 of the following subjs at HG: Biol, Geog or Phys Sc OFS B.Sc.: Biological Scs, Chemical-Physical Scs,3 yrs UM with Math SG + Phys Sc SG 40% or Blot HG 5096 or SG 6016. Mathematical Scs Earth Scs, Mathematical Scs option: Math HG 50% or SG 60%. Phys Sc is strongly recommended PMB B.Sc.: General 3 yrs f/t or 4 yrs p/t UM with Math and a natural science subj HG 40% or SG 60% POTCH B.Sc.: General, Biological Scs, Earth Scs, Econ 3 yrs UM: Math HG or a natural science subj (preferably Phys Sc) HG .+ Math SG subjs, Engineering subjs, Human Movement Sc, Material Sc, Mathematical, Physical & Chemical Scs, Psychology PTA B.Sc.: Chemical Scs, Earth Scs, 3 yrs UM: Math + Phys Sc HG 50%. Mathematical Scs + Info Tech options: Math HG 50% Environmental Scs, Geo-Info Scs, Info Tech, Mathematical Scs, Phys Scs QWACtWA B.Sc.: General 3 yrs UM: Math HG (F) or SG 40% RAU B.Sc.: Actuarial Scs, Biological Scs, Earth Scs, 3 yrs UM: Math HG 50%. Actuarial Scs option: Math HG 70%. Financial Orientation option: Financial Orientation, Info Tech, Math HG 50% + Acc HG 60% Mathematical Scs, Physical Scs RHODES B.Sc.: General 3 yrs UM: Math HG 40%+ Phys Sc or Biol SG 40% Sin B.Sc.: General, Actuarial Scs, Biological Scs, 3 yrs UM (50% av): Biological + Sport Sc options: Math + Phys Sc with one thereof on HG Engineering subjs, Human Movement Sc, (Math SG at least 40%) OR Math + a natural science subj (e.g. Biol or Phys Sc) HG or Mathematical Scs, Physical Scs, Sport Sc 60% SG. Actuarial, Mathematical, Physical and Human Movement Sc options: Math + subjs Phys Sc with one thereof on HG (Math HG 50% or SG 70%) OR Math HG 50% or SG 70% + a natural science subj (e.g. Biol or Phys Sc) HG or 60%5G. Engineering option: Math + Phys Sc HG 50% TRANS B.Sc.: General 3 yrs UM: Math HG 4096 or SG 50% UCT_ B.Sc.: Chemical Scs, Earth Scs, Life Scs, 3 yrs UM + a pass in Eng: Math HG 40% or SG 70%+ Phys Sc or Biol or Physiol HG 40% or Mathematical Scs, Physical Scs SG 50%. Physics or Chem option: Phys Sc HG 50%
7 58 Universities Univ Course Duration Entry Requirements Natural Sciences Natural Sciences
UDW B.Sc: General 3 yrs UM: Math + Biol or Phys Sc or Physiol HG or 50)6SG UNISA B.Sc.: General 3 yrs UM: Math HG 4096 or SG 5096 UPE B.Sc.: General 3 yrs UM: Math SG VENDA B.Sc.: General 3 yrs UM: Eng, Math + Phys Sc HG 40% or SG 50% VISTA BSc: General 3 yrs UM: Math HG 4096 or SG 5036 WCAPE B.Sc.: General 3 yrs UM: Math + Biol or Phys Sc HG 4096 or SC 5096 WITS B.Sc: General 3 yrs UM + proficiency in Eng Language: Math HG or 60% SG ZULU B.Industrial Science 3 yrs UM (40% av) with Math HG 40% + Phys Sc HG or 40% SG ZULU B.Sc.: General 3 yrs UM (4096 av): Math HG 40% or SG SOX
Nursing Nursing
DURBAN B.Cur. 4 yrs UM FORT B.Cur. 4 yrs UM -:: :- :, .% I' MEDUNSA B.Cur. 4 yrs UM: Math + Phys Sc (preferably HG)
NORTH B.Cur. . -4rs . UM with a rating of 30 Points on the selection scale:PhYsIc and/Or Blot NWEST B.Nursing Science 9 sems f/t UM
OFS B.SocSc.(Nursing) 4 yrs UM . -_ POTCH B.Cur. 4 yrs UM: Preference to students with Math, Phys Sc or Biol PTA B.Cur. 4 yrs ...,. RAU B.Cur. 4 yrs UM STEL B.Cur. 4 yrs UM' UCT B.Nursing 4 yrs UM (HG pass or SG 50% av), cent of physical fitness + 17 yrs of age: Eng or Afr or Math HG 6036. Math + Phys Sc or Biol or Physiol HG 40% or SG 50% UPE B.Cur. 4 yrs UM. Candidate must submit proof of holding a post as a student nurse at a health authority approved by the SA Nursing Coundl ,,---T-T-ct--,- - WCAPE B.Cur. 4 yrs UM
WITS B.Nursing 4 yrs UM + profldency in Eng Language: Math HG or SOX SG -1;.-...,+f-:-.- . ZULU B.Cur. 4 yrs UM (40% av) + proficiency in Zulu. Preference to students with Math and/or Phys Sc
Occupational Therapy Occupational Therapy
MEDUNSA B.Occupational Therapy 4 yrs UM: Math + Phys Sc (preferably HG) OFS B.Occupational Therapy 4 yrs UM: Math or Phys Sc or Biol SG PTA B.Occupational Therapy 4 is UM (60% av) with Phys Sc + Biol HG 60% STEL B.Occupational Therapy 4 yrs UM (60% av): Math HG 40% or SG 50% UCT BSc.(Occupadonai Therapy) 4 yrs UM: Math.+ Phys -Sc HG 40% or SG 5096 UDW B.Occupational Therapy 4 yrs UM: Math or a science subj HG or 50% 5G WCAPE B.Sc(Occupational Therapy) '4 Yri- ' WITS B.Sc.(Occupational Therapy) 4 yrs UM + proficiency in Eng Language: Math HG or 50%5G
Optometry Optometry
NORTH_ _ B.Optometry. 4 yrs UM with a rating of 30 points on the selection scale. Math HO-M.0r SG 4096 RAU B.Optometry 4 yrs UM: Math + Phys Sc HG 60% + Biol HG UDW B.Optometry 4 yrs UM with Math + Blot or Phys Sc HG or 50% SG
Personnel Leadership - see also Personnel Leadership - see also Commerce, Finance & Economics Commerce, Finance & Economics
OFS B.Personnel Leadership 3 yrs UM
Universities 59- Univ , Course Duration Entry Requirements Pharmacy Pharmacy
NORTH B.Pharm. 4 yrs UM with a rating of 30 points on the selection scale. Math HG (F) or SG 40%+ Biol + Phys Sc HG 4096or SG 50% POTCH B.Pharm. 4 yrs UM: Math + Phys Sc HG 50% or SG 60%. Biology is strongly recommended RHODES B.Phann. 4 yrs UM: Math HG 50% + Phys Sc or Biol HG 50% or SG 70% UDW B.Pharm. 4 yrs + 1 yr internship UM with Math + Biol or Phys Sc HG or 50%5G UPE B.Pharm. 4 yrs UM: Math HG or 50% 5G + Phys Sc HG or SG + 1 other subj (preferably Blot) WCAPE B.Pharm. 4 yrs UM: Math + Biol or Phys Sc HG 40% or SG 50% WITS B.Pharm. 4 yrs UM + proficiency in Eng Language: Math HG or 60%SG + 1 of the following subjs HG or 60% SG: Biol, Phys Sc or Physiol
Physiotherapy Physiotherapy
MEDUNSA B.Sc.(Physiotherapy) 4 yrs UM: Math + Phys Sc (preferably HG) OFS B.Sc.(Physiotherapy) 4 yrs UM: Math SG PTA B.Physiotherapy 4 yrs UM: Math + Phys Sc HG 60% STEL BSc.(Physiotherapy) 4 yrs UM: Math HG 50% or SG 60% UCT B.Sc.(Physiotherapy) 4 yrs UM + a cert of physical fitness: Math + Phys Sc HG 40% or SG 50% + a pass in Eng UDW B.Physiotherapy 4 yrs UM with Math + Biol or Phys Sc HG or 50%5G WCAPE B.Sc.(Physiotherapy) 4 yrs UM: Math + Phys Sc or Biol HG 40% or SG 50% WITS B.Sc.(Physiotherapy) 4 yrs UM + proficiency in Eng Language: Math HG or 50%SG
Police & Military Science Police & Military Science
STEL; SAWB.Mil.: Human Scs, Mgt Scs, Natural Scs 3 yrs UM (50% av): Mgt Sc option: Math SG 40%. Natural Sc option: Math HG 50% or SG 70% + Phys Sc HG or 50%SG UNISA BA(Police Science) 3 yrs UM UNISA Cert Programme in Advanced Security Mgt1 yr The Cert Programme in Security Mgt UNISA Cert Programme in Forensic Criminalistics 2 yrs M UNISA Cert Programme in Security Mgt 1 yr M
Quantity Surveying Quantity Surveying
DURBAN B.Sc.(Quantity Surveying) 4 yrs UM: Math HG 4096 or SG 70% OFS B.Sc.(Quantity Surveying) 4 yrs UM: Math HG or 50%SG + a pass in 1 of the following subjs: Phys Sc, Econ, Business Econ or Acc PTA BSc.(Quantity Surveying) 5 yrs UM: Math + Phys Sc HG 40% or SG 50% UCT B.Sc.(Quantity Surveying) 4 yrs UM: Eng 1st Language HG 40% or 2nd Language HG 60% + Math HG 40% or SG 60% UPE B.Sc(QuantitY Surveying): Quantity 4 yrs UM with Math HG 40% or SG 50% + special entrance exam Surveying with Financial Mgt & Business Mgt, Quantity Surveying with Computer Sc WITS B.Sc.(Quantity Surveying) 4 yrs UM + proficiency in Eng Language: Math HG or 60%SG + 1 of the following subjs (HG or 60% SG): Biol, Geog, Phys Sc or Physiol
Radiography Radiography
MEDUNSA B.Rad.(Diagnostic) 3 yrs UM + 18 yrs old: Math + Phys Sc HG (preferably HG) PTA B.Rad. 3 yrs UM: Math Phys Sc HG 50%
Rural Resource Management Rural Resource Management
PMB Univ Dip in Rural Resource Mgt 3 yrs UM + a reasonable proficiency in Eng
72 60 Universities Univ Course Duration Entry Requirements Social Sciences - see also Human Social Sciences - see also Human Sciences Sciences
DURBAN B.Soc.Sc. 3 yrs f/t or 4 yrs p/t UM FORT B.Soc.Sc 3 yrs UM NWEST B.Soc.Sc. 6 sems UM OFS B.Soc.Sc. 3 yrs UM PMB B.Soc.Sc. 3 yrs f/t or 4 yrs p/t UM RHODES B.Soc.Sc. 3 yrs UM UCT B.Soc.Sc.: General, Human Resource Mgt, 3 yrs UM: Eng or Math HG 50% or SG 70% OR both Eng + Math HG 40% or SG 60% plus 4 Government Admin of the following subjs HG or SG: African Languages, Afr, Arabic, Art, Biblical Studies, Biol, Drama, Econ, Eng, French, Geog, German, Greek, Hebrew, Hindi, History, Italian, Latin, Math, Music, Nederlands, Phys Sc, Portuguese, Spanish. Human Resources Mgt (Standard Curriculum) option: Math SG 50%
Social Work Social Work
DURBAN BSoc.Sc(Social Work) 4 yrs UM FORT B.Soc.Sc.(Social Work) 4 yrs UM NORTH BA(Social Work) 4 yrs UM NWEST B.Soc.Sc.(Social Work) 8 sems fit UM OFS B.Soc-Sc(SociaJ Work) 4 yrs UM POTCH BA(Social Work) 4 yrs UM (60% av) PTA BA(Sodal Work) 4 yrs f/t or 5 yrs p/t UM RAU B.A.(Soc.Sc.) (Social Work) 4 yrs UM RHODES B.SocSc.(Social Work) 4 yrs UM STEL B.A.(Social Work) 4 yrs UM (5096 av) TRANS BA(Social Work) 4 yrs UM UCT B.Soc.Sc.(Social Work) 4 yrs UM UDW BA(Social Work) 4 yrs UM UNISA B.A.(Soc.Sc.) (Social Work) 4 yrs UM + ability to attend workshops during the year UNISA Cert in Child & Youth Care 2 yrs (practical work M included) UNISA: HUG B.Diac.(Social Work) (Hugenote Kollege 4 yrs UM students) UNISA; HUG Univ Dip in Christian Service (Social Work) 4 yrs M with 5 subjs on SG or HG (Hugenote Kollege students) UPE B.A.(Social Work) 4 yrs UM VENDA BA(Social Work) 4 yrs UM (50% av): Eng HG 40)6or SG 50% + pass an entrance test WCAPE BA(Social Work) 4 yrs UM WCAPE Dip in Social Work 4 yrs M: 2 Languages + 1 other subj on HG WITS BA(Social Work) 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + 2 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Math, Music, Phys Sc, Physiol, Speech & Drama ZULU BA(Social Work) 4 yrs UM (40% av)
Speech Therapy Speech Therapy
PTA B.Communication Pathology 4 yrs UM STEL BSpeedi Therapy & Audiology 4 yrs UM (50%av): Math SG UCT B.Sc.(Log.) 4 yrs UM + a cert of physical fitness: Math + Phys Sc or Biol or Physiol HG 40% or SG 50% + a pass in Eng UDW B.Speech & Hearing Therapy 4 yrs UM with Math or a science subj HG or 50%SG WITS BA.Speech & Hearing Therapy 4 yrs UM + proficiency in Eng Language: Eng 1st Language HG or Eng 2nd Language HG 40% + Math HG or 50%SG + 1 of the following subjs (HG): A Language, Art, Biblical Studies, Biol, Drama, Econ, Geog, History, Music, Phys Sc, Physiol, Speech & Drama
Theology Theology
FORT B.Theology 4 yrs UM FORT Dip in Theology 3 yrs NORTH B.Theology 3 yrs UM
Universities 61 Univ :Course D'uration Entry Requirements Theology Theology
PMB B.Theology 3 yrs UM POTCH BA(Theology) 3 yrs UM PTA B.A.(Theology) 3 yrs UM RHODES B.Theology 3 yrs UM RHODES Dip in Theology 3 yrs Mature non-matriculants STEL B.Theology 4 yrs UM (50% av) UCT B.Theology 4 yrs UM UDW B.A.(Theology) 3 yrs UM UDW B.Theology 4 yrs UM UDW Cert in Theological Studies 3 yrs Students have to satisfy the faculty as to their competence for this programme of study UNISA B.Theology 3 yrs UM UNISA Dip in Theology 2 yrs M + 5 subjs at HG or SG UNISA: HUG B.Diac. (Hugenote Kollege students): 3 yrs UM Mission, Youth Work UNISA; HUG Univ Dip in Christian Service (Hugenote 3 yrs M + 5 subjs at SG or HG Kollege students) VENDA B.Theology 3 yrs UM: Eng HG 40% or SG 50% VENDA Cert in Christian Ministry 1 yr M VENDA Cert in Religious Studies 1 yr M WCAPE BA(with Theological subjs) 3 yrs UM WCAPE B.Theology 4 yrs UM WCAPE Dip in Theology 4 yrs M with at least 3 subjs on HG ZULU B.Theology 4 yrs UM (40% av) ZULU B.Theology (Arts) 3 yrs UM (40% av)
Town & Regional Planning Town & Regional Planning
POTCH B.Art. et Scien.(Planning) 4 yrs UM: Math HG or 60% SG PTA B.Town & Regional Planning 4 yrs UM: Math + Phys Sc HG 40% or SG 50% WITS B.Sc.(Town & Regional Planning) 4 yrs UM + proficiency in Eng Language: Math HG or 60%SC
Veterinary Science Veterinary Science
MEDUNSA B.V.M.,Ch. 6 yrs UM: Math + Phys Sc (preferably HG) PTA B.V.Sc. 6 yrs UM with Math + Phys Sc HG 50% PTA Univ Dip: Veterinary Nursing 2 yrs UM: Math + Phys Sc or Biol HG 40% or SG 50%
7 4 62 Universities Conflict Management, 52 Human Physiology, 46 Multi-cultural Sensitivity, 49. Index According Construction Management, 46, 47 Human Resources, 49 Municipal Administration, 45 Cost & Management Accounting, 49 Human Resources Management, 45, Municipal Finance, 47 to Field of Study Cost Accounting, 45 47, 48, 61 Music, 50, 51, 52, 55, 57, 58 A Counselling, 49 Human Sciences, 50, 51, 52, 53, Music Education, 52, 57, 58 Accounting, 45, 47, 48, 49 Criminal Justice, 56 54, 55, 60 Music Instrument, 57 Actuarial Sciences, 48, 58 Crop Production, 46 Humanities, 55 Music Teaching, 57, 58 Administration, 45, 47 Crop Science, 45, 46 Music Technology, 57 Adult Education, 50, 51, 52 D Industrial & Organisational Psychology, Musicology, 57, 58 Aeronautical Engineering, 53 Dance, 50, 58 47 N African Management, 48 Datametrics, 55 Industrial Arts, 51 Natural Sciences, 46, 49, 50, 51, Agricultural Administration, 45 Dental Therapy, 49 Industrial Engineering, 53 52, 53, 54, 58, 59, 60 Agricultural Economics, 45, 46, 47, Dentistry, 49 Industrial Psychology, 45, 47, 48, Nursing, 55, 59 48 Development Studies, 55 49, 55 Nutrition, 50 Agricultural Engineering, 53 Dietetics, 50 Industrial Science, 59 0 Agricultural Extension, 45, 46 Distance Education, 52 Industrial Sociology, 47, 49 Occupational Therapy, 59 Agricultural Management, 46 Drama, 50, 55 Informatics, 47, 48 Oenology, 46 Agricultural Production, 45, 46, 51 Drama & Theatrical Arts, 51 Information Design, 53 Opera, 58 Agriculture, 45, 46, 50, 51, 52, 53 Dramatic Art, 50 Information Science, 55 Optometry, 59 Agrometeorology, 46 E Information Studies, 50, 56 Oral Biology, 50 Agronomy, 46 Early Childhood Education, 52 Information Systems, 47, 48, 55 Oral Health, 49 Animal Health, 46 Earth Sciences, 58 Information Technology, 48, 58 Oral Hygiene, 49, 50 Animal Physiology, 46 Ecology, 46 Insurance, 47 Orchestral Studies, 57, 58 Animal Production, 45, 46 Econometrics, 47, 49 Interior Design, 54 Organisational Psychology, 48, 49 Animal Production Management, 46 Economic Environment, 48 Internal Auditing, 47 p Animal Science, 45, 46 Economic Sciences, 50, 51 International Business, 48 Painting, 53 Applied Graphics, 53 Economic Statistics, 49 International Relations, 45 Paralegal Studies, 56 Architecture, 46 Economics, 45, 47, 48, 49, 58 Investment, 48 Pasture Science, 45, 46 Art, 50, 51, 55 Education, 47, 49, 50, 51, 52, 53, J Personnel Administration, 45 Audiology, 61 54, 58 Jazz, 51, 57, 58 Personnel Leadership, 59 Auditing, 47 Electrical Engineering, 53 Jewellery & Metal Design, 53 Personnel Management, 45, 47, 55 Aviation Management, 45, 47 Electronic Engineering, 53 Journalism, 55 Personnel Psychology, 47 B Engineering, 53, 58 L Personnel Relations, 47 Ballet, 50 Entomology, 46 Labour Law, 56 Pharmacy, 60 Banking, 47 Entrepreneurship, 48 Labour Relations, 47, 48 Photographic Arts, 53 Behavioral & Environmental Sciences, Environmental Education, 52 Land Surveying, 55 Physical Education, 51 55 Environmental Sciences, 53, 58 Land Use Planning, 46 Physical Metallurgy, 53 Biochemistry, 46, 50 Estate Agency Management, 49 Landscape Architecture, 56 Physical Science, 51, 52, 54 Biological Sciences, 46, 58 Ethnomusicology, 57 Languages, 51, 54, 55 Physical Sciences, 58 Biometry, 46 F Law, 45, 47, 48, 49, 54, 55, 56 Physiotherapy, 60 Botany, 46 Facilitating, 49 Library & Information Science, 50, 51, Plant Breeding, 46 Building Science, 47 Finance, 47, 48 52, 56, 57, 58 Plant Pathology, 46 Business, 48 Financial Accounting, 47, 48 Life Sciences, 58 Plant Production, 46 Business Accounting, 47 Financial Management, 47, 48 Logistics Management, 48 Plant Production Management, 46 Business Administration, 47 Financial Management & Business Logopaedics, 61 Plant Protection, 46 Business Communication, 47, 48 Management, 60 M Police Science, 60 Business Computing, 48 Financial Orientation, 58 Management, 46, 47, 48, 60 Political Si Administrative Sciences, 54 Business Economics, 45, 47 Financial Planning, 48 Management & Administration Political Science, 55 Business Executive, 48 Financial Statement Analysis, 48 (freight), 48 Political Studies, 45 Business Finance, 47, 48 Fine Art, 50, 51, 52, 53, 54 Management Accounting, 47, 48 Population Genetics, 46 Business Information Systems, 47 Food, 54 Management Development, 48 Poultry Science, 46 Business Logistics, 47, 48 Food Management, 54 Marketing, 47, 48, 49 Primary Education, 50, 51, 52, 53 Business Management, 45, 47, 49 Food Processing, 46 Marketing & Advertising Management, Private Law, 47 Business Sciences, 48 Food Science, 46, 50 47 Project Management, 49 C Forensic Criminalistics, 60 Marketing Management, 47, 48 Psychology, 58 Career Guidance, 49 Forest Science (Harvesting), 54 Material Science, 58 Public Administration, 45, 49 Change Ringing, 57 Forest Science (Nature Conservation), Materials Engineering, 53 Public Affairs, 45 Chemical Engineering, 53 54 Mathematical Sciences, 58 Public Management, 45 Chemical Sciences, 58 Forestry, 54 Mathematics, 48, 52 Public Sector Human Resources Chemistry, 45, 50 G Meat Science, 46 Management, 45 Child & Youth Care, 61 Genetics, 46 Mechanical Engineering, 53 Public Sector Management & Christian Ministry, 62 Geography, 54, 58 Medical Sciences, 57 Administration, 45 Christian Service, 62 Geo-Information Sciences, 58 Medicine, 57 Publishing Science, 55 Church Organ, 57 Govemment Administration, 61 Metallurgical Engineering, 53 Purchasing, 47 Civil Engineering, 53 Purchasing Management, 48, 49 Graphic Arts, 53 Metallurgy, 53 Clothing, 54 Graphics, 51 Meteorology, 57 Q Clothing Management, 54 Grassland Science, 46 Metropolitan & Regional Quality Management, 49 Commerce, 47, 48, 49, 50, 51, 52, Quantitative Management, 48 I-1 Administration, 55 53 Microbiology, 46 Quantity Surveying, 60 Commercial Computer Science, 45, Health Education, 54 Home Economics, 50, 51, 53, 54 Military Science, 60 R 49 Mineral Economics, 48 Radiography, 60 Commercial Law, 47 Horticulture, 45, 46 Hospitality, 48 Minerals Processing, 53 Recreation Management, 47 Commercial Sciences, 51 Mining Engineering, 53 Regional Development, 49 Communication, 48, 55 Housing Science, 54 Mission, 62 Religious Studies, 55, 62 Communication Management, 47 Human Ecology, 52, 54 Mixed Farming Management, 46 Retail Management, 49 Communication Pathology, 61 Human Genetics, 46 Human Movement Science, 50, 51, Molecular Biology, 46 Risk Management, 48 Composition, 57, 58 Money & Banking, 47 Rural Development, 45, 46 Computer Science, 48, 49, 60 52, 53, 54, 55, 58
- 7 5 Universities 63 Rural Resource Management, 60 Soil Science, 45, 46 T Treasury Management, 45 S Speech & Drama, 50 Taxation, 47, 48 V School Guidance, 51 Speech & Hearing Therapy, 61 Teaching, 49 Values & Policy Studies, 55 School Music, 57 Speech Therapy, 61 Technika, 50 Veterinary Nursing, 62 Science, 50 Sport & Recreation Management, 47, Technology, 51 Veterinary Science, 62 Sculpture, 53 49 Theology, 54, 55, 61, 62 Viticulture, 46 Secondary Education, 51 Sport Management, 48 Tourism, 48 Sport Science, 58 Security Management, 60 Tourism Management, 47 Westem Classical Music, 57 State Finance, 47 Singing, 57, 58 Town & Regional Planning, 62 Wildlife Science, 46 Statistics, 47, 48 Small Business Management, 48 Trade Unions, 48 Wood Science, 54 Social Sciences, 45, 48, 49, 50, 54, Student Development, 52 Training, 52 Y 61 Surveying, 55 Transport, 49 Youth Work, 62 Social Work, 61 Systems Management, 47 Transport Economics, 48 Socio-Economics, 54 Travel, 48 Zoology, 46
-:1 64 Universities Introduction
Technikons are training institutions that aim to provide career-oriented education.They therefore strive to attain a balance between theory and application of theory in real-work situations. To achieve this aim, students have to spend some of their training time gaining theoretical knowledge at the technikon and some time at an approved place of work, learning the practical aspects of the job. Students need to have at least a Senior Certificate (Std 10/Grade 12) or equivalent to be admitted to a technikon. A university entrance certificate is not essential. Technikons offer a wide range of courses that lead to a certificate, diploma, higher diploma as well as Bachelor's, Master's and Doctoral Degrees in technology in selected fields of study. Fields of study include inter alia commerce/management, engineering, mining, art and design, communication technology, science and hotel management.
HIERARCHY OF TECHNIKON,QUALIFICATIONS.
6 yrs D.Tech. Degree 5 yrs M.Tech. Degree 4 yrsNational Higher Diploma or B.Tech. Degree 3 vrs National Diploma 2 vrs National Higher Certificate 1 yr National Certificate
How to: use this section
Course information is listed in alphabetical order by field of study. Use the index of fields of study at the end of this section to trace the field of study in which you are interested. The index will refer you to a page number. Students who wish to pursue a B.Tech. Degree programme or who want to obtain a National Higher Diploma first have to register for a National Diploma.They may advance to undergraduate or higher diploma studies after completion of the National Diploma. The table on pages 6769 shows the fields of study in which B.Tech. Degrees or National Higher Diplomas are offered. In addition to the instructional programmes listed in this section, technikons also offer a variety of short courses. Prospective students are advised to make further enquiries at the technikon of their choice.
Apply for admission to the course in good time. Don't wait for your matric results! The application form must be obtained, completed and submitted before a particular closing date.Enrolment dates are determined annually.
Technikons 7 7 65 77.77-7477- Y-70-ABEKIEVEATI,Olkit.
Institution Names General Terms BORDER Border Technikon Acc Accounting CAPE Cape Technikon Admin Administration ECAPE Eastern Cape Technikon Afr Afrikaans FSTATE Free State Technikon Agric Agricultural/Agriculture MANGOS Mangosuthu Technikon av average NATAL Technikon Natal Biol Biology NTV Technikon Northern Transvaal Cert Certificate N WEST Technikon North West Chem Chemistry PE Port Elizabeth Technikon Dept Department PENIN Peninsula Technikon Dip Diploma PTA Technikon Pretoria Econ Economics SA Technikon South Africa Eng English SAASVELD Saasveld Faculty of Forestry (PE excl excluded Technikon) f/t full time SETLO Setlogelo Technikon Geog Geography SULTAN M.L. Sultan Technikon HG higher grade VAAL Technikon Vaal Triangle Info Information WITS Technikon Witwatersrand LG lower grade M Matric Math Mathematics max maximum Mgt Management min minimum mths months NCert National Certificate NDip National Diploma NHCert National Higher Certificate p/t part time Physiol Physiology Phys Sc Physical Science Sc Science Secr Secretarial SG standard grade subj subject subjs subjects Tech Technology UM University Matric yr year yrs years
73 66 Technikons 4rHigher,Di lams
Key to abbreviations: BOR = Border; CPE = Cape; MAN = Mangosuthu; MLS= M.L. Sultan; NAT = Natal: NTV = Northern Transvaal: TFS = Free State; PEN = Peninsula; PE= Port Elizabeth; PTA = Pretoria; TSA = SA (teletuition); NW = North West; EC = Eastern Cape; VT= Vaal Triangle; TWR = Witwatersrand
B. Tech. Degree National Higher Diploma
FIELD OF STUDY BORCPEMANMLSNATNTVTFSPENPEPTATSANWECVTTWR Accounting . Agriculture Agric: Agricultural Extention Agric: Agricultural Management Agric: Agricultural Research Agric: Animal Production Agric: Crop Production Mgt Agric: Pig Production Mgt Agric: Poultry Production Mgt Analytical Chemistry Architectural Technology Archival Science Banking Beauty Technology/Somatology Biomedical Technology Biotechnology Building Business Administration Business Communication Cartography Ceramic Design * Ceramics Technology Chemistry Chiropractice Clinical Technology Clothing & Textiles Clothing Design Clothing Management Coal Mining Commercial Administration Company Administration Computer Systems Construction Management Consumer Guidance * Corporate Administration Correctional Services Management Cost & Management Accounting Credit Management Dance Dental Technology .
7 3 Technikons 67 echoDegrees- and-Natiii her Dipiomai
FIELD OF STUDY BORCPEMANMLSNATNTVTFSPENPEPTATSANWECVTTWR Drama Economic Geology Economic Management Analysis Education: Adult Basic Education Education: Art Education: Commerce Education: Economic Sciences Education: Home Economics Education: Natural Sciences Education: Management Education: Post School Education: Secondary 0 Education: Technical Engineering: Electrical Engineering: Chemical Engineering: Civil Engineering: Industrial Engineering: Mechanical Engineering: Metallurgy Environmental Health Environmental Management Exploration & Mining Geology Extraction Metallurgy Fashion Fashion Design Technology Financial Info Systems. Fine Art Fire Service Technology Food & Nutrition Food Technology Food Service Management Forestry Geotechnology Graphic Design i Homoeopathy Horticulture Hospitality Management Hotel Management Human Resources Management Industrial Design Information Technology Interior Design Internal Auditing International Communication Jewellery Design & Manufacture Journalism Landscape Technology Language Practice Library & Info Practice Library & Info Studies
68 Technikons FIELD OF STUDY BORCPEMANMLSNATNTVTFSPENPEPTATSANWECVTTWR Management Management Services Maritime Studies Marketine Medical Technology Metalliferous Minine Metallurgical Mining Microbiology Mineral Resource Management Nature Conservation Non-destructive Testing Nursing: Community Nursing: Occupational Health Oceanography Office Administration Open Space & Recreation Mgt Optometry Organisation & Work Study Performing Arts Technology Photography Podiatry Policing Production Management Public Management Public Relations Pulp & Paper Technology Purchasing Management Quality Assurance Quantity Surveying Radiography Real Estate Retail Business Management Safety Management Small Business Management Sport Admin & Marketing Sport & Excercise Technology Surveying Taxation Textile Design Textile Technology Total Quality Management Tourism Management Town & Regional Planning Transportation Management Transport Economics Travel & Tourism Veterinary Technology Water Care Wood Production Engineering
Si. Technikons 69 Tech Course Duration Entry Requirements Accounting Accounting
ECAPE NDip Accounting 3 yrs M NATAL NDip Accounting 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SC 50% or Eng 2nd Language HG 60% or SG 70% + Math HG 40% or SG 50% or Acc HG 50% or SG 60% NTV NDip Accounting 3 yrs M (40% av): Eng + Acc HG 40% or SG 50% NWEST NDip Accounting 3 yrs f/t or p/t M (4096 av): Acc + Math HG 40% or SG 50%. 2 official Languages of which 1 must be Eng PENIN NDip Accounting 3 yrs M with Math + Acc SG 50% or HG 40%. Proficiency in languages + good analytical skills PTA NDip Accounting 3 yrs f/t or p/t M: Math or Acc HG 50% or SG 60% SA Cert Accounting for Attorneys 1 yr SA NDip Accounting 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NDip Accounting 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages included): Eng 1st or 2nd Language + Math HG 40% or SG 5096. Acc is an added recommendation WITS NDip Accounting 3 yrs f/t or p/t M: Acc or Math HG 40% or SG 60%
Agriculture Agriculture
CAPE NDip Agric 3 yrs M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr CAPE NDip Agric Mgt 3 yrs M (59% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr FSTATE NDip Agric Mgt 3 yrs MANGOS NDip Agric 3 yrs M with 5 HG or SG subjs: Eng HG 40)6 MANGOS NDip Agric: Animal Production 3 yrs M with 5 HG or SC subjs: Eng HG 40% PE NDip Agric Mgt 3 yrs M with HG or SG subjs only PTA NDip Agric: Animal Production 3 yrs PTA NDip Agric: Extension 3 yrs PTA NDip Agric: Plant Production Mgt 3 yrs PTA NDip Agric: Research 3 yrs SAASVELD NDip Agric Mgt 3 yrs M with HG or SG subjs only. Preference will be given to students with Biol, Geog + Math
Air Pollution Control Air Pollution Control
SA NCert Air Pollution Control 1 yr A qualification in Public Health or M with 2 yrs appropriate experience
Ambulance & Emergency Care Ambulance & Emergency Care
NATAL NDip Ambulance & Emergency Care 3 yrs M with 4 subjs on HG or SG. Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%+ Math and/or Phys Sc. Candidate must be 18 yrs of age and have at least a learner driver's licence NDip Ambulance & Emergency Care 3 yrs f/t or p/t M
Analytical Chemistry Analytical Chemistry
BORDER NDip Analytical Chemistry 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Analytical Chemistry 3 yrs f/t or p/t M (5096 av) with 5 subjs on HG or SG: Math + Phys Sc FIG 40)6 or SG 50%. 1st + 2nd Language HG, 1 of which must be Eng or Afr MANGOS NDip Analytical Chemistry 3 yrs M with 5 HG or SG subjs, including Eng plus Math + Phys Sc HG 50% + Eng OR N3 with 50% in 2 major subjs + Eng NATAL NDip Analytical Chemistry 3yrs M with 4 subjs on HG or SG: Eng 1 st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 7096 Math + Phys Sc HG 40% or SG 60% NTV NDip Analytical Chemistry 3 yrs (1st yr leads to an M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, NCert and 2nd yr to an including Math 60%+ Eng NHCert) NWEST NDip Analytical Chemistry 3 yrs M: Math + Phys 5c HG 50% or SG 60%. 2 official Languages of which 1 must be Eng PE NDip Analytical Chemistry 3 yrs M with HG or SG subjs only: Math + Phys Sc 50% PENIN NDip Analytical Chemistry 3 yrs M: Phys Sc + Math SG 50% or HG 40%
8P 70 Techni* Tech Course Duration Entry Requirements Analytical Chemistry Analytical Chemistry
PTA NDip Analytical Chemistry 3 yrs (1st yr leads to an M: Math + Phys Sc HG 50% or SC 6096 NCert) SULTAN NDip Analytical Chemistry 3 yrs Preferably UM but at least M with 4 subjs on HG or SG (official Languages included): Math HG 40% or SG 60% + Phys Sc + Eng VAAL NDip Analytical Chemistry 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math + Phys Sc HG 40% or SG 50% WITS NDip Analytical Chemistry 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math + Phys Sc HG 40% or SG 60%. A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60%
Architectural Technology Architectural Technology
CAPE NDip Architectural Tech 3 yrs M with 5 subjs on HG or 5G. 1st + 2nd Language HG, 1 of which must be Eng or Mr. Math SG 40% or N3 Math 60%. Submission of a portfolio NATAL NDip Architectural Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%. Portfolio of art work NN NDip Architectural Tech 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, including Math 60% + Eng PE NDip Architectural Tech 3 Yrs M with HG or SG subjs only PENIN NDip Architectural Tech 3 yrs M or N3 with Eng 1st or Eng 2nd Language SG + another official Language as 2nd Language SG (both at Matric level). Portfolio PTA NDIp Architectural Tech 3 yrs M SULTAN NDip Architectural Tech 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG + Eng 1st Language WITS NDip Architectural Tech 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math HG 40% or SG 60%. A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60%
Banking Banking
CAPE NDip Banking 3 yrs f/t or 4 yrs p/t M (50%+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr FSTATE NDip Banking 3 Yrs M withAcc. SA NDip Banking 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NDip Banking 3 yrs M with 4 subjs on HG or SG (official Languages included). Eng 1st or 2nd Language + Math HG 40% or SG 50%. Acc is an added recommendation WITS NDip Banking 3 yrs f/t or p/t M: Eng + Acc HG 4036 or SG 6096
Biomedical Technology Biomedical Technology
CAPE NDip Biomedical Tech 3 yrs M (5C% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math, Phys Sc + 8101 50% FSTATE NDip Biomedical Tech 3 yrs M with Math + Phys Sc + Biol HG or SG MANGOS NDip Biomedical Tech 3 yrs M with 5 HG or SG subjs: Eng HG 40%. Math, Phys Sc + Blot HG 40% or SG 50% NTV NDip Biomedical Tech 3 yrs UM with Eng 40%: Math, Phys Sc + Biol HG 40% PE NDIp Biomedical Tech 3 Yrs M with HG or SG subjs onty: Eng, Math, Phys Sc + Bid SG 50% PENIN NDip Biomedical Tech 3 yrs (1 yr internship to M with Math + Phys Sc + Biol HG 40% or SG 50% become a practising medical technologist) PTA NDip Biomedical Tech 3 yrs M: Math + Phys Sc HG 4036 or SG 60% SULTAN NDip Biomedical Tech 3 yrs M with Math, Eng, Phys Sc and Biol HG 40% or SG 60% VAAL NDip Biomedical Tech 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math, Phys Sc + Biol HG 40% or SG 50% WITS NDip Biomedical Tech 3 yrs M: Phys Sc, Math + Biol HG 50% or SG 60%
83
Technikons 71 Tech Course Duration ' Entry Requirements Biotechnology Biotechnology
NATAL NDip Biotechnology 3 yrs (1st yr leads to an M with 4 subjs on HG or SG: Math + Biol or Phys Sc (preferably on HG) + Eng 1st NCert and 2nd yr to an Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% NHCert) SULTAN NDip Biotechnology 3 yrs (An NCert can be UM: Eng, Math, Phys Sc + Biol HG 40% or SG 60% obtained after the 1st yr) VAAL NDip Biotechnology 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math + Phys Sc HG 40% or SG 50% WITS NDip Biotechnology 3 yrs M: Math, Phys Sc + Biol HG 50% or SG 60%
Building Building
BORDER NDip Building 3 yrs f/t or 4 yrs p/t M with 4 subjs (Eng HG or SG included) CAPE NDip Building 3 yrs M with 5 subjs on HG or SG: 1st 2nd Language HG, 1 of which must be Eng or Afr. Math SG 40% or N3 Math 60% ECAPE NDip Building Scs 3 yrs M ESTATE NDip Building 3 yrs M with Math MANGOS NDip Building 3 yrs M with 5 HG or SG subjs: Math + Science HG 40%+ Eng SG 40%0R N3 with Math 50% + Eng SG 40% NATAL NDip Building 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% + Math HG or SG NIV NDip Building 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, induding Math 60%+ Eng PE NDip Building 3 yrs M with HG or SG subjs only PENIN NDip Building 3 yrs M with Math OR N3 with Eng 1st or Eng 2nd Language SG + another offfical language as 2nd Language SG (both at Matric level) PTA NDip Building 3 yrs M: Math SG SULTAN NDip Building 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG + Eng 1st Language WETS NDip Building 3 yrs M or N3/N4 (contact the particular department regarding entrance requirements): Math + Phys Sc FIG 40% or SG 60%. A pass in Eng 1st language or Eng 2nd Language HG 40% or SG 60%
Business Administration Business Administration
ECAPE NDip Commercial Practice 3 yrs M ECAPE NDip Office Admin 3 yrs M: Eng FIG 40% + Typing ESTATE NDip Business Admin 3 yrs M NTV NDip Commercial Practice 3 yrs M (4096 av): Eng HG 5096 + Afr HG 4096 NWEST NDip Business Admin 3 yrs f/t or p/t M (40% ay): 2 official Languages of which 1 must be Eng NWEST NDip Commercial Practice 3 yrs f/t or p/t M (4096 av): Acc HG 40% or SG 50%. 2 official Languages of which 1 must be Eng PTA NDip Business Admin 3 yrs (1st yr leads to an M:Afr or Eng HG 50% or SG 60%+ Typing SG (35 w.p.m.) NCert) PTA NDip Business Communication 3 yrs M: Eng or Afr HG 60% SA National Preliminary Cert Business 1 yr M with a max of 2 subjs on LG (2 Languages exd) Education SA NDip Administrative Mgt: General, Financial 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SA NDip Business Admin 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages eod) NCert and 2nd yr to an NHCert) SA NDip Commercial Practice 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SA NDip Company Admin 3 yrs M with a max of 2 subjs on LG (2 Languages exc0 SULTAN NDip Business Admin 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 40% or SG 50% SULTAN NDip Commercial Practice 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages induded): Eng + Acc HG 40% or SG 50% SULTAN NDip Office Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included). Eng 1st Language HG 50% or SG 60%. Preference will be given to students with Math, Acc + Computer Studies WETS NDip Office Mgt 3 yrs M
84 Technikons Tech Course Duration Entry Requirements Ceramic Design & Technology Ceramic Design & Technology
FSTATE NDip Ceramic Design 3 yrs M PE NDip Ceramic Design 3 yrs M with HG or SG subjs only 1st Language HG 40% or SG 50%, Preference to students with HG subjs PTA NDip Ceramic Design 3 yrs PTA NDip Ceramic Tech 3 yrs M: Math + Phys Sc HG 50% or SG 60% VAAL NDip Ceramic Design 3 yrs (1st yr leads to an M with 4 subjs on HG or SG, official Languages included, 1 of which must be a NCert and 2nd yr to an language of instruction. Submission of a portfolio NHCert) WITS NDip Ceramic Design 3 yrs M + submission of a portfolio
Chartered Secretaries & AdministratorsChartered Secretaries & Administrators
NATAL Cert of the Inst of Chartered Secretaries & 3 yrs M with 4 subjs on HG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language Administrators (CIS) HG 60% or SG 70%. Math HG 40% or SG 50% or Acc HG 50% or SG 60%
Child Care Child Care
NATAL NDip Residential Child Care 3 yrs (1st yr leads to an M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd NCert and 2nd yr to an Language HG 60% or SG 70% NHCert) SA NDip Residential Child Care 3 yrs (1st yr leads to an M (people who are above the age of 23 with Std 8 and relevant work experience may NCert and 2nd yr to an apply for provisional admission) NHCert)
Chiropractics Chiropractics
NATAL NDip Chiropractics 3 yrs UM + over 17 yrs of age: Eng 1st language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% WITS NDip Chiropractics 3 yrs M: Math + Phys Sc HG 50% or SG 60%
Clinical Technology Clinical Technology
FSTATE NDip Clhtkal Tech: Cardiology, Critical Care, 3 yrs M with Math .+ Phys Sc + Biol HG or SG Neethi 1104Y. tiqurtiPhYsiologYi PUlmOnology: Reproductive Biology SULTAN NDip Clinical Tech 3 yrs M with 4 subjs on HG or SG (official Languages included): Math, Eng, Phys Sc + Biol
Commercial Administration Commercial Administration
BORDER NDip Commercial Admin 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Commercial Admin 3 yrs f/t or 4 yrs p/t M (50%+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG 50%, 1 of which must be Eng or Afr NATAL NDip Commercial Admin 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG: Eng 1st language HG 4096 or SG 50% or Eng 2nd Language FIG 60% or SG 70% PE NDip Commercial Admin: Financial, Legal,3 yrs (1st yr leads to an M with HG or SG subjs only: 1st Language HG 40% or SG 50% or 2nd Language HG Personnel NCert and 2nd yr to an 50% or SG 60% NHCert) PENIN NDip Commercial Admin 3 yrs M + good language skills SULTAN NDip Commercial Admin 3 yrs M with 4 subjs on HG or SG (official Languages included). Eng HG 40% or SG 50%
Technikons 73 Tech Course Duration Entry Requirements
Community Development Community Development
ECAPE NDip Community Development Mgt 3 yrs M
Community Extension Community Extension
MANGOS NDip Community Extension 3 yrs M with 5 HG or SG subjs: Eng HG 40% PTA (Tompi NOip Community Extension 3 yrs M (40% av): Math + Phys Sc or Paol Se leka Agric College)
Computer Systems Computer Systems
FSTATE NDip Computer Systems Engineering 3 yrs M with Math + Phys Sc HG or SG NTV NDip Computer Systems 3 yrs M with Math + Eng + Phys Sc HG 40% or SG 5096 NWEST NDip Computer Systems Engineering 3 yrs M (40% av): Math HG 40% or SG 50%. 2 official Languages of which I must be Eng PTA NDip Computer Systems 3 yrs M: Math + Phys Sc 14G 5096 or SG 6036 SULTAN NDip Computer Systems Engineering 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG 40% or SG 50% + Eng 1 st Language. Phys Sc is a strong recommendation VAAL NDip Computer Systems Engineering 3 yrs M with 4 subjs on HG or SG (official Languages included): Math, Eng + Afr or another Language.HG 40% or SG.5036 WITS NDip Computer Systems Engineering 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math + Phys Sc HG 40% or SG 60%. A pass in Eng 1st Language or Eng 2nd Language HG 40)6or SG 60%
Corrosion Control Corrosion Control
SA Cert Corrosion Control 11 mths
Cost & Management Accounting Cost & Management Accounting
BORDER NDip Cost & Mgt Accounting 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Cost & Mgt Accounting 3 yrs f/t or 4 yrs p/t M (50%+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr ECAPE NDip Cost & Mgt Accounting 3 yrs FSTATE NDip Cost & Mgt Accounting 3 yrs M with Acc MANGOS NDip Cost & Mgt Accounting 3 yrs f/t or 4 yrs p/t M (50% av) with 5 HG or SG subjs: Eng + Acc or Math HG 50% NATAL NDip Cost & Mgt Accounting 3 yrs . _..44-with 4 subjs on HG or SG: Eng 1st Language HG 406 diSC 50% or Eng 2nd Language HG 60% or SG 70%. Math HG 40% or SG 50%- NW NDip Cost & Mgt Accounting 3 yrs M (40%av): Eng + Acc HG 40% or SG 50% NWEST NDip Cost & Mgt Accounting 3 yrs f/t or p/t M (40%av): Acc + Math HG 40% or SG 50%. 2 offidal Languages of which 1 must be Eng PE NDip Cost & Mgt Accounting 3 yrs f/t or p/t M with at least 5 HG or SG subjs: 1st Language HG 40% or SG 50% + 2nd Language HG (F) or SG 40%. Math, Commercial Math or Acc HG 40% or SG 60% PENIN NDip Cost & Mgt Accounting 3 yrs M with Acc + Math HG 40% or_SG 50%. Proficiency in languages ± good analytical skills PTA NDip Cost & Mgt Accounting 3 yrs f/t or 4 yrs p/t M: Math + Acc HG 50% or SG 60% SA NDip Cost & Mgt Accounting 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages exd) NCert and 2nd yr to an NHCert) SULTAN NDip Cost & Mgt Accounting 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages included): Eng 1st or 2nd Language + Math HG 40% or SG 50%. Acc is an added recommendation VAAL NDip Cost & Mgt Accounting 3 yrs M with 4 subjs on HG or SG, official Languages induded, 1 of which must be a language of instruction: Acc WITS NDip Cost & Mgt Accounting 3 yrs f/t or p/t M: Math or Acc HG 40% or SG 60%
86 74 Technikons Tech Course Duration Entry Requirements Credit Management Credit Management
PTA NDip Credit Mgt 3 yrs f/t or 4 yrs p/t M: Acc HG 50% or SG 60% SA NDip Credit Mgt 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NDip Credit Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 40% or SG 50% + Acc WITS NDip Credit Mgt P/t only M: Acc or Math HG 40% or SG 60%
Dental Technology & Assisting Dental Technology & Assisting
FSTATE Cert Dental Assisting 1 yr M with Biol SG 50% NATAL NHDip: Dental Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% + Phys Sc SG 50% or Math HG 60% or SG 70% PENIN NCert Dental Chairside Assistant 1 yr M. Biol and/or Phys Sc will be a strong recommendation PENIN NDip Dental Tech 3 yrs M with Math or Phys Sc. Successful completion of a aptitude and dexterity test PTA NCert Dental Assisting 1 yr M: Biol + Math HG 40% or SG 60% PTA NDip Dental Tech 3 yrs M: Math + Phys Sc SG SULTAN NCert Dental Assisting 1 yr f/t M or a recognised equivalent qualificaton with Biol + 1 other science subj WITS NDip Dental Tech 3 yrs M: Phys Sc + Math HG 4096 or SG 50%
Drama & Dance Drama & Dance
NATAL NDip Drama 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 4036 or SG 5036 or Eng 2nd Language HG 60% or SG 7096. Student must pass an audition PTA NDip Dance 3 yrs (I st yr leads to an M NCert and 2nd yr to an NHCert) PTA NDip Drama 3 yrs (1st yr leads to an M NCert and 2nd yr to an NHCert)
Drilling Practice Drilling Practice
SA NDip Drilling Practice 3 yrs M with Math and a max of 2 subjs on LG (2 Languages excl). Students must be employed in drilling practice or a related career
Economic Management Analysis Economic Management Analysis
SA NDip Economic Mgt Analysis 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages exd) NCert and 2nd yr to an NHCert)
Education Education
BORDER NDip Education: Commerce 3 yrs M with 4 subjs (Eng HG or SG included) BORDER NDip Education: Home Econ 3 yrs M with 4 subjs (Eng HG or SC included) CAPE NDip Education: Commerce 3 yrs M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math option: Math HG 40% or SG 50% ECAPE NDip Education: Commerce 3 yrs f/t or 4 yrs p/t M ECAPE (only NDip Education: Technical 3 yrs at Butterworth) ECAPE (only NDip Adult Basic Education & Training 3 yrs at East London) FSTATE NDip Education: Commerce 3 yrs M with 1st Language + another approved Language (1 must be on HG) + another subj on HG (Languages excluded) OR N3 with 4 subjs + 2 Languages on business or Matric level. If Math I is selected: Math HG 40% or SG 50%
87 Technikons 75 Tech ,Course Duration' Entry Requirements
Education Education
FSTATE NDip Education: Technical: Civil, Electrical, 3 yrs M with Math + Phys Sc (preferably on HG) OR N3 with Math+ Engineering Sc + 2 Mechanical, Languages at Matric level NATAL HDip Education: Art 4 yrs M with passes in 6 subjs. 1st Language HG 50%+ 1 other HG subj apart from the official Languages. A letter from the school principal recommending the candidate's suitability as a school teacher NATAL HDip Education: Econ Scs 4 yrs M with passes in 6 subjs. 1st Language HG 50% + 1 other HG subj apart from the official Languages. A letter from the school principal recommending the candidate's suitability as a school teacher NATAL HDip Education: Home Econ 4 yrs M with passes in 6 subjs. Eng 1st Language HG 50% + 1 other HG subj apart from the official Languages. A letter from the school principal recommending the NN candidate's suitability as school teacher NDip Education: Commerce 3 yrs M with 1 commercial subj + Eng on HG plus 1 other approved language (one as 1st Language) OR N4 with 2 languages on Manic level. Math option: Math HG 40% or SG 5096. Acc option: Acc HG 40% or SG 50% NN NDip Education: Home Econ 3 yrs M with Eng HG: 1 Science subj HG 40% or SG 50% NN NDip Education: Natural Sc 3 yrs NN M with Phys Sc + Math NDip Education: Technical 3 yrs M with Math + Phys Sc (or an equivalent e.g. N3 with Math, Engineering Sc + 2 other subjs) plus 2 official languages on Matric level NWEST NDip Commercial Education 3 yrs M: Acc + Math HG 40% or SG 50%. 2 official languages of which 1 must be Eng PE NDip Adult Basic Education 3 yrs M with HG or SG subjs only. 2 Languages (1 on HG) + another subj on HG PE NDip Education: Commerce 3 yrs M with HG or SG subjs only. 2 languages (1 on HG) + another commercial subj on HG (if Math or Acc is selected as a course subj: Math or Acc HG 40% or SG 5096) OR N4 with 2 languages on Matric level (1 on HG). If Math or Acc is selected as a course subj: Math or Acc PE NDip Education: Natural Scs 3 yrs M with HG or SG subjs only. 2 Languages (1 on HG) + another HG subj which must be Phys Sc or Biol + Math HG 40% or SG 50% OR N4 with 2 languages on Matricor business level (1 on HG) plus Phys Sc or Biol. If Math is selected: Math PENIN NDip Adult Basic Education & Training 3 yrs (1st yr leads to an M with one Language as 1st Language HG + another Language NCert) PENIN NDip Education: Commerce 3 yrs M with 2 Languages on business or Matric level. 1st Language HG + another Language HG + another subj HG 40%. If Math I is selected: Math HG 40% or SG 50% PENIN NDip Education: Natural Sc 3 yrs M or N4 with 2 Languages on business or Matric level. 1st Language HG + another language HG + another subj HG 40%. If Math I is selected: Math HG 40% or SG 50% PTA NDip Commercial Education 3 yrs M with 1st Language HG + another subj HG (Languages exci). Preference to students with commercial subjs PTA NDip Education: Natural Sc 3 yrs M: Math HG 4096 or SG 5096 + Phys Sc or Biol + 1 Language HG + another subj HG (not a Language)
Engineering Engineering
BORDER NDip Civil Engineering 3 yrs fit or 4 yrs p/t M with 4 subjs (Eng HG or SG included) BORDER NDip Electrical Engineering 3 yrs f/t or 4 yrs p/t M with 4 subjs (Eng HG or SG included) BORDER NDip Mechanical Engineering 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Chemical Engineering 3 yrs fit or pit M150% av) with 5 subjs on HG or SG: Math + Phys Sc HG 4096 or SG 50%. 1st + 2nd Language HG, 1 of which must be Eng or Afr CAPE NDip Civil Engineering 3 yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math SG 50% or HG 40% or N4 Math 50% + Phys Sc CAPE NDip Electrical Engineering: Electronic 3 yrs f/t or 4 yrs p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Communications, Heavy Current Tech, Eng or Afr. Math + Phys Sc HG 40% or SG 50% or N4 Math + another science subj Industrial Electronics, Computer Systems 60% CAPE NDip Industrial Engineering 3 yrs M (50% av) with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math + Phys Sc HG 40% or SG 50% or N4 with Math 60% CAPE NDip Mechanical Engineering 3 yrs M (50% av) with 5 subjs on HG or SC. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Matric Math + Phys Sc SG 50% or HG 40% or N4 with Math 60% ECAPE NDip Civil Engineering 3 yrs M ECAPE NDip Electrical Engineering: Heavy Current,3 yrs M Light Current ECAPE NDip Mechanical Engineering 3 yrs M FSTATE NDip Civil Engineering: General, Agriculture 3 yrs M: Math + Phys Sc HG or SG FSTATE NDip Electrical Engineering: Power, Light 3 yrs M with Math + Phys Sc HG or SG Current FSTATE NDip Mechanical Engineering 3 yrs M with Math + Phys Sc HG or SG MANGOS NDip Chemical Engineering 3 yrs M with 5 HG or SG subjs, including Eng plus Math + Phys Sc HG 50% or N3 with 50% in 2 major subjs + Eng MANGOS NDip Civil Engineering 3 yrs M with 5 HG or SG subjs: Eng SG 40% plus Math + Phys Sc HG 50%0R N4 (all subjs 5096) with N3 Math 50% + Eng SG 40%
88 76 Technikons Tech Course Duration Entry Requirements
Engineering Engineering
MANGOS NDip Electrical Engineering 3 yrs M with 5 HG or SG subjs: Math, Phys Sc, Eng + another Language HG 6C96 OR N4 Electrical Engineering with Matric Eng + another language MANGOS NDip Mechanical Engineering 3 yrs Successful completion of the access course or equivalent. Requirements for the access course: M or equivalent including Math, Science or Biol + Eng and another language OR N3 with Matric Eng + another language OR an appropriate GCE Certificate NATAL NDip Chemical Engineering 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 60% or Eng 2nd Language HG 50% or SG 70% + Math + Phys Sc HG NATAL NDip Civil Engineering 3 yrs M with 4 subjs on HG or SG. Eng 1st Language HG 40% or SG 50%or Eng 2nd Language HG 60% or SG 70% + Math HG 40% or SG 50% NATAL NDip Electrical Engineering: 3 yrs M or N3 (with 4 subjs) + 1st and 2nd Languages + Math + Phys Sc (or equivalent). Communications, Heavy Current, Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% Instrumentation & Control, Light Current NATAL NDip Mechanical Engineering 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 5096 or SG 60%or Eng 2nd Language HG 60% or SG 70%. Math + Phys Sc HG 40% NN NDip Chemical Engineering 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, including Math 60% + Eng NN NDip Civil Engineering 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, induding Math 60%+ Eng NN NDip Electrical Engineering 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, including Math 60% + Eng NN NDip Mechanical Engineering 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, including Math 60%+ Eng NWEST NDip Electrical Engineering (Light Current) 3 yrs M (40% av): Math + Phys Sc. 2 official Languages of which 1 must be Eng PE NDip Civil Engineering 3 yrs M with HG or SG subjs only. A good pass in Math + Phys Sc PE NDip Electrical Engineering 3 yrs M with HG or SG subjs only + good pass marks in Math + Phys Sc OR N3 with Math + Engineering Sc 60% plus 2 Languages on Matric level PE NDip Industrial Engineering 3 yrs M with HG or SG subjs only. Math + Phys Sc HG 40% or SG 5096 OR N3 with Math + Science 50% plus 2 languages on Matric level PE NDip Mechanical Engineering 3 yrs M with HG or SG subjs only. Math + Phys Sc HG 40% or SG 50% OR N3 with Math + Science 50% plus 2 languages on Matric level PE NDip Metallurgical Engineering 3 yrs M with HG or SG subjs only. Math + Phys Sc HG 40% or SG 50% OR N3 with Math + Science 50% plus 2 languages on Matric level PE NDip Wood Production Engineering 3 yrs M with 1st Language HG 40% or SG 50% + Math. LG subjs are not acceptable PENIN NDip Chemical Engineering 3 yrs M with Phys Sc + Math HG 4096 or SG 5036 PENIN NDip Civil Engineering 3 yrs M with Math HG or SG OR N3 with Eng 1st or Eng 2nd Language SG + another official Language as 2nd Language SG (both at Matric level) PENIN NDip Electrical Engineering: Computer, 3 yrs M with Math + Phys Sc HG 40% or SG 50)6 + Eng 40)60R N3 with N4 Engineering Sc Instrumentation, Power Systems, + N4 Math 60% + Eng 40% Telecommunications PENIN NDip Mechanical Engineering 3 yrs M with Math + Phys Sc HG 50% or SG 60%+ Eng 40%0R N3 with N4 Math + N4 Engineering Sc 60%+ Eng 40% PTA NDip Chemical Engineering 3 yrs M: Math + Phys Sc HG 50% or SG 60% PTA NDip Civil Engineering 3 yrs M: Math + Phys Sc HG 40% or SG 60% PTA NDip Civil Engineering (Agric) 3 yrs M: Math + Phys Sc HG 4096 or SG 6096 PTA NDip Electrical Engineering: Avionics, 3 yrs M: Afr or Eng, Math + Phys Sc HG 40% or SC 50% Clinical & Analogue, Digital Tech, High Frequency Tech, Power, Process Instrumentation & Control PTA NDip Industrial Engineering 3 yrs M: Math HG 4096 or SG 50% PTA NDip Mechanical Engineering: Design & 3 yrs (also offered p/t) M: Math + Phys Sc HG 40% or SG 50% Manufacturing, Maintenance & Air Conditioning PTA NDip Metallurgical Engineering 3 yrs M: Math + Physics HG 50% or SG 60% SA NDip Chemical Engineering 3 yrs M with a max of 2 subjs on LG (2 Languages excluded) + Math + Physics + Chem HG 40% or SG 50%0R N3 with 4 subjs (50% av) + 2 Languages HG or SG + N3 Industrial Chem 50% + N3 Math + N3 Engineering Sc SA NDip Civil Engineering 3 yrs M with a max of 2 subjs on LG (2 Languages exduded) + Math + Physics + them HG 40% or SG 50% OR N3 with 4 subjs (50% av) + 2 Languages HG or SG + N3 Math + N3 Engineering Sc SA NDip Electrical Engineering: Electronics & 3 yrs M with a max of 2 subjs on LG (2 Languages excluded) + Math, Physics + Chemistry Electronic Communication, Heavy Current, HG 40% or SG 50% OR N3 with 4 subjs (50% av) (Math + Engineering Sc included) + Process Instrumentation 2 Languages HG or SG SA NDip Industrial Engineering 3 yrs M with a max of 2 subjs on LG (2 Languages excluded) + Math, Physics + them HG 40% or SG 50%0R N3 with 4 subjs (50% av) (Math + Engineering Sc included) + 2 Languages on HG or SG SA NDip Mechanical Engineering 3 yrs M with a max of 2 subjs on LG (2 Languages excluded) + Math, Physics + Chemistry HG 40% or SG 50%0R N3 with 4 subjs (50% av) (Math + Engineering Sc included) + 2 Languages HG or SG
89 Tpchnikons 77 Tech Course Duration 4 Entry Requirements Engineering Engineering
SULTAN NDip Chemical Engineering 3 yrs Preferably UM but at least M with 4 subjs on HG or SG (official Languages induded): Math + Phys Sc. Technical Drawing will be an added recommendation SULTAN NDip Civil Engineering 3 yrs M with Math + Phys Sc and/or Technical Drawing HG 50% or SG 60% + Eng HG 40% or SG 60%. Computer Studies will be an added advantange. Students with M + a completed N3 with Math, Engineering Sc, Technical Drawing + a trade subj relating to the Building or Civil Engineering field will be given preference SULTAN NDip Electrical Engineering: Electronic 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG, Eng 1st Communications, Industrial Language + Phys Sc Instrumentation & Control, Power SULTAN NDip Industrial Engineering 3 yrs M with 4 subjs on HG or SG (official Languages included). Math HG + Phys Sc + Eng 1st (or another Language) as 1st Language OR N3 with Math + Applied Sc 50% + Eng + Afr (or another Language) on Matric level SULTAN NDip Mechanical Engineering 3 yrs M with 4 subjs on HG or SG (official Languages induded). Math HG + Phys Sc + Eng (or another Language) as 1st Language OR N3 with Math + Applied Sc 50% + Eng + Afr (or another Language) on Matric level VAAL NDip Chemical Engineering 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math + Phys Sc HG 40% or SG 50% VAAL NDip Civil Engineering 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be Eng. Math + Phys Sc HG 40% or SG 50%0R N3 with 4 subjs, induding Math + Engineering Sc 5036 plus Eng + another language VAAL NDip Electrical Engineering: Electronics, 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be Eng: Electronic Communication, Power, Process Math + Phys Sc HG 40% or SC 50%0R N3 with 4 subjs, including Math + Instrumentation & Control Engineering Sc 50%plus Eng + another language
VAAL NDip Industrial Engineering . 3 yrs M with 4 subjs on HG or SG, official languages included, 1 of which must be Eng. Math + Phys Sc HG'1036 or SG 50%0R N3 with 4 subjs, including Math + Engineering Sc 50%"plus Eng + another language VAAL NDip Mechanical Engineering 3 yrs M with 4 subjs on HG or SG, official languages included, 1 of which must be Eng. Math + Phys Sc HG 40% or SG 50%0R N3 with 4 subjs, including Math + Engineering Sc 50% plus Eng + another language VAAL NDip Metallurgical Engineering 3 yrs M with 4 subjs on HG or SG, official languages included, 1 of which must be Eng. Math + Phys Sc HG 40% or SG 50%0R N3 with 4 subjs, induding Math + Engineering Sc 50% plus Eng + another language WITS NDip Chemical Engineering 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math + Phys Sc HG 40% or SG 6096 A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60% WETS NDip Civil Engineering 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): A pass in Eng 1st Language or Eng 2nd Language HG Environmental Health Environmental Health CAPE NDip Environmental Health 3 yrs M with 5 subjs on HG or SC: 1st + 2nd Language HG, 1 of which must be Eng or Afr. 2 or more of the following subjs: Math, Biol, Physiol, Phys Sc or Geog ESTATE NDip Environmental Health 3 yrs M with at least 2 of the following subjs HG or SG 5096: Math, Phys Sc, Bid, Geog MANGOS NDip Environmental Health 3 yrs M with 5 HG or SG subjs (1 subj on HG): Eng, Math + Phys Sc 40% NATAL NDip Environmental Health 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% plus 2 of the following subjs on HG 40% or SG SO% Math, Phys Sc, Physiol, Biol, Geog NTV NDip Environmental Health 3 yrs M PE NDip Environmental Health 3 yrs M with HG or SG subjs only + a good pass mark in Eng, Phys Sc, Math and Biol PENIN NDip Environmental Health 3 yrs M with any 2 of the following subjs: Math, Phys Sc, Biol, Geog or Agric Sc. Preference to students with HG passes PTA NDip Environmental Health 3 yrs M: Phys Sc + Math SULTAN NDip Environmental Health 3 yrs M with 4 subjs on HG or SG (official Languages included): Math + Biol, Geog or Phys Sc WITS NDip Environmental Health 3 yrs M (HG SO% or SG 60% av) with 2 natural science subjs 90 78 Technikons Tech Course Duration Entry Requirements Environmental Management Environmental Management PTA NDip Environmental Mgt 3 yrs M: Math + Phys Sc HG 50% or SG 6096 Equine Studies Equine Studies PTA NDip Equine Studies 3 yrs Explosives Technology Explosives Technology CAPE NDip Explosives Technology 3 yrs f/t or p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math + Phys Sc HG 4096 or SG 5096 Extraction Metallurgy Extraction Metallurgy NDip Extraction Metallurgy 3 yrs M: Phys Sc + Math HG 5096 or SG 6096 Fashion & Clothing Fashion & Clothing BORDER NCert Dressmaking & Pattern Construction1 yr f/t M with 4 subjs (Eng HG or SG included) BORDER NDip Fashion 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Clothing Mgt 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Submission of a portfolio CAPE NDip Fashion 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Submission of a portfolio ECAPE NDip Fashion 3 yrs (An NHCert can be M obtained after the 2nd yr) ECAPE NDip Textile Design & Tech 3 yrs M FSTATE NDip Clothing 3 yrs M NATAL NDip Clothing Mgt 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or,595096 or Eng 2nd Language HG 60% or SG 70% plus an understanding of bailc Math NATAL NDip Fashion 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%. Portfolio of work NWEST NDip Fashion Design & Tech 3 yrs M (40% av) + aptitude test 2 official Languages of which 1. must be Eng PE NDip Fashion Design & Tech 3 yrs M with HG or SG subjs only 1st Language HG 40% or SG 50%. Preference to students with Math + Needlework -. ::-. PEN1N NIA, Clothing Mgt 3 yrs 1.14-withat leat 5,ubjs + a portfolio- PENIN NDip Fashion Design & Tech 3 yrs M with Eng Language proficiency PTA NDip Clothing 3 yrs M with HG subjs E+ av or SG subjs RN av PTA NDip Fashion 3 yrs (1st yr leads to an M NCert and 2nd yr to an NHCert) SULTAN NDip Fashion 3 yrs M with 4 subjs on HG or SG (official Languages included) VAAL NCert Garment & Pattern Construction 1 yr M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction VAAL NDip Clothing 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of Instruction VAAL NDip Fashion 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WETS NDip Clothing Mgt 3 yrs M with Eng WITS NDip Fashion 3 yrs M with Eng + submission of a portfolio Film & Video Technology Film & Video Technology NATAL NDip Video Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 4096 or SG 50% or Eng 2nd / Language HG 60% or SG 70% PTA NDip Film & Video Tech 3 yrs M: Eng or Afr HG 50% or SG 6096 91 Technikons Tech Course" Dtiration Entry Requirements Financial Information Systems Financial Information Systems BORDER NDip Financial Info Systems 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Financial Info Systems 3 yrs f/t or 4 yrs p/t M (50%+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr ECAPE NDip Financial Info Systems 3 yrs M: Math HG 40% or SG 50% + Eng HG 40% or SG 50% FSTATE NDip Financial Info Systems 3 yrs M with Acc NATAL NDip Financial Info Systems 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 4096or SG 50% or Eng 2nd Language HG 60% or SG 70% + Math HG or 50%SG or Acc HG 50%or SG 6096. Candidate must pass the Technikon's computer aptitude test NTV NDip Financial Info Systems 3 yrs M (40% av): Acc + Eng HG 40% or SG 50% PE NDip Financial Info Systems: Cost & Mgt 3 yrs f/t or p/t M with HG or SG subjs only 1st Language HG 40% or SG 50%+ 2nd Language HG Acc, Financial Acc, Info Systems, Internal (F) or SG 40%. Math, Commercial Math or Acc HG 40% or SG 60% Auditing PTA NDip Financial Info Systems 3 yrs f/t or 4 yrs p/t M: Math + Acc HG 50% or SG 60% SULTAN NDip Financial Info Systems 3 yrs M with 4 subjs on HG or SG (official Languages induded): Eng 1stor 2nd Language + Math HG 40% or SG 5096. Acc is an added recommendation VAAL NDip Financial Info Systems 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must bea language of instruction. Acc WITS NDip Financial Info Systems 3 yrs M: Acc or Math HG 40% or SG 60% Financial Management Financial Management SA Cert Personal Financial Mgt 1 yr M with a max of 2 subjs on LG, excluding 2 languages Fine Art Fine Art BORDER Cert Access Programme: Art & Design 1 yr f/t M with 4 subjs (Eng HG or SG induded) BORDER NDip Fine Art 3 yrs M with 4 subjs (Eng HG or SG included) FSTATE NDip Fine Art 3 yrs M NATAL NDip Fine Art 3 yrs M with 4 subjs on HG or SG: A competent standard of written and spoken English+ a portfolio of art work PE NDip Fine Art: Painting, Printmaking, 3yrs M with HG or SG subjs only 1st Language HG 40% or SG 50% Preference to students Sculpture, Stained Glass with one HG subj PTA NDip Fine Art 3 yrs M VAAL NDip Fine Art 3 yrs (1st yr leads to an M with 4 subjs on HG or SG, official Languages included, 1 of which must bea NCert and 2nd yr to an language of instruction NHCert) WITS NDip Fine Art 3 yrs M + submission of a portfolio Fire Service Technology Fire Service Technology CAPE NDip Fire Service Tech 3 yrs p/t M (50% av) with 5 subjs HG or SG or equivalent qualifications + work experience. Candidates without Matric must be 23 yrs of age with 3 yrs fire service experience + a Cert in Fire Technology. All candidates must be employed by a Fire Services institution PE NDip Fire Service Tech 3 yrs Pit M with HG or SG subjs only: Math + Phys Sc. Students must be employed by a Fire Service Department PTA NDip Fire Service Tech 3 yrs Pit M + candidates must be employed by or involved in an approved allied service VAAL NDip Fire Brigade Tech 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math + Phys Sc HG 40% or SG 50% Food & Cateripg Food & Catering CAPE NDip Food & Nutrition 3 yrs M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Phys Sc or Biol CAPE NDip Food Service Mgt 3 yrs M (SS% av) with 5 subjs on HG or SG. 1st Language HG 50% + 2nd Language HG 40%, 1 of which must be Eng or Afr 92 Technik, Tech Course Duration Entry Requirements Food & Catering Food & Catering CAPE NDip Food Tech 3 yrs f/t or p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Mr. Math + Phys Sc HG 40% or SG 50% ECAPE NDip Food Service Mgt 3 yrs M FSTATE NDip Food Service Mgt 3 yrs M with 1 or more of the following subjs HG or SG: Biol, Phys Sc, Home Econ NATAL NDip Catering Mgt 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% NATAL NDip Food & Nutrition 3 Yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 5096 or Eng 2nd Language HG 60% or SG 70%. Preference to students with Eng HG &Nand Phys Sc and/or Biol and/or Math NATAL NDip Food Service Mgt 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%. Preference to students with Phys Sc and/or Biol and/or Math and/or Acc NATAL NDip Food Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 717136. Math + Biol or Phys Sc HG 50% NTV NDip Food Service Mgt 3 yrs M (40% av). Two science subjs HG 40% or SG 50% + Eng PENIN NDip Food Tech 3 yrs M:- Biol + Math + Phys Sc HG 40% or SG 50% PTA NDip Food & Clothing Tech 3 yrs M with SG subjs with 50% av or HG subjs E+ av PTA NDip Food & Nutrition 3 ws M with 50% av in HG subjs or 60% av in SG subjs PTA NDip Food Service Mgt 3 yrs M with 50% av in HG subjs or 60% av in SG subjs PTA NDip Food Tech 3 yrs M: Math + Phys Sc SG 50% SULTAN NDip Catering Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included) SULTAN NDip Food Tech 3 yrs f/t or 4 yrs p/t UM: Math, Phys Sc, Biol + Eng HG 40% or SG 60% VAAL NDip Food & Clothing Tech 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction VAAL NDip Food & Nutrition 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction VAAL NDip Food Service Mgt 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WETS NDip Food Service Mgt 3 yrs M with Eng HG WITS NDip Food Tech 3 yrs M: Phys Sc, Math + Biol HG 50% or SG 60% Forestry Forestry SAASVELD NDip Forestry 3 yrs M with HG or SG subjs only. Preference will be given to students with Math + Phys Sc or Biol Fuel Technology Fuel Technology SA NDip Fuel Tech 3 yrs (1st yr leads to an M + Math with a max of 2 subjs on LG (2 Languages excl). Students must be NCert and 2nd yr to an employed in a career related to fuel tech NHCert) Geology Geology NDip Exploration & Mining Geology 3 yrs M: Math + Phys Sc HG 5096 or SG 6096 Geotechnology Geotechnology PTA NDip Geotechnology 3 yrs M: Math + Phys Sc HG 50% or SG 60% Government / State Finance Government / State Finance BORDER NDip Local Government Finance 3 yrs f/t or 4 yrs p/t M with 4 subjs (Eng HG or SG included) ECAPE (only NDip State Accounts & Finance (Inland 4 yrs pit M at Umtata) Revenue) 93 Technikons 81 Tech Course Duration Entry Requirements' Government / State Finance Government / State Finance NWEST NDip Government Finance 3 yrs p/t M (40% av): Acc HG 40% or SC 50%. 2 official Languages of which 1 must be Eng PTA NDip Government Finance 3 yrs M: Acc PTA NDip Local Government Finance 3 yrs M: Acc PTA NDip: Local Government Finance 3 yrs M with Acc SA NDip Government Finance 3 yrs M with a max of 2 subjs on LG (2 Languages exci) SA NDip Local Government Finance 3 yrs M with a max of 2 LG subjs (2 Languages excl) SA NDip State Accounts & Finance (Inland 3 yrs M with a max of 2 subjs on LG (2 Languages exd) Revenue) SULTAN NDip Government Finance 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages included). Eng 1st or 2nd Language + Math HG 40% or SG 50%. Acc is an added recommendation Graphic Design Graphic Design CAPE NDip Graphic Design 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Submission of a portfolio FSTATE NDip Graphic Design 3 yrs M NATAL NDip Graphic Design 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 4066 or SG SO% or Eng 2nd Language HG 60% or SG 70%+ a portfolio PE NDip Graphic Design 3 yrs M with HG or SG subjs only: 1st Language HG 40% or SG 50%. Preference to students with one HG subj PENIN NDip Graphic Design 3 yrs M with Eng + another Language (1 must be on HQ PTA NDip Graphic Design 3 yrs M SULTAN NDip Graphic Design 3yrs M with 4 subjs on HG or SG (official Languages induded) VAAL NDip Graphic Design 3 yrs (1st yr leads to an M with 4 subjs on HG or SG, official Languages included, 1 of which must be a NCert and 2nd yr to an language of instruction. Submission of a portfolio NHCert) WITS NDip Graphic Design 3 yrs M + submission of a portfolio Health Services Administration Health Services Administration MANGOS NDip Health Services Admin 3 yrs M with 5 HG or SG subjs + Eng HG 40% Homoeopathy Homoeopathy NATAL NDip Homoeopathy 3 yrs UM + 17 yrs of age: Eng 1st Language HG 40% or SG 5096 or Eng 2nd Language HG 6096 or SG 70% + Math and/or Phys Sc. Preferably alsci Bloh="f WITS NDip Homoeopathy 3 yrs M: Math, Phys Sc + Biol HG 5096 or SG 6096 Horticulture Horticulture CAPE NDip Horticulture 3 yrs M (50% av) with 5 subjs on HG or SG or a N3 Cert in Horticulture: 1st + 2nd Language HG, 1 of which must be Eng or Afr NATAL NDip Horticulture 3 yrs M with 4 subjs on HG or SG: Eng 1st language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%. Biol and Phys Sc are highly recommended PENIN NDip Horticulture 3 yrs M (40% av). Preference to students with 13101 + Phys Sc (Matric level) PTA NDip Horticulture 3 yrs M SA NDip Horticulture 3 yrs (1 st yr leads to an M with a max of 2 subjs on LG (2 Languages exci) NCert and 2nd yr to an NHCert) Hospitality Management Hospitality Management BORDER NDip Hospitality Mgt 3 yrs M with 4 subjs (Eng HG or SG included) 94 Technikons Tech Course Duration Entry Re uirements Hospitality Management Hospitality Management CAPE NDip Hospitality Mgt 3 Yrs M (55% av) with 5 subjs on HG or SG: 1st Language FIG 50% + 2nd Language HG 40%, 1 of which must be Eng or Afr. Practical experience in the hotel industry is a recommendation PTA NDip Hospitality Mgt 3 yrs M with 50% av in HG subjs or 60% av in SG subjs WITS NDip Hospitality Mgt 3 yrs (1st yr leads to an M: Eng HG NCert and 2nd yr to an NHCert) Hotel Management & Reception Hotel Management & Reception FSTATE NDip Hotel Mgt 3 yrs M SULTAN NCert Hotel Reception 1 yr f/t M with 4 subjs on HG or SG (official Languages included) SULTAN NDip Hotel Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included) Housing Development & Management Housing Development & Management NDip Housing Development & Mgt 3 yrs M with a max of 2 subjs on LG (2 Languages excl) Human Resources Management Human Resources Management BORDER NDip Human Resources Mgt 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Human Resources Mgt 3 yrs f/t or 4 yrs p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr ECAPE NDip Human Resources Mgt 3 yrs M FSTATE NDip Human Resources Mgt 3 yrs M MANGOS NDip Human Resources Mgt 3 yrs f/t or 4 yrs p/t M (40% av) with 5 HG or SG subjs: Eng HG 40% NATAL NDip Human Resources Mgt 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% NTV NDip Human Resources Mgt 3 yrs f/t or 4 yrs p/t M: Eng + 2 other subjs HG 40% or SG 50%, excluding Languages + Biblical Studies NWEST NDip Human Resources Mgt 3 yrs p/t or f/t M (40% av): 2 official Languages of which 1 must be Eng 40% PE NDip Human Resources Mgt: Industrial 3 yrs f/t or p/t M with at least 5 HG or SG subjs: 1st Language HG 40% or SG 50% + 2nd Language Relations, Personnel Mgt, Training Mgt HG (F) or SG 40% PENIN NDip Human Resources Mgt 3 yrs M with good symbols in Languages PTA NDip Human Resources Mgt 3 yrs (also offered p/t) M SA NDip Human Resources Mgt 3 yrs (1 st yr leads to an M with a max of 2 subjs on LG (2 Languages exd) NCert and 2nd yr to an NHCert) SULTAN NDip Human Resources Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 40% or SG 50% + Acc VAAL NDip Human Resources Mgt 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WFTS NDip Human Resources Mgt 3 yrs M Import & Export Management Import & Export Management FSTATE NDip Import & Export Mgt 3 yrs M Information Technology Information Technology BORDER NCert Information Tech 2 yrs p/t M with 4 subjs (Eng HG or SC included) BORDER NDip Information Tech 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Information Tech 3 yrs f/t or 4 yrs p/t M (50%+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math HG 50% or SG 60% ECAPE NDip Information Tech 3 yrs f/t or 4 yrs p/t M: Math HG 40% or SC 50%+ Eng HG 4096 or SG 50% FSTATE NDip Information Tech 3 yrs M 95 Technikons 83 Tech Course Dur'ation Entr Res uirernenis Information Technology Information Technology NATAL NDip Information Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 4036 or SG 50% or Eng 2nd Language HG 60% or SG 70%+ Math HG or 50%5G or Acc HG 50% or SG 60%. Candidate must pass the Technikon's computer aptitude test NTV NDip Information Tech 3 yrs M: Eng + Math HG 40% or SG 50% NWEST NDip Information Tech 3 yrs M (40% av): Math + Phys Sc. 2 official Languages of which 1 must be Eng PE NDip Information Tech: Business Orientated3 yrs M (50% ay) with HG or SG subjs only: Business Orientated programme: At least 3 programme, Computer subjs on HG + preference to students with Math, Computer Studies + Acc. Networks/ Programming Computer Networks/Programming option: Math + Phys Sc HG 40% or SG 50% PENIN NDip Information Tech 3 yrs M with 4 subjs on HG + Eng 40%. Acc HG is a strong recommendation PTA NDip Information Tech 3 yrs f/t or 4 yrs p/t M: Math SG SA NCert Information Tech 1 yr M with a max of 2 subjs on the LG (2 Languages excl) SA NDip Information Tech 3 yrs M with a max of 2 LG subjs (2 Languages excl) SULTAN NDip Information Tech 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG 40% or SG 50% VAAL NDip Information Tech 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math -+ Eng HG 40% or SG 50% WITS NDip Information Tech 3 yrs M: Math Intercultural Studies Intercultural Studies SA Cert in Intercultural Studies 1 yr M Interior Design Interior Design CAPE NDip Interior Design 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Submission of a portfolio NATAL NDip Interior Design 3 yrs M with 4 subjs on FIG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%+ a portfolio PTA NDip Interior Design 3 yrs M WITS NDip Interior Design 3 yrs M + submission of a portfolio Internal Auditing Internal Auditing BORDER NDip Internal Auditing 4 yrs p/t M with 4 subjs (Eng HG or SG included) CAPE NDip Internal Auditing 3 yrs fit or 4 yrs pit M (5096+ av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr ECAPE NDip Internal Auditing 3 yrs M FSTATE NDip Internal Auditing 3 yrs M with Acc NTV NDip Internal Auditing 3 yrs M.(40% av): Acc + Eng HG 40% or SG 50% NWEST NDip Internal Auditing 3 yrs M (40% ay): Math + Acc HG 40% or SG 50%. 2 official Languages of which 1 must be Eng PE NDip Internal Auditing 3 yrs f/t or p/t M with at least 5 subjs HG or SG: 1st Language HG 40% or SG 50% + 2nd Language HG (F) or SG 40%. Acc, Math or Commercial Math HG 40% or SG 60% PENIN NDip Internal Auditing 3 yrs M with Acc HG 50% or SG 7036 Math. Eng Language proficiency + good analytical skills PTA NDip Internal Auditing 3 yrs f/t or 4 yrs p/t M: Acc HG 50% or SC 60% SA NDip Internal Auditing 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SULTAN NDip Internal Auditing 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages included): Eng 1st or 2nd Language + Math HG 40% or SG 50%. Acc is an added recommendation VAAL NDip Internal Auditing 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction. Acc International Communication International Communication PTA NDip International Communication 3 yrs M: Afr + Eng preferably HG 60% 96 84 Technikons Tech Course Duration Entry Requirements Inventory & Stores Management Inventory & Stores Management PE NDip Inventory & Stores Mgt 3 yrs f/t or 4 yrs p/t M with 6 subjs HG or SG: The tuition language FIG 40% or SG 50%a 2nd language Jewellery Design & Manufacture Jewellery Design & Manufacture CAPE NDip Jewellery Design & Manufacture 3 yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr NATAL NDip Jewellery Design & Manufacture 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 60% or Eng 2nd Language HG 60% or SG 70% + a portfolio PTA NDip Jewellery Design & Manufacture 3 yrs M WITS NDip Jewellery Design & Manufacture 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60%. Submission of a portfolio Journalism Journalism NATAL NDipJoumalism 3 yrs M with 4 subjs on HG including Eng and 1 other Language. Eng 1st or 2nd Language HG 60% NTV NDipJoumalism 3 yrs M: Eng 60%+ Afr HG 40% or SG 50% PENIN NDipJoumalism 3 yrs M. A flair for languages is a strong recommendation PTA NDip Journalism 3 yrs M: Afr + Eng (preferably HG 60%) SULTAN NDip Journalism 3 yrs M with 4 subjs on HG or SG. Eng HG 60% + any other Language HG Laboratory Practice Laboratory Practice PTA NCert Laboratory Assistant 1 yr SA NDip Laboratory Animal Tech 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excluded) + written evidence of access NCert and 2nd yr to an to facilities of an approved laboratory where laboratory animals are kept NHCert) Labour Relations Labour Relations VAAL NDip Labour Relations 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction Landscape Technology Landscape Technology CAPE NDip Landscape Tech 3 yrs M (5096av) with 5 subjs on HG or SG or a N3 Cert in Horticulture: 1st + 2nd Language HG, 1 of which must be Eng or Afr NATAL NDip Landscape Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% --- Art or Technical Drawing. Preference will also be given to students with Biol Phys Sc PTA NDip Landscape Tech 3 Yrs M SA NDip Landscape Tech 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) Language Practice Language Practice CAPE NDip Language Practice 3 yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr FSTATE NDip Language Practice 3 yrs M with 2 Languages on Matric level 60% PTA NDip Language Practice 3 yrs M SA NDip Language Practice 3 yrs M with a max of 2 subjs on the LG (2 Languages excl) Technikons Tech Course Entry Requirements Language Practice Language Practice SULTAN NDip Language Practice 3 yrs M with 4 subjs on HG or SG. 1st Language (Eng/Zulu/Afr) HG 50% + 2nd Language HG 60%. Speech & Drama at Matric level + a 3rd or more languages will be added advantages Library & Information Studies Library & Information Studies CAPE NDip Library & Info Studies 3yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr PE NDip Library & Info Studies 3 yrs (1st yr leads to an M (HG or SG subjs only) with 50%HG or 60%SG for 2 languages, which must include NCert and 2nd yr to an the language subjs to be taken in the course NHCert) PTA NDip Library & Info Practice 3 yrs M + good Language skills SA NDip Library & Info Practice 3 yrs M with a max of 2 LG subjs (2 Languages excl). Students must be employed in the field of library and info work SULTAN NDip Library & Info Studies 3 yrs (1st yr leads to an M with 4 subjs on HG or SG. Eng HG + 1 other Language NCert and 2nd yr to an NHCert) Management Management BORDER NDip Management 3 yrs M with 4 subjs (Eng HG or SG included) FSTATE NDip Management 3 yrs M NATAL NDip Management 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% + at least Std 8 Math NTV NDip Management 3 yrs M with Eng + Math or Acc HG 40% or SG 50% plus 2 other subjs (excluding languages + Biblical Studies) HG 4096 or SG 5096 NTV NDip Management of Training 3 yrs f/t or 4 yrs p/t M: Eng plus 2 other subjs HG 40% or SG 5096, excluding Languages + Biblical Studies PE NDip Management 4 yrs p/t M with at least 5 HG or SG subjs: 1st Language HG 40% or SG 50e6 + 2nd Language HG (F) or SG 40% PENIN NDip Management 3 yrs M with Eng 1st or Eng 2nd Language HG 50% + Math SG 40% + Acc SG 50% PTA NDip Management 3 yrs (also offered p/t) M: Preference to students with Acc, Math, Business Econ, Econ SA NDip Management 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SULTAN NDip Management 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 40% or SG 50% + Acc WITS NDip Management 3 yrs p/t M WITS NDip Management Services 3 yrs f/t or p/t M Maritime Studies Maritime Studies CAPE NDip Maritime Studies 3 yrs f/t or 4 yrs p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math + Phys Sc HG 4096 or SG 50% or N4 Math 60% NATAL NDip Maritime Studies 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%+ Math SG 40% Marketing Marketing BORDER NDip Marketing 3 yrs f/t or 4 yrs p/t M with 4 subjs (Eng HG or SG included) CAPE NDip Marketing 3 yrs f/t or 4 yrs pit M (5096 av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr FSTATE NDip Marketing 3 yrs M MANGOS NDip Marketing 3 yrs fit or 4 yrs p/t M (40% av) with 5 HG or SG subjs: Eng + Acc or Math HG 40% NATAL NDip Marketing 3 yrs f/t or 4 yrs p/t M with 4 subjs on FIG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% NTV NDip Marketing 3 yrs f/t or 4 yrs pit M with Eng + 2 other subjs HG 40% or SG 50%, excluding Languages + Biblical Studies NWEST NDip Marketing 3 yrs p/t M (40% av): Acc HG 40% or SG 5096.2 official Languages of which 1 must be Eng 93 86 Technikons . Duration Entry Require'ments Marketing Marketing PE NDip Marketing 3 yrs f/t or 4 yrs p/t (1st M with 6 subjs on NG or SG: The tuition language HG 40% or SG 50% + a 2nd yr leads to an NCert and language 2nd yr to an NHCert) PENIN NDip Marketing 3 yrs M with Eng 1st Language HG 4096 or Eng 2nd Language HG 5096. Preference to students with good passes in Math + Acc PTA NDip Marketing 3 yrs f/t or 4 yrs p/t M with Math and/or Acc SA NDip Marketing 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SAASVELD NDip Marketing 3 yrs M with HG or SG subjs only. Preference will be given to students with Acc + Business Econ or Econ SULTAN NDip Marketing 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 40% or SG 50% + Acc + Math VAAL NDip Marketing 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WITS NDip Marketing 3 yrs M Medical Orthotics & Prosthetics Medical Orthotics & Prosthetics PTA NDip Medical Orthotics & Prosthetics 3 yrs M: Phys Sc Biol SG Meteorology Meteorology PTA NDip Meteorology 3 yrs M: Math + Phys Sc HG 40% or SG 50% Mining Mining SA NDip Coal Mining 3 yrs M with Math + Phys Sc HG 40% or SG 50% with a max of 2 subjs on LG (2 Languages excluded). Employed on a mine or in a mining related career SA NDip Metalliferous Mining 3 yrs M with Math + Phys Sc HG 4096 or SG 50% with a max of 2 LG subjs (2 Languages excluded). Employed on a mine or in a mining related career SA NDip Surface Mining 3 yrs M with Math + Phys Sc HG 40% or SG 50% with a max of 2 subjs on LG (2 Languages excluded). Employed on a mine or in a mining related career WETS NDip Coal Mining 3 yrs M: Math + Phys Sc HG 40% or SG 50% WITS NDip Metalliferous Mining 3 yrs M: Math + Phys Sc HG 4096 or SG 50% Municipal Administration Municipal Administration MANGOS NDip Municipal Admin 3 yrs M with 5 HG or SG subjs, including Eng + 1 subj on HG NTV NDip Municipal Admin 3 yrs f/t or 4 yrs p/t M: Eng FIG 40% or SG 50% SA NDip Municipal Admin 3 yrs M with a max of 2 subjs on LG (2 Languages excl) Museum Technology Museum Technology SA NDip Museum Tech 3 yrs M with a max of 2 subjs on LG (2 Languages excl) Music Music NATAL NDip Light Music 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%+ an audition PTA NDip Light Music 3 yrs 99 Technikons 87 Tech Course Duration Entry Requirements Music Music PTA NDip Music Theatre 3 yrs (1 st yr leads to an M NCert and 2nd yr to an NHCert) PTA NDip Opera 3 yrs Nature Conservation Nature Conservation CAPE NDip Nature Conservation 3 yrs M (50% av) with 5 subjs on HG or SC: 1st + 2nd Language HG, 1 of which must be Eng or Afr MANGOS NDip Nature Conservation 3 yrs M with 5 HG or SG subjs: Eng HG 40%+ Biol HG PTA NDip Nature Conservation 3 yrs M SA NDip Nature Conservation 3 yrs M with a max of 2 subjs on LG (2 Languages excl): Biol SAASVELD NDip Nature Conservation 3 yrs M with HG or SG subjs only. Preference will be given to students with Math + Phys Sc or Biol Noise Control Noise Control SA NCert Noise Control 1 yr M with 2 yrs appropriate experience or a qualification in Public Health Non-Destructive Testing Non-Destructive Testing VAAL NDip Non-Destructive Testing 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Math + Phys Sc HG 40% or SG 50% Oceanography Oceanography CAPE NDip Oceanography 3 yrs M with 5 subjs on HG or SG: Math + Phys Sc HG 50% or SG 70%. 1st + 2nd Language HG, 1 of which must be Eng or Afr Open Space / Parks & Recreation Open Space / Parks & Recreation CAPE NDip Open Space & Recreation Mgt 3 yrs Myiith 5 subjs on HG or SG or a N3 Cert in Horticulture: 1st + 2nd Language HG, of which must be Eng or Afr PTA NDip Open Area & Recreation Mgt 3 yrs SA NDip Open Space & Recreation Mgt 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) Optical Dispensing Optical Dispensing CAPE NDip Optical Dispensing 3 yrs M with 5 subjs on HG or SG: Math + Phys Sc HG 40% or SG 50%. 1st + 2nd Language HG, 1 of which must be Eng or Afr Optometry Optometry WITS NDip Optometry 3 yrs M: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 50% or SG 60%. Math + Phys Sc HG 50% or SG 60% 1 c)0 Technikons Tech CoLirse Entry Requir&nent Organisation & Work Study Organisation & Work Study PTA NDip Organisation & Work Study: Civil 3 yrs (also offered p/t) M Service, Offices SA NDip Organisation & Work Study: Civil 3 yrs M with a max of 2 subjs on LG (2 Languages exd). Candidates must have access to Service, Factories, Offices or be employed in a work study environment SULTAN NDip Organisation & Work Study (Factories) 4 yrs p/t M with 4 subjs on HG or SG (official Languages included). Preference will be given to students in related employment Packaging & Printing Packaging & Printing CAPE NDip Packaging & Printing Tech 3 - 4 yrs p/t M (50% av) with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Candidates without Matric must be 23 yrs of age with 3 yrs appropriate industrial experience CAPE NDip Packaging Mgt 3 yrs pit M (50% av) with 5 subjs on HG or 5G. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Candidates without Matric may be allowed on the basis of time employed in the packaging industry CAPE NDip Printing Mgt P/t only M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr WITS NDip Packaging Mgt 3 yrs f/t or p/t M: Eng Performing Arts Technology Performing Arts Technology NATAL NDip Performing Arts Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% PTA NDip Performing Arts Tech 3 yrs (1st yr leads to an M NCert and 2nd yr to an NHCert) Pharmaceutical Marketing Pharmaceutical Marketing SA NDip Pharmaceutical Marketing 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NCert Pharmacy Sales Consultants 1 yr f/t M or recognised equivalent qualification Photography Photography ESTATE NDip Photography 3 yrs NATAL NDip Photography 3 yrs M with 4 HG or SG subjs: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% + a portfolio PE NDip Photography 3 yrs M with HG or SG subjs only 1st Language HG 40% or SG 50%. Preference to students with Phys, Sc + Math PENIN NDip Photography 3 yrs M with Eng + another official Language (1 must be on HG) PTA NDip Photography 3 yrs (1st yr leads to an M NCert and 2nd yr to an NHCert) VAAL NDip Photography 3 yrs (1st yr leads to an M with 4 subjs on HG or SG, official Languages included, 1 of which must be a NCert and 2nd yr to an language of instruction NHCert) Plastics Technology Plastics Technology CAPE NDip Plastics Tech 3 yrs f/t or p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math + Phys Sc HG 40% or SG 50% PTA NDip Plastics Tech 3 yrs M: Math + Phys Sc 101 Technikons Entry Requirements Podiatry Podiatry WITS NDip Podiatry 3 yrs M: Biol + Phys Sc HG 50% or SG 60)6 Police & Correctional Services Police & Correctional Services BORDER NDip Correctional Services Mgt 4 yrs p/t M with 4 subjs (Eng HG or SG included) PE Correctional Services Administrative CourseOnly exam for promotionM with HG or SG subjs only or Std 8(23 yrs of age + 3 yrs experience in the are currently offered Department). Students must be members of the Dept of Correctional Services SA Cert Community Policing 6 mths M with a max of 2 subjs on LG (2 Languages excl) SA Cert Police Mgt 6 mths M with a max of 2 subjs on LG (2 Languages exd). A student must be in a managerial position e.g. sergeant or higher SA NDip Correctional Services Mgt 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SA NDip Policing 3 Yrs M with a max of 2 subjs on LG (2 Languages exd) Production Management Production Management CAPE NDip Production Mgt 3 yrs M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math + Phys Sc HG 40% or SG 50% or N4 Math 60% NATAL NDip Production Mgt 4 yrs p/t M with 4 subjs on HG or 5G: Eng 1st Language HG 40% or SG 5096 orEng.2nd Language HG 6096 or SG 7096 + at least Std 8 Math PE NDip Production Mgt 3 yrs p/t M with HG or SG subjs only PTA NDip Production Mgt 3 yrs (also offered p/t) M SA NDip Production Mgt 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NDip Production Mgt 3 yrs fit or 4 yrs pit M with 4 subjs on HG or SG (official Languages and Math included). Preference to students in related employment VAAL NDip Production Mgt 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be Eng. Math SC 40% or N3 with 4 subjs, including Math 45%, Eng + another language WITS NDip Production Mgt 3 yrs M Public Management & Administration Public Management & Administration BORDER NDip Public Mgt 4 yrs p/t M with 4 subjs (Eng HG or SC included) CAPE NDip Public Mgt 3 yrs f/t or pit M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr ECAPE NDip Public Mgt & Admin 3 yrs M FSTATE NDip Public Mgt 3 yrs M. Preference to students with Business Eton + Acc MANGOS NDip Public Mgt & Admin 3 yrs M with 5 HG or SG subjs, including Eng + 1 subj on HG NATAL NDip Public Mgt &Admin 4 yrs p/t M with 4 subjs on'HCor SG:BIg Tst Lancitiacje+C 40)6Or3G-50% or Eng 2hd -Lariguage HG 6096 or SG 70% (\ITV NDip Public Mgt 3 yrs M: Eng + 2 other subjs HG 40% or SG 50%, excluding Languages + Biblical Studies NWEST NDip Public Mgt & Admin 3 yrs f/t or pit M (40% av): 2 official Languages of which 1 must be Eng - PE NCert Public Mgt: Development Mgt, Local 1 yr M with 6 subjs on HG or SG: The tuition language HG 40% or SG 50% + a 2nd Government language PENIN NDip Public Mgt Public Mgt, Local 3 Yrs M (50% av) with any 2 official Languages 5096 OR 50% av in Eng + any other subj, Government Mgt excluding Religious Studies and Agric Sc. Local Government option: Financial Acc or Math 50% PTA NDip Public Mgt 3 yrs f/t or p/t M SA NDip Public Mgt & Admin 3 yrs M with a max of 2 subjs on LG (2 Languages exd) SULTAN NDip Public Mgt 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG 50% or SG 60% Public Relations Public Relations CAPE NDip Public Relations Mgt 3 yrs fit or pit M (5096 av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr NATAL NDip Public Relations Mgt 3 yrs M with 4 subjs on HG including Eng and 1 other Language. Eng 1st or 2nd Language HG 60% PE NDip Public Relations Mgt 3 yrs f/t or 4 yrs p/t M (HG or SG subjs only) with 50% HG or 60% SG for 2 languages, which must include the language subjs to be taken in the course. A Matriculation exemption Cert will be a strong recommendation 102 Technikons 211115301110610100211 . Ni. r LL' .. . RNP ,. nOUR.CHOSEN IV MEIIIN1 , .,, , ..v. .t,% . e'.'..- ..,,,S.-1,4;,:,-v '""c 4Mtatit :.'':+i.4...... ,..' INTERNATIONALLY RECOGNISED ..,-,,,..,s4P."-:- .3 . ---;-11.: :`..' v.=411. .-...;....s, i .....,..e: , .. .,-.4 FULL-TIME COURSES r4:'6.- Dairtelin Damelin has taken many thousands of students to success in their --1. .,-.,. ,. --- Vin.811.1 .CP studies and careers. Serious, ambitious students have learnt that r,t ').4 . fiN there is no substitute for the dynamic Damelin educational 1 environment coupled with an exciting campus life. Vki..... :: 1 1 . V A ' I ' i. i ',0`.l,. 4: .. The full-time one-year Damelin Diplomas are the only qualifications cvl -...: y I 1 ''-, 41,4':. of their kind to be officially recognised and endorsed by the ",-..1.,... ., 1.; 1, ; , - ',.1',. appropriate institutes. --.....,.',... i , 1 , 0.,.... Visit your nearest Damelin Campus to find out what makes w ...a. I Damelin different - before you make one of the most important 41 x 14,. decisions of your life. { 4- ' ,,,i, -* . ENTRANCE QUALIFICATIONS 1-0' 17: °' 4-* UNISA degrees - University Entrance Matric. fi...,...,;....*'-'-'.% -..21# 1, ', All other courses - Standard 10. ....,',:,,,,- ...--w------'"---- 4"--Z-1.---,--ise.,-....= COMMENCEMENT ,-.9...- t1,.t7.:,0,,,,=a, The academic year commences 2 February 1998. :, ,y, ,x, '1`,,,," ,"9` ',1- , ° GABE ''. .., S , STUDY OFA'Ti10135"'A.-f-, ^-,4%* 4.Pvi1, N '"filliftoTION MANAGEMENT, ACCOUNTING, BCompt Bachelor of Accounting Science (UNISA) 3 years FINANCE AND BANKING CIS SA Institute of Chartered Secretaries & Administrators 3 years MBM Diploma in Marketing and Business Management 1 year BankBus Diploma in Banking and Business 1 year MARKETING, SALES BCom Bachelor of Commerce (UNISA or Oxford Brookes University) 3 years AND ADVERTISING IMM Institute of Marketing Management 3 years MBM Diploma in Marketing and Business Management 1 year HUMAN RESOURCES BCom Bachelor of Commerce (UNISA) 3 years AND INDUSTRIAL RELATIONS BA Bachelor of Arts (UNISA) 3 years HRM Diploma in Human Resource Management 1 year TRAVEL, TOURISM TravTour Diploma in Travel and Tourism 1 year AND HOSPITALITY HOM Diploma in Hotel Operations and Management 1 year FTour Frontline Tourism 1 year RetTrav Diploma in Retail Travel 6 months PUBLIC RELATIONS BA Bachelor of Arts (UNISA) 3 years AND JOURNALISM PRCom Diploma in Public Relations and Business Communication 1 year Dip PR Diploma in Public Relations 3 years Journ Diploma in Journalism 1 year . PSYCHOLOGY AND BA Bachelor of Arts (UNISA) 3 years INDUSTRIAL PSYCHOLOGY BCom Bachelor of Commerce (UNISA) 3 years (A post-graduate qualification is a further requirement for these careers) LAW BA Bachelor of Arts (UNISA) 3 years BCom Bachelor of Commerce (UNISA) (A post-graduate qualification is a further requirement for a law career) COMPUTERS AND BusComp Diploma in Business Computing 1 year INFORMATION TECHNOLOGY PCEng Diploma in PC Engineering 1 year SWS Diploma in PC Software Support 1 year SecCompDiploma/Advanced Diploma in Secretarial and Computer Skills6 mnths/1 year DigAn Diploma in Digital Publishing and Animation 1 year BCom (Informatics) 3 years BRAAMFONTEIN CAMPUS (011) 403-3126. Damelin Centre, Cnr Simmonds & De Korte Streets. RANDBURG CAMPUS (011) 791-4152. Cnr Republic Road & Hans Strijdom Drive. KRUGERSDORP (011) 660-2358. VEREENIGING (016) 455-2310 PRETORIA (012) 342-0755/322-6710. elin BENONI (011) 425-2241. A -,N4 Visitus on our Web site: http://www.damelin.com 111111121,.MI51 103 Accounting Engineering Logistics Management Accounting Air-conditioning Organization and Work Study Cost and Management Accounting Air Pollution Control (Civil Service) Government Finance Alluminium Organization and Work Study (Factories) Internal Auditing Coal Mining Organization and Work Study (Offices) Financial Information Systems Corrosion Control Production Management Taxation Engineering: Chemical Purchasing Management Tax Engineering: Civil Safety Management Engineering: Electrical Applied Marketing Communication Marketing Archival Studies Travel and Tourism Intercultural Studies Profit from Tourism Language and Tour Guide Gauteng Communication fyou want a career Police Practice Practice Library and Information Policing Practice Public Management Public Relations and not just ajob, and Development Applied Natural Government Finance Sciences you'reaTechnikon SA Local Government Agricultural Finance Management Local Government Animal Health Management Commercial Floristry nd ofperson. Public Management Horticulture Real Estate and Nature Conservation Economics Open Space tk Morethan.,70 programmes to Recreation Banking Management choose frOM Certificates, Economic Pharmaceutical Management Marketing Analysis Diplomas and Degrees Real Estate: Property Business Management Marketing Real Estate: Property Administrative TECHNIKON SA Management Financial) Practice Administrative Real Estate: Property Management (General) Valuation Business Administration Transport Economics Business Education Security Management Commercial Administration Commercial Practice Security Management Credit Management BUREAU FOR PUBLIC Management Engineering: Industrial MANAGEMENT DEVELOPMENT Small Business Management Engineering: Mechanical Winning Business Systems Fuel Technology The following non normal short courses, Metalliferous Mining certificate programmes and seminars are Correctional Services Management Mine Surveying offered: Correctional Services Management Noise Control Certificate in Local Government and Strategic Management for Correctional Refrigeration Development Management Services Managers Rock Engineering Foundation Capacity Building Programme: Professional Skills Development Stainless Steel Local Government Management Surface Mining Councillor Orientation Programme Education, Training and Development Water Care Local Government Supervisory, Middle and Biblical Studies Senior Management Development Human Resource Management Child Therapy for Professionals Programme Education Human Resource Management Conflict Resolution and Negotiation Skills Education: Management Information Technology Workshop Education: Post-school Seminar: Change Management Education: Technical Intbrmation Technology Certificate Programmes (13): Parent Enrichment Financial Information Systems Disaster Management Residential Child Care Law Theology INTEGRATED COMMUNITY Child and Youth Development Civil Law Administration BUILDING PROGRAMME Child and Youth Care Corporate Administration Youth Work Registration of Deeds BUREAU FOR BUSINESS STUDIES To obtain more information on Technikon SA's career specific programmes, contact the TSA regional office closest to you: Benoni (011) 421-6514/16, Bloemfontein (051) 430-4353, Cape Town (021) 946-1425/6, East London (0431) 43-9246, Giyani (0158) 22005, Kimberley (0531) 82-6391, Kroonstad (0562) 32053/4, Middelburg (013) 282-4115, Mmabatho (0140) 84-4185/7/90, Newcastle (03431) 24048/54, Nelspruit (013) 755-2476, Oudtshoorn (044) 272-5177, Pietermaritzburg (0331) 94-5778, Pietersburg (0152) 297-4476/7/8, Pinetown (031) 709-3737/8/9, Port Elizabeth (041) 55-5562/4/8, Potchefstroom (0148) 294-3341, Pretoria (012) 326-5950/1/2/3 or contact our main campus in Florida on (011) 471-3500. e-mail: [email protected]: http://www.trsa.ac.za SAATCHI'S+. SAATCHI RECRUITMENT ADVERTISING 5' 104 Tech Course Duration Entry Requirements Public Relations Public Relations PTA NDip Public Relations Mgt 3 yrs M: Eng + Afr preferably 60% SA NDip Public Relations 3 yrs M with a max of 2 subjs on LG (2 Languages exd) SULTAN NDip Public Relations 3 yrs M with 4 subjs on HG or SG (official Languages included): Eng HG or 60%SG + any other Language HG VAAL NDip Public Relations Mgt 3 yrs M with 6 subjs of which 4 must be on HG or SG, official Languages inducted, 1 of which must be a language of instruction WITS NDip Public Relations 3 yrs M: Eng + a 2nd Language HG Purchasing Management Purchasing Management FSTATE NDip Purchasing Mgt 3 YrS M NIV NDip Purchasing Mgt 3 yrs M: Eng + 2 other subjs HG 40% or SG 5096, excluding Languages + Biblical Studies PE NOin PUithasing Mgt 3 yr-if/t p/t (1stKwitti 6 subis oil HG or SG: The tuition language HG 4096 or SC 50% + a 2nd lang yr leads to an NCert and 2nd yr to an NHCert) PTA NDip Purchasing Mgt 3 yrs (also offered p/t) M: Math HG 40% or SG 50% SA NDip Purchasing Mgt 3 yrs.!' M With a max of 2 subjs On LG (2 Languages exd) VAAL NDip Purchasing Mgt 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WITS NDip Purchasing Mgt 3 yrs f/t or p/t Radiography Radiography FSTATE NDip Radiography Diagnostic, Nuclear 3 yrs M with Math + Phys Sc + Biol SG Medicine, Oncotherapy, Therapeutic NATAL NDip Radiography. Diagnostic, Nudear 3 yrs UM: Eng 1st language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% Medidne, Therapeutic, Ultrasound + Math + Phys Sc (them and/or Physics) and/or Biol PE NDip Radiography: Diagnostic 3 yrs M with HG or SG subjs only Math, Phys Sc + Biol PENIN NDip Radiography Diagnostic, Nudear 3 yrs MI,vith Math + 1 other scene subj (i.e. Blot or Phys Sc) HG 4096 or SG 50% Medidne, Therapeutic, Ultrasound . PTA NDip Radiography 3 yrs M: Math, Biol + Phys Sc SG 60% WITS NDip Radiography 3 yrs M: Math + Biol or Phys Sc HG 40% or SG 50% Real Estate Real Estate CAPE NDip Real Estate: Property Marketing, 3 yrs p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Property Valuation Eng or Afr NATAL NDip Property Valuation 4 yrs p/t --M7vith 4 subjs on HG or SG: Eng 1st Language KG 4096 or SG 50% or Eng 2nd Language HG 60% or SG 70%. At least Std 8 Math PTA NDip: Real Estate 3 Yrs M SA NDip Real Estate: Property Marketing,. 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages exd) Property Practice, Property Valuation. NCert and 2nd yr to an NHCert) WITS NDip Real Estate 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements) with above average language abilities: A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60% Registration of Deeds Registration of Deeds NDip Registration of Deeds: Civil Service 3 yrs M with a max of 2 subjs on LG (2 Languages exd) Retail Business Management Retail Business Management CAPE NDip Retail Business Mgt 3 yrs M (50% av) with 5 subjs on HG or SC: 1st + 2nd Language HG, 1 of which must be Eng or Afr 105. Technikons = 91 Tech Course -Entry Res uirements Retail Business Management Retail Business Management FSTATE NDip Retail Business Mgt 3 yrs NTV NDip Retail Business Mgt 3 yrs f/t or 4 yrs p/t M: Eng + 2 other subjs HG 40% or SG 50%, excluding Languages + Biblical Studies PENIN NDip Retail Business Mgt 3 yrs M with Eng 1st or Eng 2nd Language 50% + Business Econ. Preference to students with good passes in Math or Acc WITS NDip Retail Business Mgt 3 yrs Rubber Technology Rubber Technology PE NDip Rubber Tech 3 yrs f/t + p/t M with HG or SG subjs only PTA NDip Rubber Tech 3 yrs M: Math Secretarial Secretarial MANGOS NDip Secretarial: Executive Secretaries, 3 yrs M (40% av) with 5 HG or SG subjs: Eng HG 40% Office Admin NTV NDip Secretarial: Office Admin 3 yrs M (40% av): Eng HG 50%+ Afr HG 40% VAAL NDip Secretarial: Business Admin 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction: Typing or 20 wpm typing speed WITS NDip Secretarial: Executive Secretary, Office3 yrs M Administration Security / Safety Management Security / Safety Management PE NDip Safety Mgt 3 yrs p/t M with HG or SG subjs only SA NDip Safety Mgt 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SA NDip Security Mgt 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) WITS NDip Security Mgt 3 yrs M: Eng Small Business Management Small Business Management BORDER NDip Small Business Mgt 3yrs M-with 4 subjs (Eng HG or SG included) NATAL NDip Small Business Mgt 3 yrs (1st yr leads to an M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd NCert and 2nd yr to an Language HG 60% or SC 70%. At least Std 8 Math NHCert) PENIN NDip Small Business Mgt 3 yrs f/t or 4 yrs p/t M PTA NDip Small Business Mgt 3 yrs M SA NDip Small Business Mgt 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SULTAN NDip Small Business Mgt 3 yrs M with 4 subjs on HG or SC (official Languages included). Eng HG 40% or SG 50% + Acc Somatology / Beauty Technology Somatology / Beauty Technology CAPE NDip Somatology 3 yrs M (60% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Biol or Physiol + a medical cert FSTATE NDip Somatology 3 yrs M with Biol + Phys Sc NATAL NDip Somatology 3 yrs M with 4 subjs on HG or SC: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% PTA NDip Beauty Tech 3 yrs M: Biol HG 40% or SG 50% WITS NDip Somatology 3 yrs M: Biol 106 92 Entry Requirements Sport Sport BORDER NDip Sport Admin & Marketing 3 yrs M with 4 subjs (Eng HG or SG included) PE NDip Sport Admin & Marketing 3 yrs M with 6 subjs on HG or SC: The tuition language HG 40% or SG 50% + a 2nd language. Preference to students who have excelled in their chosen sport PTA NDip Sport & Exercise Tech 3 yrs M PTA NDip Sport Admin & Marketing 3 yrs M VAAL NDip Sport Admin & Marketing 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction WITS NDip Sport Admin & Marketing 3 yrs M Stainless Steel Stainless Steel SA Cert Stainless Steel 11 mths Surveying & Cartography Surveying & Cartography CAPE NDip Cartography 3 yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math HG 40% or SG 50%0R N4 Math 50% CAPE NOip Surveying 3 yrs M with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Eng or Afr. Math HG 40% or SG 50%0R N4 Math 50% MANGOS NDip Surveying 3 yrs M with 5 HG or SC subjs: Eng SG 40% plus Math + Phys Sc HG 50% or N4 (all subjs 50%) with N3 Math 50% + Eng SG 40% NATAL NDip Surveying 3 yrs M with 4 subjs on HG or SG. Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70%+ Math HG 40% or SG 50% NfTV NDip Surveying 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, induding Math 60%+ Eng PENIN NDip Land Surveying 3 yrs M with Math HG or SG OR N3 with Eng 1st or Eng 2nd Language SG + another Official Language as 2nd Language SG (both at Matric level) PTA NDip Cartography 3 yrs M: Math + Phys Sc HG 40% or SG 60% PTA NDip Surveying 3 yrs M: Math + Phys Sc HG 40% or SC 60% SA NDip Mine Surveying 3 yrs M with Math + Phys Sc HG 40% or SG 5096 with a max of 2 LG subjs (2 Languages exduded). Employed on a mine or in a mining related career SULTAN NDip Surveying 3 yrs M with Math + Physical Sc and/or Technical Drawing HG 50% or SG 60%+ English HG 40% or SG 50% WITS NDip Mine Surveying 3 YrS M: Math HG 50% or SG 60% WITS NDip Surveying 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math + Phys Sc HG 40% or SG 60%. A pass in Eng 1st Language or Eng 2nd Language HG 40% or SG 60% Taxation Taxation BORDER NDip Taxation 3 Yrs M with 4 subjs (Eng HG or SG included) FSTATE NDip Taxation 3 yrs M with Acc SA Cert Value Added Tax 1 yr SA NDip Taxation 3 yrs (1st yr leads to an M with a max of 2 subjs on LG (2 Languages excl) NCert and 2nd yr to an NHCert) SULTAN NDip Taxation 3 yrs f/t or 4 yrs p/t M with 4 subjs on HG or SG (official Languages included). Eng 1st or 2nd Language + Math HG 40% or SG 50%. Acc is an added recommendation Textile Design & Technology Textile Design & Technology CAPE NDip Textile Design 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG, 1 of which must be Eng or Afr. Submission of a portfolio NATAL NDip Textile Design 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 5096 or Eng 2nd Language HG 60% or SG 70% + a portfolio NATAL NDip Textile Tech 3 yrs M with 4 subjs on HG or SG: Eng 1st Language HG 40% or SG 50% or Eng 2nd Language HG 60% or SG 70% 107 1 Technikons 93 Entry Requirerrients Textile Design & Technology Textile Design & Technology PE NDip Textile Design 3 yrs M with HG or SG subjs only: 1st Language HG 40% or SG 5096 Preference to students with one HG subj PTA NDip Textile Design 3 yrs M SULTAN NDip Textile Design 3 yrs M with 4 subjs on HG or SG (official Languages included) Theology Theology SA B.A.(Theology) 4 yrs (After the 2nd yr M or the Technikon Cert: Biblical Studies or Theology students can obtain an Associate of Arts in Religious Studies Degree) SA Technikon Cert Biblical Studies 1 yr Students without Std 10 who wish to enter for the B.A.(Theology) Degree Programme SA Technikon Cert Theology 1 yr Students without Std 10 who wish to enter for the B.A.(Theology) Degree Programme Three-Dimensional Design Three-Dimensional Design CAPE NDip Three-Dimensional Design 3 yrs M with 5 subjs on HG or SG. 1st + 2nd Language HG,1 of wchich must be Eng or Afr. Submission of a portfolio WITS NDip Three-Dimensional Design 3 yrs M + submission of a portfolio Town & Regional Planning Town & Regional Planning CAPE NDip Town & Regional Planning 3 yrs M with S subjs on HG or SG: 1 st + 2nd Language HG, 1 of which must be Eng or Afr. Math HG 406 or SG 5096 OR N3 Math 70% or N4 Math 50% SULTAN NDip Town & Regional Planning 3 yrs M with 4 subjs on HG or SG (official Languages included): Math HG + Eng 1st Language WITS NDip Town & Regional Planning 3 yrs M or N3/N4 (contact the particular dept regarding the entrance requirements): Math HG 40% or SG 60%. A pass In Eng 1st Language or Eng 2nd Language HG 40% or SG 60% Transportation Management Transportation Management WITS NDip Transportation Mgt 3 yrs f/t or p/t M Travel & Tourism Travel & Tourism BORDER NDip Tourism Mgt 3 yrs M with 4 subjs (Eng HG or SG included) CAPE NDip Travel & Tourism 3 yrs f/t or p/t (1st yr M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be leads to an NCert and Eng or Afr 2nd yr to an NHCert) ECAPE NDip Travel & Tourism Mgt 3 yrs M ESTATE NDip Travel & Tourism 3 yrs M NATAL NDip Travel & Tourism 3 yrs (1st yr leads to an M with 4 subjs on KG or SG: Eng 1st Language FIG 40% or SG 50% or Eng 2nd NCert and 2nd yr to an Language HG 60% or SG 70% NHCert) NWEST NDip Travel & Tourism 3 yrs f/t or p/t M (40% av): 2 official Languages of which 1 must be Eng PE NDip Travel & Tourism 3 yrs M with HG or SG subjs only: 1st Language HG 40% or SG 50% or 2nd Language HG 50% or SG 60% PTA NDip Travel & Tourism 3 yrs M: 2 official Languages HG 50% or SG 60% SA NDip Travel & Tourism 3 yrs M with a max of 2 subjs on LG (2 Languages excl) SULTAN NCert Tour Guides I yr f/t M with Eng HG 40% or SG 50% SULTAN NDip Travel & Tourism 3 yrs M with 4 subjs on HG or SG (official Languages included) VAAL NDip Travel & Tourism 3 yrs M with 4 subjs on HG or SG, official Languages included, 1 of which must be a language of instruction 108 94 Technikons Tech Course Duration Entry Requirements Travel & Tourism Travel & Tourism WITS NDip Tourism Mgt 3 yrs (1 st yr leads to an M NCert and 2nd yr to an NHCert) Veterinary Technology & Animal HealthVeterinary Technology & Animal Health PTA NDi Veterin. Tech 3rs M: Math + Ph Sc SG 40% or SG 60% SA NDip Animal Health 3 yrs M with a max of 2 subjs on LC (2 Languages exd). Admisslop is restricted to animal health technicians who are p/t, permanent or contract wOdceri-of Directorates of Animal Health (Department of Agriculture) Water Care Water Care CAPE NDip Water Care 3 yrs f/t or p/t M (50% av) with 5 subjs on HG or SG: 1st + 2nd Language HG, 1 of which must be Enq or Mr. Math + Physical Sc HG 40% or SG 50% NTV NDip Water Care 3 yrs M (60% av) with Math 60% plus Eng + Phys Sc OR N4 with 5 appropriate subjs, Induding Math 60%+ Eng NWEST NDip Water Chemistry 3 yrs M: 2 official Languages of which 1 must be Eng PTA NDip Water Care 3 yrs (1st yr leads to an or N3 with! offidal languages. - NCert and 2nd yr toaw ;." NHCertl SA NCert Water Care 1 yr M: Math + Phys Sc SG SULTAN NDip Water Care 3 Yrs fit or 4 yrs p/t M with 4 subjs on HG or SG (ofRdal languages indudect Math, Phys Sc + Biol HG 40% or SG 60%+ Eng NC (F) or SC 5096 Wood Technology Wood Technology SAASVELD NDip Wood Tech 3 yrs M with HG or SG subjs only. Math + Phys Sc 109 Technikons D Instrumentation, 77 Photography, 89 Index According Dance, 75 Instrumentation & Control, 77 Plant Production Management, 70 to Field of Study Dental Assisting, 75 Intercultural Studies, 84 Plastics Technology, 89 Interior Design, 84 Podiatry, 90 A Dental Technology, 75 Development Management, 90 Internal Auditing, 80, 84 Police Management, 90 Accounting, 70 Digital Technology, 77 International Communication, 84 Policing, 90 Accounting for Attorneys, 70 Drama, 75 Inventory & Stores Management, 85 Power Engineering, 76, 77, 78 Administrative Management, 72 Dressmaking & Pattern Construction, Printing Management, 89 Adult Education, 75, 76 79 Jewellery Design & Manufacture, 85 Printmaking, 80 Agricultural Engineering, 76 Drilling Practice, 75 Journalism, 85 Process Instrumentation, 77 Agricultural Extension, 70 E L Process Instrumentation & Control, Agricultural Management, 70 77, 78 Agricultural Research, 70 Economic Management Analysis, 75 Laboratory Animal Technology, 85 Production Management, 90 Agriculture, 70 Economic Sciences, 76 Laboratory Practice, 85 Property Marketing, 91 Air Conditioning, 77 Education, 75, 76 Labour Relations, 85 Property Practice, 91 Air Pollution Control, 70 Electrical Engineering, 76, 77, 78 Land Surveying, 93 Property Valuation, 91 Ambulance & Emergency Care, 70 Electronic Communication, 76, 77, Landscape Technology, 85 Public Management, 90 Analytical Chemistry, 70, 71 78 Language Practice, 85, 86 Electronics, 77, 78 Legal Administration, 73 Public Management & Administration, Animal Health, 95 90 Animal Production, 70 Engineering, 76, 77, 78 Library & Information Studies, 86 Public Relations, 90, 91 Architectural Technology, 71 Environmental Health, 78 Light Current Engineering, 76, 77 Pulmonology, 73 Art, 76 Environmental Management, 79 Light Music, 87 Purchasing Management, 91 Art & Design, 80 Equine Studies, 79 Local Government, 90 R Avionics, 77 Exploration Geology, 81 Local Government Finance, 81, 82 Explosives Technology, 79 Local Government Management, 90 Radiography, 91 B Extraction Metallurgy, 79 Real Estate, 91 Banking, 71 M Registration of Deeds, 91 Beauty Technology, 92 F Management, 86 Reproductive Biology, 73 Biblical Studies, 94 Fashion, 79 Management of Training, 86 Residential Child Care, 73 Biomedical Technology, 71 Fashion Design & Technology, 79 Management Services, 86 Retail Business Management, 91, 92 Biotechnology, 72 Film & Video Technology, 79 Maritime Studies, 86 Rubber Technology, 92 Building, 72 Financial Accounting, 80 Marketing, 86, 87 S Business Administration, 72, 92 Financial Administration, 73 Mechanical Engineering, 76, 77, 78 Safety Management, 92 Business Communication, 72 Financial Information Systems, 80 Medical Orthotics & Prosthetics, 87 Sculpture, 80 Business Education, 72 Financial Management, 80 Metalliferous Mining, 87 Fine Art, 80 Secretarial, 92 C Metallurgical Engineering, 77, 78 Fire Service Technology, 80 Meteorology, 87 Security Management, 92 Cardiology, 73 Food & Clothing Technology, 81 Mine Surveying, 93 Small Business Management, 92 Cartography, 93 Food & Nutrition, 80, 81 Mining, 87 Somatology, 92 Catering Management, 81 Food Service Management, 80, 81 Mining Geology, 81 Sport, 93 Ceramic Design, 73 Food Technology, 81 Municipal Administration, 87 Stained Glass, 80 Ceramic Technology, 73 Forestry, 81 Museum Technology, 87 Stainless Steel, 93 Chartered Secretaries & Fuel Technology, 81 Music, 87, 88 State Accounts & Finance (Inland Administrators, 73 Music Theatre, 88 Revenue), 81, 82 Chemical Engineering, 76, 77, 78 G Surface Mining, 87 Child Care, 73 Garment & Pattern Construction, 79 N Geology, 81 Natural Sciences, 76 Surveying, 93 Chiropractics, 73 T CMI Engineering, 76, 77, 78 Geotechnology, 81 Nature Conservation, 88 Taxation, 93 Clinical & Analogue Engineering, 77 Government Finance, 81, 82 Nephrology, 73 Technical Education, 75, 76 Clinical Technology, 73 Graphic Design, 82 Neurophysiology, 73 Telecommunications, 77 Clothing, 79 H Noise Control, 88 Textile Design, 93, 94 Clothing Management, 79 Health Services Administration, 82 Non-Destructive Testing, 88 Textile Design & Technology, 79 Coal Mining, 87 Heavy Current Engineering, 76, 77 0 Textile Technology, 93 Commerce, 75, 76 High Frequency Technology, 77 Oceanography, 88 Theology, 94 Commercial Administration, 73 Home Economics, 75, 76 Office Administration, 72, 92 Three-Dimensional Design, 94 Commercial Practice, 72 Homoeopathy, 82 Office Management, 72 Tour Guiding, 94 Communications Engineering, 77 Horticulture, 82 Open Space & Recreation Tourism Management, 94, 95 Community Development Hospitality Management, 82, 83 Management, 88 Town & Regional Planning, 94 Management, 74 Hotel Management, 83 Opera, 88 Training Management, 83 Community Extension, 74 Hotel Reception, 83 Optical Dispensing, 88 Transportation Management, 94 Community Policing, 90 Housing Development & Management, Optometry, 88 Travel & Tourism, 94 Company Administration, 72 83 Organisation & Work Study, 89 Computer Engineering, 77 Human Resources Management, 83 p V Computer Programming, 84 Packaging & Printing Technology, 89 Value Added Tax, 93 Computer Systems, 74, 76 Import & Export Management, 83 Packaging Management, 89 Veterinary Technology, 95 Correctional Services, 90 Industrial Electronics, 76 Painting, 80 Video Technology, 79 Correctional Services Management, 90 Industrial Engineering, 76, 77, 78 Parks & Recreation Management, 88 Corrosion Control, 74 Industrial Instrumentation & Control, Performing Arts Technology, 89 Water Care, 95 Cost & Management Accounting, 74, 78 Personnel Administration, 73 Water Chemistry, 95 80 Industrial Relations, 83 Personnel Management, 83 Wood Production Engineering, 77 Credit Management, 75 Information Systems, 80 Pharmaceutical Marketing, 89 Wood Technology, 95 Critical Care, 73 Information Technology, 83, 84 Pharmacy Sales Consulting, 89 11 0 Technikons . Introduction One of the major decisions facing a school leaver today is whichprivate college to select. This is indeed a difficult decision as there are literally hundreds to choose from, many of which appear tooffer the same courses. School leavers should become active consumersand check the standing and credentials of colleges in the community since a poor choice could prove very costly. The following are someguidelines to use when making this decision: Many private colleges are members of APCSA (Association of Private Colleges of SouthernAfrica). This association ensures that its members subscribe to a code of ethics. Should students believe that thecollege where they are enrolled has acted unethically or made false promises to them and,provided the college is a member of APCSA, they are then at liberty write to APCSA which will undertake toinvestigate the students' complaints regarding the college concerned. APCSA stresses that although it will not enterinto litigation on a student's behalf, it will do its utmost to ensurethat the situation is resolved to the satisfaction of the parties concerned. Many colleges have also chosen to affiliate themselves with the NCBTS(National Council for Business Training Standards) which offers students the facility of sitting for a national examinationin subjects in respect of which there is no authoritative leading institute (forexample PRISA or IMM). Allowing their students to sit for external examinations is also an important measure of theteaching standards of a college. Students should make every effort to arrange a formal interview at the college of theirchoice before making a final decision. This will enable them to assess thetraining facilities offered and to ask questions about the college's teaching methodology in a face-to-face situation. For example, where studentshave elected to attend a lecture-based college, they should not base their choice purely on the informationcontained in a brochure received in the post. They should rather undertake an in-depth investigation to assesswhether this system would suit their individual needs. It is important to remember that although cost plays a role in the decision-making process,it is vitally important that students satisfy themselves that the college they choose to attend will make everyeffort to ensure that the qualifications they receive at the endof their studies will be recognised and accepted by the employer market. Although the above information may assist you to make and informed choice. youshould also seriously consider the following points: Think carefully about your career choice. Is this what you really want to do or are yousimply emulating you friends? Does the career of your choice suit your personality and fit in with your long-termplans and career goals? What job opportunities exist for you in your chosen career field? Although you maybe tempted to enter a specific field, you need to carefully consider the work opportunities that await you once youhave completed your studies. I 1 1 Private Colleges 97 How to use tititieSecti011 Course information is listed in alphabetical order by field of study Use the index of fields of study at the end of this section to trace the fieldof study in which you are interested. The index will refer you to the relevantpage number. Only courses with a duration of six months andmore are listed in this section. Private colleges often also offer shorter courses, e.g. computer courses. Prospective studentsare advised to make further enquiries at the college of their choice. 'rdTP 013REVIATIONS: General Terms Math Mathematics Mgt Management Acc Accounting mths months Admin Administration/Administrative NDip National Diploma av average p/t part-time Afr Afrikaans Phys Sc Physical Science Biol Biology Physiol Physiology B.Tech. Bachelor's Degree in Technology SA South Africa Cert Certificate SG Standard Grade Dip Diploma Std Standard Econ Economics subjs subjects Eng English UM University Matric exam examination Univ University f/t full-time yr year HG higher grade y rS years Inst Institute M Matric The Association of Private Colleges OSA Code of ethics PREAMBLE: ACCEPTANCE AND OBSERVANCE OF THIS CODE OF ETHICS IS A CONDITION OF MEMBERSHIP OF THE ASSOCIATION OF PRIVATE COLLEGES OF SOUTHERN AFRICA. THE MANAGEMENT COMMITTEE MAY, IN TERMS OF ARTICLE 7.6 OF THE CONSTITUTION, REPRIMAND. SUSPEND OR EXPEL ANY MEMBER WHO INFRINGES THE CODE OR WHO, IN ITS OPINION, CONDUCTS ITSELF IN ANY MANNER WHICH DISCREDITS THE ASSOCIATION. 1. No member shall: 1.1 wilfully or negligently fail to perform its general functions as an educationalist; 1.2 make false, misleading or unsubstantiated claims, whether by word of mouth or paid advertising or publicity; 1.3 question or make negative allegations in public as to the reputation of The Association of Private Colleges of Southern Africa or any of its committees or members; 1.4 cancel any educational or tuition course for which students have enrolled and paid, unless for good reason, and: 1.4.1should such course be cancelled by the member prior to its commencement, the member shall forthwith refund to each student affected by such cancellation the fee paid by such student. 1.4.2should such course be cancelled by the member after its commencement, the member shall forthwith refund to each student affected by such cancellation the actual amount of the fee paid by such student less appropriate pro rata amount to cover administrative fees and benefits received by the student. 1.5 postpone a course unless for good reason, and any student to whom postponement is not acceptable shall be entitled to a full refund of fees paid upon return of all issued materials that are in an acceptable condition. For the purpose of Clauses 1.4 and 1.5 above, "good reason" shall be determined by the Management Committee at its sole and absolute discretion. The Management Committee shall only be entitled to decide whether a course has been cancelled for good reason or not on receipt of a written complaint from a student who claims to have been adversely affected by such cancellation and shall allow the member concerned to defend himself against any such complaints, the Management Committee taking whatever steps it feels necessary to right any wrongs that may have been committed. 2. A member shall: 2.1 conduct its activities at all times in a lawful, ethical and professional manner consistent with the promotion and maintenance of the integrity of the field of education and training and thereby enhance the image and reputation of the Association; 2.2 when providing tuition for externally examined courses, ensure that its educational or tuition course covers the syllabus/es prescribed by the relevant external examining bodies in their publications; 2.3 provide prospective students with an outline of their course curriculum and shall inform prospective students prior to their enrolment for an educational or tuition course of all the material terms and conditions of their enrolment, including the payment of fees; 2.4 conduct itself with fairness and reasonableness inallitsdealings withitsstudents or student representatives; 2.5 ensure that all lecturers/teachers employed by it for the purpose of providingeducational training or tuition courses are suitably qualified to lecture thereon and conduct themselves during lectures in a professional manner and in accordance with educational standards and decorum; 2.6 provide suitable facilities in the tuition venue/s commensurate with generally acceptablestandards; 2.7 provide essential equipment and/or training aids and/or course material that will be sufficient for the student to cover the course syllabus in the stated time; 113 Private College' The Association of Private-Colle ofEthicslcontinued), 2.8 conduct all examinations and evaluation proceduresin the utmost good faith and in accordance with acceptable standard practiceas regards venues, invigilation and confidentiality of examinationpapers and answer scripts; 2.9 encourage students to complete the educationalor tuition course and take reasonable steps toensure that all students receive the maximum benefitfrom the course, at least commensurate with therules and regulations pertaining to examination proceduresof the examining bodies and/or those statedin 2.8 above; 2.10 notwithstanding anything mentioned above,conduct its business ethically and shallnot behave in a manner prejudicial to or likely to bring discreditupon the prestige and good reputation of the Association or its members. 114 100 Private Colleges Course Duration Entry Requirements Accounting, Auditing & Bookkeeping Accounting, Auditing & Bookkeeping Academy of Computer Bookkeeping Accounting Dip 6 mths Ability to read and write Eng and to do simple arithmetical calculations Academy of Learning Credit Controller Dip Approximately 8 M mths Academy of Learning Practical Accounting Dip Approximately 8 mths Academy of Learning Practical Bookkeeping Dip Approximately 8 mths Boston Computer Schools Dip in Computerised Accounting 3 yrs M Cajee's Commercial College & Integrity Dip in Bookkeeping 68 mths No formal requirements Business College Intec College Dip in Accountancy 1 - 2 yrs M or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Admin & Commerce (IAC) Cert in Acc 612 mths M or Inst of Business Studies OBS) Higher Dip or Inst of Certified Bookkeepers (I03) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Acc 1 - 3 yrs M or Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (AC) Dip in Cost & Mgt Acc 1 3 yrs M or Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Cost & Mgt Acc 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Certified Bookkeepers (ICB) Associate 6- 12 mths Cert level of ICB or equivalent Intec College Inst of Certified Bookkeepers (ICB) Cert 6 - 12 mths Std 8 or 16 yrs of age Intec College Inst of Certified Bookkeepers (CB) Fellowship 6- 12 mths Associate level of ICB or equivalent Intec College Intec Cert in Accounting 612 mths M or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Intec Cert in Bookkeeping & Acc 6- 12 mths Std 8 or 16 yrs of age Intec College Intec Dip in Cost & Mgt Acc 1 - 2 yrs M or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Intec Dip in Internal Auditing 4 yrs M Intec College The Chartered Accociation of Certified Accountants 3 yrs UM or equivalent (ACCA) Midrand Campus B.Compt. (UNISA) 3 yrs f/t or 4 yrs p/t UM Office Plus Business Academy Bookkeeping Dip Flexi-time study M Oxford College of Education Computerised Accounting Dip 6 mths Varsity College B.Compt. (UNISA) 3 yrs UM with 50% in at least 3 HG or SG subjs. Math HG 40% or SG 50%. UM with 50% in less than 3 HG or SG subjs will limit students to only 2 subjs in their 1st yr of study Advertising Advertising AM School of Advertising Dip in Advertising: Art Direction or Graphic Design 2 yrs AM Preliminary Cert or industry experience Bimam Business College Advertising Dip 1 yr M Intec College Inst of Marketing Mgt (IMM) (Advertising) 3 yrs M or Inst of Business Studies (IBS) Higher Dip or equivalent Art & Design Art & Design AM School of Advertising 1 yr Preliminary Cert in Art Direction & Graphic Design 1 yr M, artistic talent, portfolio + assessment interview City Varsity Dip in Multimedia Design 3 yrs f/t or pit M Design Centre BA.(Hons.)(Interior and Graphic Design) 5 yrs M with Eng + interview. Preference to students with Math, Art and Science Design Centre Cert in Higher Education: Graphic & Interior Design 2 yrs M with Eng + interview. Preference to students with Math, Art and Science Design Centre Dip in Higher Education: Graphic & Interior Design 3 yrs M with Eng + interview. Preference to students with Math, Art and Science Inscape Design College Architectural Design Dip 3 yrs Preferably M, portfolio + assessment interview Inscape Design College Graphic Design Dip 3 yrs Preferably M, portfolio + assessment interview 115 Private Colleaes 101 College Course Duration Entry Requirements Art & Design Art & Design Inscape Design College Interior Design Dip 3 yrs Preferably M, portfolio + assessment interview Inscape Design College Landscape Design Cert/Dip 6 mths p/t No requirements Ruth Prase School of Art Cert Fine Art 2 yrs Std 8 + 1 7 yrs of age + a portfolio of drawings. Students should have a good understanding of mark maldng Ruth Prowse School of Art Dip in Destktop Publishing (DTP) & Graphic Design 1 yr Std 8 + 17 yrs of age + portfolio of drawings Ruth Prowse School of Art Dip in Fine Art 4 yrs Std 8 + 17 yrs of age + a portfolio of drawings Ruth Prowse School of Art Dip in Graphic Design 3 yrs Std 8 + 17 yrs of age + portfolio of drawings Ruth Prowse School of Art Dip in jewellery Design & Craftmanship 4 yrs Std 8 + 17 yrs of age + portfolio of drawings Ruth Prowse School of Art Dip in Textile Design & Applied Design 3 yrs Std 8 + 17 yrs of age + a portfolio of drawings Ruth Prowse School of Art. Foundation Course: Art & Design 1 yr Std 8 + 17 yrs of age + a portfolio of drawings Ruth Prowse School of Art Post Dip in Graphic Design 1 yr (a Cert is Dip (3 yrs) obtained after 6 mths) The Design School SA Graphic Design Dip 3 yrs f/t or 3 - 4 yrsM with Eng + Art p/t The Design School SA Interior Decorating Dip 1 yr p/t No requirements The Design School SA Interior Design Dip 3 yrs f/t M with Eng, Math + Art Banking & Finance Banking & Finance Academy of Computer Bookkeeping Financial Mgt Dip 6 mths Ability to read and write Eng and to do simple arithmetical calculations Alberton College National Cert N4-N6 (Financial Mgt) 6 mths per N level NSC (Std 10) Damelin Education Group: Business Dip in Banking & Business 1 yr M Campus Gauteng Business College Financial Dip 1 yr M with Eng + matric subjs (preferably Math) + Std 8 Accounting IMD Education Centre Inst of Bankers (10B) M Lowveld Tertiary College Dip in Financial Mgt 3 yrs (1 st yr leads toM a Cert and 2nd yr to a Higher Cert) Mentor Business College 3 yr Dip in Credit Mgt 3 Yr P/t Preferably M + experience Mentor Business College 3 yr Dip in Financial Mgt 3 yrs p/t Preferably M + experience MSC Training Centre Financial Dip 1 yr Std 8 MSC Training Centre Financial Mgt Dip 1 yr M + Acc knowledge Varsity College B.Com.(Banking) (UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Beauty Care I Skin Care Beauty Care / Skin Care Stellenbosch Academy of Health & Skin Dip & Masters Dip of the Stellenbosch Academy of Health 2 yrs f/t M (6036 av) with 6 subjects on HG or 5G. Eng 1st Care Therapy & Skin Care Therapy Language HG 50% or Eng 2nd Language HG 6036 or SG 70%+ Bbl or Physiol 55% Business Management & AdministrationBusiness Management & Administration Academy of Learning Administrative Clerk Dip Approximately 6 Std 8 mths Academy of Learning Principles of Business Mgt Dip Approximately 8 M mths Academy of Leaming Small Business Mgt Dip Approximately 8 M mths Alberton College N3 (Business Studies) 1 yr National Intermediate Cert (NIC) Alberton College National Cert: N4 (Introductory) 6 mths NSC Alberton College National Cert N4-N6 (Business Mgt) 6 mths per N level NSC (Std 10) Alberton College National Intermediate Cert (NIC/N2) 1 year Std 7 Alberton College National Senior Cert (NSC) Acc/Admin 1 yr National Intermediate Cert (NIC) Anchor College Business Admin Dip 1 yr M with Acc Birnam Business College Dip in Business Mgt 1 yr M with Math 116 102 Private Colleges College Course Duration Entry Requirements Business Management & Administration Business Management & Administration Bimam Business College Specialised Business Dip 6 mths M (SG) Bimam Business College Specialised Business Dip (Plus) 6 mths M (SG) Damelin Education Group: Business Dip in Business Studies 1 yr Std 8, Std 9 or M Campus Damelin Education Group: Business Inst of Business Studies OM 1 yr Std 8 Campus Damelin Education Group: Business SA Inst of Mgt (SAIM) 3 yrs M or Inst of Business Studies (IBS) Campus Global School of Business Inst of Admin 81Corrunerce PAC) 2 yrs fit or 3 yrs pitM Global School of Business M.Business Admin (MBA) (Bond Univ) 19 mths p/t M + 3 yrs work experience Global School of Business- SA Inst of Mgt (SAIM) 2 yrs f/t or 3 yrs p/t Hampton Community College Business Mgt Association (BMA) Dip (Associate level) 6 mths per subj Open access policy - no formal requirements Hampton Community College Business Mgt Association (BMA) Dip (Fellow level) 6 mths per subj. Open access PolitY-1-..nalcirinal requirements Hampton Community College Business Mgt Association (BMA) Dip (Member level) 6 mths per subj Open access policy - no formal requirements Hawthorne University (SA) Associate Degree in Business Adrnin (ABA) 2 - 4 yrs SW 7 anc1.25yriof age-; .Sirs.ngeVAnt work experience OR Stc10 ii:1423.yrsof agei+ 3 yrs relevant work experience OR Sod 10- Hawthorne University (SA) B.Business Admin (B8A) 2 yrs Std 7 and 25 yrs of age + S yrs relevant work experience OR Std 8 and 23 yrs of age + 3 yrs relevant work experience OR Std 10 IMC Business School SA B.Management '12 - 18 mths 2 yrs formal edlickrtkihitiathelorleVet or equivalent work experience: 23'yri of age IMC Business School SA Executive MBA 18 - 24 mths BA or assessment of prior experiential learning + 4 yrs management experience. Access to a computer and internet compulsory 'Fleet College , Inst of Admin & Commerce PAO Cert in Business Admin .6 -12 mitts M OcIriii.dfsBUSIrieSS:Bttid14.085) SOO DIP Or lint of Certifiridllotldteglirers (1Q3)ASSoclatelf Intec College Inst of Admin & Commerce (IAC) Cert in Business Studies 612 mths M or Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert Intec College Inst of Admin & Commerce (IAC) Dip in Business Admin 1 3 yrs M or Inst of.BusinessStOdles OBS) Higher Dip or Inst of Certified Boa keepers OCB) Asiociate CertOfequtialerie:- Intec College Inst of Admin & Commerce (IAC) Dip in Business Mgt 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Business Studies OPS) Dip in Business Studies 6- 12 mills Std 8 or equivalent'',--;;,:5--'4. -- Intec College Inst of Business Studies (IBS) Higher Dip in Business 612 mths Inst of Business Studies OBS) Dip or Std 10 with 2 Studies yrs employment acceptable to the Inst Intec College Intec Cert in Business Studies 6 - 12 mths Std 8 or equivalent Intec College Intec Dip in Business Mgt 1 -2 yrs Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College- SA Inst of Mgt (SAlIv Advanced Dip in Business Mgt 1 yr SAIM Intermediate Dip or ;equivalent Intec College SA Inst of Mgt (SAIM) Dip in Business Mgt 6 12 mths Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College SA Inst of Mgt (SAIM) Intermediate Dip in Business Mgt 1 yr SAIM Dip or equivalent Lowveld Tertiary College Dip in Business Mgt 3 yrs (1st yr leads toM a Cert and 2nd yr to a Higher Cert) Mentor Business College 3 yr Dip in Business Admin 3 yrs p/t Preferably M +expedente. Mentor Business College 3 yr Dip in Office Mgt 3 Yrs P/t Preferably M + experience Mentor Business College 3 yr Dip in Supervisory Mgt 3 yrs p/t Preferably M + experience Mentor Business College 3 yr Pre-Tertiary Dip in Business Admin or Public Admin3 yrs Preferably M + experience Midrand Advanced Dip in Business %idles (London City College Yis M or the London city7College Dip in Business UK) Studiei Midrand Campus B.Business Admin (BBA) (Thames Valley UnivLondon) 3 yrs f/t or 4 yrs p/tM Midrand Campus Cert in Business Studies (London City College - UK) Births M Midrand Campus Dip in Business Mgt 1 yr M Midrand Campus Dip in Business Studies (London City College - UK) 1 yr f/t M Milpark Business School B.Business Admin (BBA) (Thames Valley UnivLondon) 3 yrs f/t UM with Math HG 40% or SG 60% or completion of a bridging course Milpark Business School Dip in Business Mgt 1 yr f/t or 2 yrs p/t M. Applicants without Manic maystill be eligible for admission; sullied icithe discretion of the Programme Co-ordinator MSC Training Centre Administrative Clerk Dip 1 yr Std 8 MSC Training Centre General Mgt Dip 1 yr M Newport University B.Business Admin (BBA) M + past academic and professional experience Newport University M.Business Admin (MBA) M + past academic and professional experience BEST COPY AVAILABLE Private Colleges Collee Course Duration Entr Requirements Business Management & Administration BusinessManagement & Administration Office Plus Business Academy Business Mgt Dip Flexi-time study M Office Plus Business Academy Office Manager Dip Flexi-time study M Oxford College of Education SA Inst of Mgt (SAIM) Diplomas in Business Mgt 3 X 1 yr Diplomas M Pax Commercial College Dip in Business Admin & Computing 1 -3 yrs M + Eng Varsity College B.Com.(General Mgt) (UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Varsity College Dip in Accounting, Admin & Mgt (CIS) 3 yrs (after the 1st &M with Math, Acc or Phys Sc HG 40% or SG 50% 2nd yrs a Cert can be obtained) Varsity College Dip in Business Mgt 1 yr (may lead to M further studies) Varsity College Dip in Mgt Principles 1 yr (may lead to M further studies - including B.Com. Working World Business Mgt Dip 7 mths f/t M or relevant business experience Working World SA Inst of Mgt (SAIM) Dip in Business Mqt 3 yrs M or relevant business experience Chartered Secretaries & AdministratorsChartered Secretaries & Administrators Dame lin Education Group: Business Inst of Chartered Secretaries & Administrators (CIS) 3 4 yrs UM Campus Global School of Business Inst of Chartered Secretaries & Administrators (CIS) 3 - 4 yrs f/t or p/t IMD Education Centre Inst of Chartered Secretaries & Administrators (CIS) 3 yrs M with Math or Acc Intec College Inst of Chartered Secretaries & Administrators (CIS) Cert 1 -2 yrs M or Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) or equivalent Intec College Inst of Chartered Secretaries & Administrators (CIS) Dip 1 2 yrs CIS Cert or equivalent (Members qualified to perform duties of an accounting officer) Pax Commercial College Inst of Chartered Secretaries & Administrators (CIS) 1 mth3 yrs M + Eng Courses Child Care Child Care Prime Care Training Prime Care Training Child Care Course 6 mths f/t or 11 Matric is an advantage but not a necessity mths p/t Commerce & Economics Commerce & Economics Midrand Campus B.Com. (UNISA) 3 yrs f/t or 4 yrs p/tUM Company Secretaries Company Secretaries Intec College Inst of Admin & Commerce (IAC) Dip in Company 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Do Secretaryship or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Company 1 -3 yrs M or Inst of Business Studies (IBS) Higher Dip or Secretaryship Inst of Certified Bookkeepers (CB) Assodate Cert or equivalent Intec College Intec Dip in Company Secretaryship 1 - 2 yrs M or Inst of Business Studies (IBS) Higher Dip or equivalent College Course Duration Entry Requirements Computer Studies / Information Computer Studies / Information Technology Technology Academy of Learning Computer Clerk 68 mths M (SG) Academy of Learning Data Capture Dip Approximately 6 Std 8 mths Academy of Learning Software Support Dip Approximately 8 mths Birnam Business College Computer Technician Dip 6 mths Intermediate Computer Dip. Matric Math + Phys Sc Bimam Business College Dip in Advanced Comprehensive Computers 1 yr M Bimam Business College Dip in Comprehensive Computers 6 mths M Bimam Business College Dip in Computer Graphics 1 yr M Birnam Business College Dip in Computer Programming 1 yr M with Math + Phys Sc Boston Computer Schools Dip in Business Computing / Business Mgt 3 yrs M Boston Computer Schools Dip in Information Technology / Business Mgt 3 yrs M. Must pass an aptitude test Boston Computer Schools Dip in PC Support / Business Mgt 3 yrs M Boston Computer Schools PC Specialist Dip I yr M with Eng Careers 2000 Business College Dip in Advanced Business Computing 1 yr f/t M Careers 2000 Business College Dip in Advanced Personal Computing 6 mths f/t M Careers 2000 Business College Dip in Personal Computing 6 mths p/t M Computer Training Institute (CT1) Dip in Advanced Field Service Technology 8 mths f/t or 16 M (SG). Preferably Math or Science or Computer mths p/t (2 eveningsSc per week of 3 hours each) Computer Training Institute (CT!) Dip in Cobol Programming (entry level) 4 - 6 rriths f/t or 8 M (SG). Preferably Math, Science or Computer Sc mths p/t (2 evenings per week of 3 hours each) Computer Training Institute (C71) Dip in Computer Science 1 yr f/t or 24 mths M (SG). Preferably Math or Science or Computer p/t (2 evenings per Sc week of 3 hours each) Computer Training Institute (CTO Dip in Field Service Technology 6 mths f/t or 12 M (SG). Preferably Math or Science or Computer mths p/t (2 evenings Sc per week of 3 hours each) Computer Training Institute (CT 1) Dip in Programming (C++, Visual Basic, Cobol, Pascal, 8 mths f/t or 16 M (SG). Preferably Math or Science or Computer Delphi) mths p/t (2 evenings Sc per week of 3 hours each) Dame lin Education Group: Computer Dip in Business Computing 1 yr M School Dame lin Education Group: Computer Dip in Computers & Animation 1 yr M School Dame lin Education Group; Computer. Dip in K Engineering 1.yr M School . ,. Damelin Education Group: Computer PC Software Support I yr M School Durbanville College Dip in Computer Programming & Information Systems 1 yr M with Afr 1st or 2nd Language HG or SG + Eng 1st or 2nd Language HG or SG (1 of the Languages must be on HG) + Math HG or SG + aptitude test Gauteng Business College Computer Dip 1 yr M with Eng + matric subjs (preferably Math) IMD Education Centre B.Tech. Degree (Information Technology) (Technikon SA)4 yrs M with Math or Computer Sc Intec College A+ Certification 612 mths M Intec College Certified Novell Administrator (CNA) 1 yr M Intec College Certified Novell Engineer (CNE) 1 yr M Intec College Microsoft Certified Systems Engineer wag 1 yr M Intec College PC Support Specialist 1 yr M K Commercial College Computer Dip 7 mths No requirements Mentor Business College 3 yr Dip in Information Mgt 3 yrs p/t Preferably M + experience Midrand Campus Cert in Computers 6 mths M Midrand Campus Dip in Datametrics 2 yrs UM with Math HG 40% or SG 50% Milpark Business School Dip or Advanced Dip in End User Computing 6 mths each M. Applicants without Matric may still be eligible for admission, subject to the discretion of the Programme Co-ordinator MSC Training Centre Dip in End User Computing 1 yr Std 8 Office Plus Business Academy Business Computing Dip Flexi-time study M Oxford College of Education Business Computing Dip 2 yrs f/t M Oxford College of Education Computer Science Dip 2 yrs f/t Matric Math 50% 119 Private Colleges 105 College 'Course Duiration Entry Requirements Computer Studies / Information Computer Studies / Information Technology Technology Oxford College of Education Programming Dip 1 yr p/t Pax Commercial College Diplomas in Computers (1 - 6 mths) 1 - 6 mths M + Eng Varsity College B.Com.(Computers) (UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Drama & Dance Drama & Dance City Varsity Dip in Drama & Presentation (for Radio, Film & Television) 2 - 3 yrs M SA Guild of Speech & Drama TeachersLicentiate Examination in Speech & Drama 4 yrs M + Level I Language for the 4th year Waterfront Theatre School Accociate & Licenciate Teaching Dip 2 - 4 yrs M with Eng HG 5036 or 2nd Language SG 70%. Elementary Dance (any syllabus) Draughting Draughting Inscape Design College Architectural Draughting Cert/Dip Cert: 6 mths p/t. Dip: No requirements 1 yr p/t Education Education Corporate College International Assessor Award for Competency Based Assessment 3 - 6 mths M (SG) Corporate College International Cert in Further & Adult Education 6 mths 1 yr M (SG) with Eng + Math Corporate College International Initial Cert in Teaching Basic Skills 6 rnths - 1 yr M (SG) with Eng + Math Newport University B.Sc.(Education) M + past academic and professional experience Newport University M.Education M + past academic and professional experience Train-A-Child College Dip in Pre-School Education 1 yr f/t M Electrical / Electronics Electrical / Electronics Dame lin Education Group: Technical Dip in Electronics & Technology M + at least Std 8 Math' : - Learn-A-Trade Electrical / Electronic Technician 1 yr Std 8 with Science. Ability to work with one's hands Learn-A-Trade Electrical/Electmrecs/PLCTectmlcim 2 years Good Std 8 with Science. Ability to work with one's hands Entrepreneurship Entrepreneurship Anchor College Business Entrepreneurial Dip 1 yr M with general subjs Durbanville College Dip in Entrepreneurship & Small Business Mgt 1 yr M with Afr 1 st or 2nd Language HG or SG + Eng 1st or 2nd Language HG or SG 0 of the Languages must be on FIG) Fashion & Clothing Fashion & Clothing Bimam Business College Fashion Marketing & Design with IMM Retail Marketing 1 yr M with Math Cert Bimam Business College Fashion Marketing & Mgt Dip 1 yr 106 190 Private Colleges > > > > > > > > > v EDUCAT I ON This newly listed division of the ADG R OCal U P is comprised of private colleges that offer tuition for certificates, diplomas, degrees, honours degrees and masters degrees covering a broad spectrum of tertiary education V V rra r.Gr. rAmpus Specialising in computer careers Tel: 403-3820 V IMM, IPM, CIS, TECHNIKON SA degrees Tel: 403-3680 ., ; GLOBAL r' SCHOOL OF BUSINESS MBA degrees, IMM, CIS, SAIM, PRISA diplomas Tel: 403-8806 UNISA degrees, IMM, CIS and other diplomas Tel: 886-9077 Rosebank College IMM, SAIM, PR, TRAVEL, SECRETARIAL, COMPUTERS, IBS Tel: 886-9860 V 7 .143 11 1,- '7 there: akeitout anna -ge "I want an education that prepares me for the job I've got to do. Look, I'll still need books, but what I really need is an education that takes me places. Out of the classroom and into the workplace, for instance. Where I'll get the 'hands-on' experience that's geared for the real world. That's why I'm studying at Wits Technikon. I mean, they've got a serious range of programmes. And now they've even got degrees as well. So if you want to make it out there, get an education with the right attitude. I can relate to that." ART, DESIGN & ARCHITECTURE BUSINESS MANAGEMENT ENGINEERING HEALTH & BIOTECHNOLOGY MINING & METALLURGY . Abalanced education that takes you places. FOR PROGRAMME DETAILS CONTACT PO BOX 1701 1 DOORNFONTEIN2028. TEL: (011) 406-2221 We recognise-a proud past tradition, and in order to-meet the dynamic needs of the present, we continually keep in touch with and invest in the future! In an exciting environment, we equip our students with social, academic and technological skills to help them build a firm future and to guide our developing country into the 21st century! .-A centre of excellence forcareer education OUR SCHOOLS School of Business frastructured for applied research School of Electrical and Mechanical Engineering, Responding to the needs of a society Information-Technology, Mathematics and Statistics School of Education, Secretarial Studies, Languages PO Box 1906 and Communication Bellville 7535 School of Architecture, Building and Civil Engineering 0 School of Art and Design South Africa School of Science- Tel: +27 21 959-6911 Fax: +27 21 951-5617r `o,,,.ftee is ah e College Cour Se DuratiOn Entry Requirements Fashion & Clothing Fashion & Clothing Design 3 School of Fashion Fashion & Clothing Design Dip 2 yrs f/t (A Higher M with Art, Math ± Technical Drawing Dip can be obtained after additional f/t study of 1 yr) Haute Couture School of Fashion Dip in Fashion Design 3 yrs (A Ceti can be M Design obtained after the 1st Yr) Lindiwe Kuzwayo Academy of FashionCert in Fashion Design & Clothing Production 1 yr fit Std 8 Design Lindiwe Kuzwayo Academy of FashionDip in Fashion Design & Clothing Production 2 yrs f/t Std 8 Design School of Fashion, Dressmaking & Dip in Fashion Designing & Dressmaking 2 yrs (A Cert can be Std 8 with Eng 4096 Design obtained after the 1st yr) Film & Video Film & Video City Varsity Dip in Animation for Film & Television 2 yrs f/t or pit City Varsity Dip in Television & Film Production Techniques 3 yrs f/t or p/t Fire Service Fire Service Intec College Course in Fire Control & Prevention 18 mths Std 8 or N1 Intec College Inst of Fire Engineers (IFE) Graduate Examination 1 yr Std 8 Intec College Inst of Fire Engineers (IFE) Membership Exam 3 yrs IFE Graduateship Intec College Inst of Fire Engineers (IFE) Preliminary Cert 1 yr Std 8 Health & Fitness Health & Fitness Exercise Teachers Academy Aerobic Instructor Course 6 mths p/t Fluency in Eng (preferably M) Exercise Teachers Academy Dip in Group Fitness Leadership 6 mths M ± fluency in Enq Exercise Teachers Academy Dip Outdoor Adventure Guide 6 mths M + fluency in Eng Exercise Teachers Academy Lifestyle Counsellor Course 1 yr p/t Aerobic Instructor or Sports Fitness Trainer or Personal Fitness Trainer Exercise Teachers Academy Personal Fitness Trainer Course 6 mths p/t Fluency in Eng (preferably M) Exercise Teachers Academy Sports Fitness Trainer Course 6 mths p/t Fluency in Eng (preferably M) Hotel & Catering Hotel & Catering Bimam Business College Hotel Food & Beverage Service Dip 6 mths Birnam Business College Hotel Mgt Dip I yr Bimam Business College Practical Chef Dip 6 mths Damelin Education Group: Business Dip in Hotel Operations & Mgt 1 yr Campus Durbanville College Dip in Restaurant Mgt & Organisation 1 yr M with Afr 1st or 2nd Language HG or SG + Eng 1st or 2nd Language HG or SG (1 of the Languages must be on HG) Mentor Business College 1 yr Hotel & Tourism Mgt Dip 1 yr f/t Mentor Business College 3 yr Dip in Hotel & Tourism Mgt 3 yrs p/t Preferably M + experience Varsity College Dip in Hotel Mgt 1 yr (practical work included) 123 i Private Colleaes 107 Collee Course Duration Entry Requirements Human Resources / Personnel Human Resources / Personnel Management Management Alberton College National Cert: N4-N6 (Human Resources Mgt) 6 mths per N level NSC (Std 10) Dame lin Education Group: Business Human Resource Mgt Dip 1 yr Campus IMC Business School SA M.Phil.(Human Resources Mgt) 18 mths First degree or assessment of prior experiential learning + 4 yrs management experience IMD Education Centre B.Tech. Degree in Personnel Mgt 1 yr Inst of Personnel Management Dip or NDip in Personnel Management IMD Education Centre Inst of Personnel Mgt (IPM) Dip 3 yrs M Institute of Personnel Management Inst of Personnel Mgt (IPM) Dip in Personnel Mgt 3 yrs M Intec College Inst of Admin & Commerce (IAC) Cert in Personnel Mgt 6 - 12 mths Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Personnel Mgt 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Intec Dip in Personnel Mgt 1 -2 yrs M or Inst of Business Studies OBS) Higher Dip or equivalent Lowveld Tertiary College Dip in Human Resource Mgt 3 yrs (1st yr leads toM a Cert and 2nd yr to a Higher Cert) Mentor Business College 1 yr Personnel Mgt & Public Relations Dip 1 yr f/t M Mentor Business College 3 yr Dip in Personnel Mgt 3 Yrs P/t Preferably M + experience Midrand Campus Human Resources Dip 1 yr f/t or 2 yrs p/t M Milpark Business School Dip in Human Resource Mgt 1 yr f/t or 2 yrs p/t M. Applicants without Matric may still be eligible for admission, subject to the discretion of the Programme Co-ordinator MSC Training Centre Human Resources Mgt Dip 1 Yr M Varsity College B.A.(Personnel / Human Resources) (UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Varsity College B.Com.(Personnel / Human Resources) (UNISA) 3 Yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Working World Inst of Personnel Mgt (IPM) Dip 3 yrs f/t M. Students without Matric can contact the College for an interview Human Sciences Human Sciences Midrand Campus BA (UNISA) 3 yrs UM (Matric Exemption) Newport University BA(Human Behaviour) M + past academic and professional experience Industrial Relations Industrial Relations Intec College Inst of Admin & Commerce (IAC) Cert in Industrial 6 -12 mths Std 10, Inst of Business Studies OBS) Higher Dip Relations or Inst of Certified Bookkeepers (CB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Industrial 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Dip Relations or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Intec Cert in Industrial Relations 6- 12 mths M or Inst of Business Studies OBS) Higher Dip or equivalent Journalism Journalism Birnam Business College Advanced Journalism Dip 1 yr M with Eng HG 60% Bimam Business College Intermediate journalism Dip 6 mths M with Eng HG 60% Boston Computer Schools Dip in Journalism 1 yr M City Varsity Dip in Journalism 1 yr f/t or p/t M Dame lin Education Group: Business Dip in Journalism 1 yr M Campus 124 108 Private Colleges Co Hee Course Duration Entry Requirements Journalism Journalism Varsity College BA(Joumalism)(UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Languages Languages Cajee's Commercial College & Integrity Combined Courses: English Individual course M (SG) or Std 8 for simpler courses Business College settings with each student Corporate College International Teaching English to Speakers of other Languages 6 mths 1 yr M (SG) with Eng + Math Law Law Intec College Dip in Law & Taxation 1 Yr UM with at least 5 subjs or the General Cert of Education with 2 subjs at A level and 3 at 0 level with Eng + Math Midrand Campus B.luris 3 yrs UM Midrand Campus B.Proc. (UNISA) 4 yrs UM (Matric Exemption) Midrand Campus Dip. luris 3 yrs M with at least 5 subjs on HG or SG Varsity College B.A.(Law) (UNISA) 3 yrs UM with 50%in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Varsity College B.Com.(Law) (UNISA) 3 yrs UM with 50% in at least 3 HG or SG subjs. UM with 50% in less than 3 HG or SG subjs will limit students to only 2 subjs in their 1st yr of study Local Management & Administration Local Management & Administration Mentor Business College 3 yr Dip in Local Mgt & Admin 3 yrs p/t Preferably M + experience Maintenance Management Maintenance Management Mentor Business College 3 yr Dip in Maintenance Mgt 3 yrs p/t Preferably M + experience Marketing & Sales Marketing & Sales Academy of Learning Retail Marketing Mgt Dip Approximately 8 mths Alberton College National Cert: N4-N6 (Marketing Mgt) 6 mths per N level NSC (Std 10) Bimam Business College Inst of Marketing Mgt (IMM) Dip in Retail Marketing 1 yr M with Math Bimam Business College Marketing & Business Mgt Dip 1 yr M with Math Damelin Education Group: Business Inst of Marketing Mgt (IMM) 3 yrs Campus Damelin Education Group: Business Marketing & Business Mgt Dip 1 yr Campus Damelin Education Group: Degree B.Com.(Marketing & Business Mgt) 3 yrs M + Eng + Eng proficiency test Campus & Oxford Brookes University (UK) Global School of Business Inst of Marketing Mgt (IMM) Graduate Dip in Marketing 2 yrs f/t or 3 yrs p/t M Global School of Business M.Business Admin (MBA) (Strategic Marketing) (Hull Univ) 2 yrs p/t M + 3 yrs work experience Inst of Marketing Management Dip or NDip in IMD Education Centre B.Tech. Degree in Marketing 1 yr Marketing IMD Education Centre Inst of Marketing Mgt (IMM) Dip 3 yrs M M or Inst of Business Studies (IBS) Higher Dip or Intec College Dip in Marketing Mgt 3 Yrs equivalent 12 5 Private Colleaes 109 CoHee .:Course Duration Entry Requirements Marketing & Sales Marketing & Sales Intec College Inst of Admin & Commerce (IAC) Cert in Marketing Mgt 6 12 mths Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Cert in Sales Mgt 6 - 12 mths Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Marketing Mgt 1 3 yrs Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Marketing Mgt (IMM) Cert in Marketing 1 yr Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Marketing Mgt (IMM) Cert in Personal Selling 1 yr Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Marketing Mgt (IMM) Cert in Retail Marketing I yr Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Marketing Mgt (IMM) Cert in Sales Mgt 1 yr Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Marketing Mgt (IMM) Graduate Dip in Marketing 3 yrs M or Inst of Business Studies OBS) Higher Dip or equivalent Intec College Inst of Marketing Mgt (IMM) Graduate Dip in Marketing 3 yrs Std 10 or Inst of Business Studies (IBS) Higher Research Dip or equivalent Intec College Intec Cert in Marketing 6 - 12 mths Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Intec Cert in Sales 612 mths M or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Intec Dip in Marketing 1 - 3 yrs Std 10 or Inst of Business Studies (IBS) Higher Dip or equivalent Lowveld Tertiary College Dip in Marketing Mgt 3 yrs (I st yr leads to M a Cert and 2nd yr to a Higher Cert) Mentor Business College 1 yr Business & Marketing Mgt Dip 1 yr f/t M Mentor Business College 3 yr Dip in Marketing & Sales Mgt 3 yrs p/t Preferably M + experience Midrand Campus Dip in Marketing & Advertising 1 yr M Milpark Business School Dip in Marketing & Advertising 1 yr f/t or 2 yrs p/t M. Applicants without Matric may still be eligible for admission, subject to the discretion of the Programme Co-ordinator MSC Training Centre Marketing Mgt Dip 1 yr M Varsity College B.A.(Marketing) (UNISA) 3 yrs UM with 50% in 3 HG or SG subjs. UM with 50% in less than 3 subjs will limit students to only 2 subjs in their 1st yr of study Varsity College B.Com.(Marketing Mgt) (UNISA) 3 yrs UM with 50% in 314C or SG subjs. UM witti 50% in less than 3 subjs will limit students to Only 2 subjs in their 1st yr of study Varsity College Graduate Dip in Marketing 3 yrs (a Cert can be M obtained after the 1st and 2nd yrs and a Dip in Business Mgt & Marketing can be obtained after the 1st Yr) Working World Inst of Marketing Mgt (IMM) Graduate Dip in Marketing 3 yrs M or relevant business experience Natural Sciences Natural Sciences Midrand Campus B.Sc. 3 yrs UM with Math HG 40% or SG 50%. Math option: Math HG 50%. Phys Sc option: Phys Sc HG 50%. Botany or Zoology options: Phys Sc or Biol Photography Photography Ruth Prowse School of Art Dip in Photography 3 yrs Std 8 + 17 yrs of age. Matric will be an advantage 126 110 Private Colleges College Course Duration Entry Requirements Production & Operations Management Production & Operations Management Mentor Business College 3 yr Dip in Production & Operations Mgt 3 yrs p/t Preferably M + experience Project Management Project Management Mentor Business College 3 yr Dip in Project Mgt 3 yrs p/t Preferably M + experience Property Management Property Management Mentor Business College 3 yr Dip in Property Mgt 3 yrs p/t Preferably M + experience Public Relations Public Relations Academy of Learning General Business Practice Public Relations Dip Approximately 8 M mths Albertan College National Cert: N4-N6 (Public Relations) 6 mths per N level NSC (Std 10) Bimam Business College Dip in Public Relations 1 yr M Boston Computer Schools Dip in Public Relations 3 yrs M Dame lin Education Group: Business Public Relations & Business Communications 1 yr M Campus Dame lin Education Group: Campus & Dip in Public Relations 3 yrs M + Eng PRISA Global School of Business Business Skills in PR & Communications 1 yr f/t Std 8 Global School of Business PRISA 3 yr Dip in Public Relations 2 yrs f/t or 3 yrs p/t M Intec College Inst of Admin & Commerce (IAC) Cert in Public Relations6 - 12 mths Std 10, Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Inst of Admin & Commerce (IAC) Dip in Public Relations 1 3 yrs M or Inst of Business Studies (IBS) Higher Dip or Inst of Certified Bookkeepers (ICB) Associate Cert or equivalent Intec College Intec Cert in Public Relations 6 - 12 mths Std 10 or Inst of Business Studies OBS) Higher Dip or equivalent Mentor Business College 3 yr Dip in Corporate Relations & Communications 3 Yrs P/t Preferably M + experience Midrand Campus Dip in Public Relations 1 yr f/t or 2 yrs p/t M Milpark Business School Dip in Public Relations 1 yr f/t or 2 yrs p/t M. Applicants without Matric may still be eligible for admission, subject to the discretion of the Programme Co-ordinator MSC Training Centre Public Relations Career Dip 1 Yr Std 8 Varsity College B.A(Public Relations & Advertising) (UNISA) 3 yrs UM with 50% in at least 3 HG or SG subjs. UM with 50% in less than 3 HG or SG subjs will limit students to only 2 subjs in their 1st yr of study Varsity College Dip in Public Relations & Mgt Principles Yr M Purchasing & Inventory Management Purchasing & Inventory Management Mentor Business College 3 yr Dip in Purchasing & Inventory Mgt 3 yrs p/t Preferably M + experience Quality Management Quality Management Mentor Business College 3 yr Dip in Quality Mgt 3 Yrs P/t Preferably M + experience Retail Management Retail Management Mentor Business College 3 yr Dip in Retail Mgt 3 yrs P/t Preferably M + experience 127 Drivato r,nlItarspc 111 Colle.e Course Duration Entry Requirements Secretarial Secretarial Academy of Computer Bookkeeping Executive Secretarial Course 6 mths Ability to read and write Eng and to do simple arithmetical calculations Academy of Computer Bookkeeping Secretarial Dip 6 mths Ability to read and write Eng and to do simple arithmetical calculations Academy of Learning Executive Secretary Marketing Dip Approximately 8 M mths Academy of Learning Executive Secretary Personal Assistant Dip Approximately 8 mths Academy of Learning Executive Secretary Public Relations Dip Approximately 8 M mths Academy of Learning General Secretary Dip Approximately 8 Std 8 mths Academy of Learning Girl Friday Dip Approximately 6 Std 8 mths Academy of Learning Legal Secretary Dip Approximately 8 mths Academy of Learning Receptionist Dip Approximately 68 Std 8 mths Alberton College National Cert: N4-N6 (Legal Secretary) 6 mths per N level NSC (Std 10) Alberton College National Cert: N4-N6 (Management Assistant) 6 mths per N level NSC (Std 10) Alberton College National Cert: N4-N6 (Medical Secretary) 6 mths per N level NSC (Std 10) Alberton College National Senior Cert (NSC) Secretarial 1 year National Intermediate Cert Anchor College Executive Secretarial Dip 1 yr M with general subjs Anchor College Girl Friday 6 and a half mths Std 8 with general subjs Anchor College Legal Secretarial Dip 1 yr M with general subjs Anchor College Professional Secretary 9 mths Std 8 with general subjs Birnam Business College Executive Personal Assistant 1 yr M Bimam Business College Executive Personal Assistant (Plus) 1 Yr M Bimam Business College Medical Personal Assistant 6 mths M Boston Computer Schools Electronic Secretarial Dip (PA) 1 yr M Cajee's Commercial College & IntegrityCombined Courses: Special Secretarial Individual course M (SG) or Std 8 for simpler courses Business College settings with each student Careers 2000 Business College Dip in Executive Secretarial Studies 1 yr f/t M Careers 2000 Business College Dip in Secretarial Studies 6 mths p/t M Dame lin Education Group: Business Dip in Secretarial & Computer Skills 6 mths or 1 yr M Campus Durbanville College Dip in Secretarial Studies 1 yr M with Afr 1st or 2nd Language HG or SG + Eng 1st or 2nd Language HG or SG (1 of the Languages must be on HG) Gauteng Business College Executive Secretarial Dip 1 yr M with Eng + matric subjs (preferably Math) Gauteng Business College Receptionist (Girl Friday) Dip 1 yr M with Eng + matric subjs (preferably Math) Inter College Dip for Executive Secretaries 3 yrs M or Inst of Business Studies S) Higher Dip or equivalent Intec College Dip in Secretaryship 3 yrs M or Inst of Business Studies (IBS) Higher Dip or equivalent Intec College Inst of Admin & Commerce (IAC) Dip for Executive Determined by the M. Exemption may be granted to those holding Assistant student an approved educational cert or relevant business experience Integrity Business College Dip in Secretarial Studies 1 yr M (SG) + Eng K Commercial College Executive Secretarial Dip 1 yr No requirements K Commercial College Private Secretan/s Dip 9 mths No requirements Kelly- Greenoaks Legal Secretarial Dip 1 yr f/t M Kelly-Greenoaks Public Relations Secretarial Dip 1 yr f/t M Kelly-Greenoaks Secretarial / Personal Assistant Course 6 mths f/t M Kelly-Greenoaks Secretarial and Business Course 6 mths f/t M Kelly-Greenoaks Travel Secretary Dip 1 yr f/t M Keyboards Secretarial Project 1 yr Secretarial Dip 1 yr M Maritzburg Business College Secretarial Course 1 yr No requirements Maritzburg Business College Single Subject Secretarial Cert (Legal) 1 yr No formal requirements Mentor Business College 1 yr Office & Secretarial Mgt Dip 1 yr M Montrose Business College Executive Secretarial Dip 1 yr Eng Montrose Business College Paralegal Executive Secretarial Dip 1 yr Eng MSC Training Centre Financial Secretarial Dip 1 yr Std 8 MSC Training Centre General Secretarial Dip 1 yr Std 8 Office Plus Business Academy Secretarial Dip Flexi-time study M Oxford College of Education Executive Secretarial Dip 1 yr f/t M 98 112 Private Colleaes College Course Duration Entry Requirements Secretarial Secretarial Oxford College of Education Secretarial Dip 1 yr f/t Std 8 St Mar Vs DSG Outreach Business Lifeskills Course subsidized by sponsorship) 12 mths (1 mth Ability to communicate in Eng. Numeracy and practical training) Eng Language entrance test plus interview. Varsity College Dip for the Executive Secretary & Personal Assistant 1 yr (incorporating Public Relations & Mgt Principles) Working World Executive Assistant Dip 9 mths f/t M. Students without Mark can contact the College for an interview Working World Working World Dip 8 mths f/t M. Students without Matric can contact the College for an interview Security Management Security Management Mentor Business College 3 yr Dip in Security Mgt 3 yrs p/t Preferably M + experience Social Sciences Social Sciences Mid rand Campus B.A.(Social Sciences) 4 yrs UM (Manic Exemption) UM with 5096 in 3 HG or SC subjs. UM with 50% Varsity College BA(Sodal Science) (UNISA) 3 yrs in less than' 3 subjs will limit students to only 2 subjs in their 1 st yr of study Sound Engineering Sound Engineering City Varsity Dip in Sound Recording Engineering 3 yrs f/t or p/t Sport Management Sport Management Dame lin Education Group: Business Dip in Ocean Sailing Mgt 6 mths Campus Dame lin Education Group: Business Dip in Sport & Event Mgt 1 yr Campus Varsity College Dip in Sports & Health Club Mqt 1 yr Stage Craft Stage Craft City Varsity Dip in Special Effects, Decor Painting & Make Up 3 yrs f/t or p/t Stock & Stores Stock & Stores Academy of Learning Stock Controller Dip Approximately 8 Std 8 mths Training Management Training Management College of Progressive Learning The ABET Trainers Cert: Progressive Method of Learning10 days intense. 1 yr Std 8 with Eng or Afr + Science practical with monitoring 129 Private Colleges 113 College Course Duration Entry Requirements Travel & Tourism Travel & Tourism Academy of Learning Tourism Information Officer Approximately 68 M mths Academy of Learning Travel & Tourism Dip Approximately 8 M with Geography mths Bimam Business College Dip in Advanced Travel 1 yr Boston Computer Schools Dip in Travel & Tourism I yr Dame lin Education Group: Business Dip in Travel & Tourism 1 yr Campus Dame lin Education Group: School of Dip in Frontline Tourism 1 yr M + Eng Travel & Tourism Durbanville College Dip in Tourism & Public Relations 1 yr M with Afr 1st or 2nd Language HG or SG + Eng 1st or 2nd Language HG or SG (1 of the Languages must be on HG) MD Education Centre B.Tech. Degree in Travel & Tourism (Technikon SA) 4 yrs M Pax Commercial College Dip in Travel & Tourism 1 2 yrs M + Eng Travel Training Institute Cert of Travel Agency Competence (COTAC I) 6 mths M + Eng Varsity College Dip in Travel & Tourism (incorporating Public Relations & 1 yr M Mgt Principles) Working World Dip in Travel & Tourism 8 mths fIt M. Students without Matric can contact the College for an interview University Access University Access Midrand Campus Cambridge University A Levels 1 yr M or or Std 9 or 0 Levels. Special cases will be considered Midrand Campus Cambridge University IGCSE 6 mths No formal requirements 1 0 114 Private Colleges Computer Technology, 105 Human Sciences, 108 Public Administration, 103 Index According Public Relations, 108, 111, 114 Computerised Accounting, 101 1 Computers & Animation, 105 Industrial Relations, 108 Public Relations Secretary, 112 to Field of Study Corporate Relations, 111 Information Management, 105 Purchasing & Inventory Management, A Cost & Management Accounting, 101 Information Technology, 105 111 Accounting, 101, 102, 104 Credit Control, 101 Interior Decorating, 102 Q Administration & Commerce, 103 Credit Management, 102 Interior Design, 101, 102 Quality Management, 111 Administrative, 102, 103, 104 D Internal Auditing, 101 R Adult Education, 106 Datarnetrics, 105 Receptionist, 112 Adventure Guide, 107 Decor Painting, 113 jewellery Design, 102 Restaurant Management, 107 Advertising, 101, 110, 111 Design, 101, 102 journalism, 108, 109 Retail Management, 111 Aerobic Instruction, 107 Desktop Publishing, 102 Retail Marketing, 109, 110 Animation for Film & Television, 107 L Drama & Dance, 106 Retail Marketing Management, 109 Architectural Design, 101 Landscape Design, 102 Drama & Presentation, 106 Law, 109 S Architectural Draughting, 106 Dressmaking, 107 Art, 101 Legal Secretary, 112 Sales, 110 E Sales Management, 110 Art & Design, 102 Lifestyle Counselling, 107 Education, 106 Secretarial, 112, 113 Auditing, 101 Local Management & AdMinistration, Electrical, 106 109 Security Management, 113 B Electronic Secretary, 112 Skin Care, 102 Banking, 102 M Electronics, 106 Maintenance Management, 109 Small Business Management, 102, Beauty Care, 102 End User Computing, 105 106 Bookkeeping, 101 Make Up, 113 English, 109 Management, 103, 104, 106, 111 Social Sciences, 113 Business, 102, 110 Entrepreneurship, 106 Sound Recording Engineering, 113 Business Administration, 102, 103, Management Assistant, 112 F Special Effects, 113 104 Marketing, 109, 110 Fashion Design, 106, 107 Marketing Management, 109, 110 Speech & Drama, 106 Business Communications, 111 Fashion Marketing, 106 Sport Management 113 Business Computing, 104, 105 Marketing Research, 110 Field Service Technology, 105 Sports Fitness Training, 107 Business Management, 102, 103, Medical Secretary, 112 Stage Craft, 113 104, 105, 106, 109 Finance, 102 Multimedia Design, 101 Financial Management, 102 Stock Control, 113 Business Studies, 102, 103 N Financial Secretary, 112 Strategic Marketing, 109 C Natural Sciences, 110 Fine Art, 102 0 Supervisory Management, 103 Catering, 107 T Fire Control & Prevention, 107 Ocean Sailing Management, 113 Chartered Secretaries & Fire Service, 107 Taxation, 109 Administrators, 104 Office Management, 103, 104, 112 Fitness Leadership, 107 Office Skills, 113 Television & Film Production, 107 Child Care, 104 Fitness Training, 107 Textile Design, 102 Clothing Design, 107 p G Tourism, 107, 114 Personal Computing, 105 Clothing Production, 107 Training Management, 113 Graphic Design, 101, 102 Personal Selling, 110 Commerce, 104 Travel, 114 Communication, 111 H Personnel Management, 108 Travel & Tourism, 114 Company Secretaries, 104 Health & Skin Care, 102 Photography, 110 Travel Secretary, 112 Competency Based Assessment, 106 Health Club Management, 113 Pneumatics, 106 U Computer Graphics, 105 Hotel & Catering, 107 Production & Operations Management, University Access, 114 Computer Programming, 105, 106 Hotel Management, 107 111 Computer Science, 105 Human Behaviour, 108 Project Management, 111 Computer Studies, 105, 106 Human Resources Management, 108 Property Management, 111 131 Private Colleaes 115 Technical Co Ile es Introduction Technical colleges are training institutions that aim at providing participants with the knowledge and skills that prepare them for specific trades or occupations. There isthus a strong emphasis on practical training. Studies at the technical colleges are open to individuals who have passed at least Grade 9 (Std 7).For some of the courses, however, you may be required to have attained ahigher standard, particularly in mathematics and science. The fields of study available at technical colleges include technical, commercial, the arts and cultural enrichment.Courses offered at technical colleges are referred to as National Technical Certificates (N Certificates) and range from N1 to N6. The following courses are available: The National Intermediate Certificate (NIC)is equivalent to N2 or Grade 11 (Std 9) and is usually followed by students who have completed Grade 9 (Std 7) and are at least 16 years old. The National Senior Certificate (NSC) is equivalent to a Senior Certificate (Std 10/Grade 12) and is followed by students who have completed the National Intermediate Certificate. The National Certificate (NI-N3) and (N4-N6) are referred to as "N" courses. The N1-N3 courses are usually followed by students who have completed Grade 9 (Std 7). (Mathematics and science maybe required for certain fields of study). The N4-N6 courses are followed by students who have completed N3, Std 10/Grade 12 or NSC. A National Diploma is issued provided 12 applicable subjects from N4-N6 have beenpassed and the student has completed a period of 18 months of relevant experience at an approved place of employment. The Government Certificate of Competency for Engineers is awarded after the 18 prescribedsubjects have been passed with an average mark of 50 % and a further two applicable subjects have been passed. How to use this section The technical colleges are listed in alphabetical order with course information appearing below thecollege's name. Not all the technical colleges are listed as the relevant information was not available at the timeof going to print.Please consult the complete address list of technical colleges in order to find a college that willsuit you best. In addition to the formal courses listed in this section, technical colleges also offer awide variety of enrichment and hobby courses, for example computer courses, language courses, photography, calligraphy, flower arranging, etc. Prospective students are advised to make enquiries at their nearest technicalcolleges. Apply for admission to the course in good time. Don't wait for your examination results! Theapplication form must be obtained, completed and submitted before a particular closing date.Enrolment dates are determined annually. T,Nr.hrlir-31e`nllorloc 132 117 :0,ABEIREV*TION, General Terms NCert National Certificate NDip National Diploma Acc Accounting NHCert National Higher Certificate av average NIC National Intermediate Certificate Afr Afrikaans NSC National Senior Certificate Biol Biology NTC National Technical Certificate Cert Certificate p/t part-time Dip Diploma Phys Sc Physical Science Econ Economics Sc Science Eng English Std Standard f/t full-time SG Standard Grade H/C Heavy Current subj subject HG Higher Grade subjs subjects L/C Light Current UM University Matric LG Lower Grade yr year Math Mathematics yrs years mths months 133 118 Technical Colleaes Course Field of Study Duration Entry Requirements Athlone Technical College Athlone Technical College NCert: NI -N3 Engineering: Building, Electrical (L/C & H/Q, Mechanical, Mechanical 3 mths per N level f/t orStd 7 with Math + Science + 16 yrs Draughtsman, Water & Waste Water Treatment p/t of age NCert: Orientation Engineering: Building, Electrical, Mechanical 3 mths Std 6 (Std 5 will be considered) Drawing Office Practice Engineering: Drawing Office Practice 6 mths N3 (Building or Mechanical) or Std 10 (Technical) NCert: N4-N6 Engineering: Building, Electrical (L/C & H/Q, Mechanical Draughtsman, 3 mths per N level f/t or N3 with Math + Science Mechanical p/t NIC General: Hair Care & Cosmetics 1 yr f/t Std 7 + 16 yrs of age NSC General: Hair Care & Cosmetics 1 yr f/t NIC or Std 10 Atteridgeville College Atteridgeville College NIC Business 1 yr f/t Std 8 + 16 yrs of age NSC Business 1 yr f/t NIC or Std 9 (Commercial) NCert N4 (Introductory) Business 6 mths f/t Std 10 NCert: N4-N6 Business: Business Management, Financial Management, Marketing 6 mths f/t Std 10 or N3 or N4 Introductory Management, Secretarial NCert. NI -N3 Engineering: Electrical, Mechanical 3 mths per N level Std 8 with Math + Phys Sc + 16 yrs of age NCert: Orientation Engineering 3 mths Std 8 NCert N4-N6 Engineering: Becoical, Mechanical 3 mths per N level N3 +-16 yrs of age NCert: Food Service Supervision General: Food Service Supervision 1 yr f/t NIC (Food Service Supervision) NCert N2-N3 General: Hair Care & Cosmetics 1 yr f/t per N level Std 8 + 16 Yis of age NIC General: Educare, Food Service Supervision 1 yr Std 8 + 16 yrs of age NSC General: Educate I yr NIC or Std 8 + 16 yrs of age NCert: N4 (Introductory) General: Educare 6 mths Std 10 NCert N4-N6 General: Educare 6 mths per N level N3 (Educate) or Std 10 + N4 Introductory NCert: N4-N6 General: Hair Care & Cosmetics 6 mths fit per N level N3 or NSC Bellville Technical College Bellville Technical College NCert: Ni -N3 (Modular & Practical) Engineering: Auto Electrical, Boiler-making, Diesel, Electrical, Ming & 3 mths per N level Boiler-making, Fitting & Machining Machining, Motor Mechanics, Spray-painting & Panel-beating . and Electrical options: Std 8. Motor Mechanics option: Std 8 with Math + Science at Std 7 level. Spray- painting & Panel-beating option: Bethelsdorp Technical College Bethelsdorp Technical College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 + 16 yrs of age NSC Business: Accounting, Administrative, Seaetarial 1 yr MC NCert: N4-N6 Business: Business Management, Management Assistant, Marketing 6 mths per N level Std 10 Management, Public Management NCert Ni -N3 Engineering: Building & Ovil, Electrical, Mechanical 3 mths per N level NCert: Orientation Engineering 3 mths Std 6 NCert N4-N5 Engineering: Multi-Disciplinary Drawing Office Practice 3 mths per N level N3 or Std 10 (Tedthical) NCert: N4-N6 Engineering: Building & Civil, Electrical, Mechanical 3 mths per N level N3 or Std 10 (Technical) NIC General'. Clothing Production, Educate, Food Service Supervision, HairI yr Std 7 + 16 yrs of age Care & Cosmetics NSC General: Clothing Production, Educare, Food Service Supervision, Hair 1 yr NIC Care & Cosmetics NCert: N4-N6 General: aothing Production, Educate, Hospitality Services 6 mths per N level Std 10 Bloemfontein College Bloemfontein College NCert: Ni -N3 (Adult Education) Business: Computer Practice, Typing 6 mths per N level Grade 10 (Std 8) is recommended 134 Technical Colleges 119 Course Field of Stud Duration Entry Requirements Bloemfontein College Bloemfontein College NCert: N3 (Adult Education) Business: Communication, Office Practice 6 mths Grade 10 (Std 8) is recommended NIC/N2 Business: Business Studies 1 yr Grade 9 (Std 7) or 16 yrs of age NSC/N3 Business: Business Studies 1 yr NIC/N2 NCert: N4-N5 (Adult Education) Business: Computer Practice 6 mths per N level Grade 10 (Std 8) is recommended NCert: N4-N6 Business: Management (Financial, Human Resources, Marketing, 6 mths per N level Secretarial options: Grade 12 (Std Public). Secretarial (Management Assistant, Medical Secretary, Public 10) with Eng or Afr SG 40%. Relations) Financial Management option: NSC with Eng + Afr SG 40% Human Resources, Marketing & Public Management options: Grade 12 (Std 10) with Eng 40% AGM Cert: 1 -3 (Internal Cert) Engineering: Agricultural Mechanics 3 mths per AGM level Grade 10 (Std 8) NCert: N1-N3 Engineering: Electrical, Electronics, Mechanical, Motor 3 mths per N level Grade 9 (Std 7) or 16 yrs of age. Agricultural Mechanics option: Grade 10 (Std 8) NCert: N4-N6 Engineering: Electrical, Electronics, Mechanical, Motor 3 mths per N level Grade 12 (Std 10) or N3 with Math Phys Sc Hair Care & Cosmetics (Module 1- General 2 yrs f/t or 3 yrs p/t Grade 10 (Std 8) 6) NIC/N2 General: Art, Clothing Production, Classical Music, Educare, Hair Care & 1 yr Grade 9 (Std 7) or 16 yrs of age. Cosmetics, Light Music Hair Care & Cosmetics option: Grade 10 (Std 8) NSC/N3 General: Art, Clothing Production, Classical Music, Educare, Hair Care & 1 yr NIC/N2 Cosmetics, Light Music NCert: N4-N6 General: Art, Clothing Production, Educare, Hospitality Services 6 mths per N level Grade 12 (Std 10) or N3 or NSC Boksburg College for Vocational Boksburg College for Vocational Education Education NIC Business: Accounting, Secretarial 1 yr Std 7, but preferably Std 8 NSC Business: Accounting, Secretarial 1 yr NIC or N2 or Std 9 with 2 relevant school subjs NCert: N4-N6 Business: Secretarial (Business Computers, Public Relations). 1 yr Std 10 or N3 or equivalent Management (Accounts / Computer Practice, Personnel Management) NCert: NI -N3 Engineering: Electrical & Electronics, Mechanical 4 mths per N level Electrical & Electronics option (N1): Std 7 (SG) (Technical) or Std 8 (Functional Grade) or Std 9 without Math + Science. Mechanical option (Ni): Std 7 (SG) or Std 8 (Functional Grade) (Technical) NCert: N4-N6 General: Computer Courses 1 X 3 hour Basses per Std TO or N3:or equivalent week Brakpan College Brakpan College NIC Business 1 yr f/t Std 7, but preferably Std 8 (40% av) NSC Business 1 yr f/t N2 (Business Studies) or Std 9 with appropriate supls, including Typing NCert: N4 (Computer Course for Business: Computer Studies 6 mths p/t (aftemoon or Beginners) evening classes) NCert: N4-N6 Business: Management Assistant 6 mths per N level Std 10 (40% av) C.N. Mahlangu Technical College C.N. Mahlangu Technical College NCert: N4 (Introductory) Business: Financial Manager, Management Assistant 6 mths Std 10 NCert: N4-N6 Business: Financial Manager, Management Assistant 6 mths per N level Std 10 NCert: NI -N3 Engineering 3 mths per N level Std 7 ;! 135 120 Technical Colleges Course Field of Study Duration Entry ReqUirenients Cape College Cape College NCert: N3 Business: Commerce NIC Business: Accounting, Administrative_,Secretarial 1 yr Std 7 + 16 yrs of age NSC Business: Accounting, Administrative, Secretarial 1 yr NIC, N2 or Std 9 NCert: N4-N6 Business: Financial Management, Human Resources Management, 6 mths per N level Std 10, Financial Management Legal Secretary, Management Assistant, Marketing Management, option: Acc. Secretarial options: Public Administration, Public Relations Secretary Typing 40% NIC General: Art, Educare, Food Serve Supervision, Interior Decorating 1 yr Std 7 + 16 yrs of age NSC General: Art, Educare, Food Service Supervision, Interior Decorating 1 yr NIC or Std 9 Senior Cen (Std 10)/N3CPA General 1 Yr P/t NCert: N4-N6 General: Art & Design, Educare, Hair Care & Cosmetics, Hospitality 6 mths per N level Std 10 or N3 Services, Interior Decorating, Travel & Tourism Carletonville Technical College Carletonville Technical College MC (Foundation) Business 1 yr f/t NIC/N2 Business: Accounting, Administrative, Secretarial 1 yr f/t NSC /N3 Business: Accounting, Administrative, Secretarial 1 yr f/t NIC orStd 9 with appropriate subjs an entrance test NCert: N4 (Introductory) Business 6 mths N3, NSC or Std 10 NCert N4-N6 Business:Accounting & Computer Practice Management, Computer 6 mths per N level N3, NSC or Std 10 .. Practice,Mancetincikinagement, Operation Management,Tersonnele Management; Public Relartions: NCert: NI -N3 Engineering 3 mths per N level f/t orStd 7 with Math + Science p/t NCert: Orientation Engineering NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level f/t or N3 with Math + Science p/t NIC/N2 General: Educate 1 yr f/t NSC/N3 General: Educare 1 yr f/t NIC or Std 9 with appropriate subjs Cato Manor Technical College Cato Manor Technical College NIC Business 1 yr Std .7 + 16 yrs of age NSC Business 1 yr NIC or Std 9+ 16 yrs of age NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level Business Management, Human Resources Management, Management Assistant, Marketing Resources Management, Management, eublicManagement, Public Relations, ..Marketing Management, Public Management options: Std 10 or ,,_...N3:11narrcial-Management option: §tit 10Cir 037iiithltd)b Agx or- equlvalerit ManagernentrAssistant and Public Relations options: N4 .;7111*,91:14attiY (Business Studies), or :41SiCf'ilirsiness Studies or Std 10 or N3 with Typing NCert: N1 -N3 Engineering: Civil (Bricklaying & Plastering, Carpentry &Joinery, 3 mths per N level Electrotechnology option: Std 8 Plumbing); Electrical H/C (Armature Winding, Electrotechnology, with Math + Phys Sc SG 40% + 16 Refrigeration); Electrical L/C (Motor Electrical, Radio & Television); yrs of age. All other options: Std 7 Mechanical (Fitting & Machining, Motor Mechanics, Plater Boiler- with Math SG 4096 + 16 yrs of age making, Welding) NCert: N2-N3 Eigineering: Electrical L/C (Instrumentation), Mechanical (Diesel 3 traits per N level Electrical Engineering option: Std 8 Mechanics) with Math + Phys Sc SG 40%+ 16 yrs of age. Mechanical Engineering option: Std 7 or Ni with Motor Trade Theory + 16 yrs of age Skills Training Engineering: Armature Winding, Boiler-making & Welding, Bricklaying,1 yr Std 7 + 16 yrs of age Carpentry, Electrical (H /C), Electronics, Fitting & Turning, Instrumentation, Motor Electrical, Motor Mechanics, Radio & Television, Refrigeration & Air Conditioning, Sheet Metalwork NCert: N4-N5 (Multi-DisciplinaryEngineering: Multi-Disciplinary Drawing Office Practice 6 mths Building Drawing N3 + Drawing_Office Practice) Engineering Drawing N3 136 Technical Colleges 121 Course Field of Study Duration Entry Requirements Cato Manor Technical College Cato Manor Technical College NCert: N4-N6 Engineering: Civil, Electrical H/C (Electrotechnology), Electrical L/C 3 mths per N level Civil Engineering option: N3 with (Instrumentation), Mechanical Civil Engineering subjs or Std 10 with Math + Phys Sc SG 4096. Mechanical Engineering option: N3 with Math + Engineering Sc or Std 10 with Math + Phys Sc SG 4096. Electrical Engineering option: N3 Modular Training (Module 1-3) General: Hair Care, Afro-Hair 6 mths Std 7 + 16 yrs of age NCert: N2-N3 General: Hair Care & Cosmetics 1 yr per N level Std 7 + 16 yrs of age NIC General: Educare 1 yr Std 7 + 16 yrs of age NSC General: Educare 1 yr NIC COTAC I (Tourism) General: Tourism 6 mths Std 10 + 16 yrs of age NCert: N4 (Introductory) General: Clothing Production 6 mths Std 10 + 16 yrs of age NCert: N4-N6 General: Clothing Production, Educare, Tourism 6 mths per N level Clothing Production option: N4 Introductory. Educare option: N3 or NSC. Tourism option: Std 10 + 16 yrs of age Centurion College Centurion College NIC Business: Accounting; Administrative; Secretarial 1 yr f/t Std 7 NSC Business: Accounting; Administrative; Secretarial 1 yr f/t Std 9 or NIC NCert: N4 (Introductory) Business 6 mths f/t Std 10 NCert: N4-N6 Business: Business Management, Management Assistant (Secretarial) 18 mths f/t Std 10 NCert: NI -N3 Engineering: Electrical, Mechanical 6 mths per N level Std 6Std 10 NCert N4-N6 Engineering: Electrical, Mechanical 6 mths per N level N3 or Std 10 (SC or HQ with Math + Phys Sc Senior Cert (Std 10/Grade 12) with General 1 yr f/t or p/t Std 8 or Ni or without university admission NCert: N4-N6 General: Educare, Hospitality Services 6 mths per N level Std 10 Community Technical College Brits Community Technical College Brits NIC Business 1 yr Std 7 NSC Business 1 yr NIC NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level Std 10. Management Assistant option: Typing De Aar Campus De Aar Campus NIC Business 1 yr Std 7 with Acc NSC Business 1 yr NIC or Std 9 with Acc + Typing NCert: N4-N6 Business: Management Assistant 6 mths Std 10 with or without Typing NCert: N1-N3 Engineering: Electrical, Motor Mechanical 3 mths per N level Std 7 NCert N4-N6 Engineering: Electrical 3 mths per N level N3 or Std 10 Distancekol Distancekol NIC Business 1 yr Std 7 NSC Business I yr NIC NCert: N4-N6 Business 6 mths per N level N3 NCert. Engineering Engineering: Combustion Prindples & Practice, Paint Technology, Pest 1 yr. Paint Technology 2Std 7 with Math + Phys Sc Control yrs NCen: NI -N2 Engineering: Power Station Operation, Water Treatment 3 mths per N level Std 7 with Math + Phys Sc NCert. Ni -N3 Engineering: Building, Chemistry, Electrical, Electronic, Mechanical, 3 mths per N level Std 7 with Math + Phys Sc Plant Operation NCert: N4-N6 Engineering: Building, Chemistry, Electrical, Electronic, Mechanical, 3 mths per N level N3 Plant Operation 137 122 Technical Colleges Course Field of Study Duration Entry Requirements Distancekol Distancekol Elementary Technisa Studies (ETS) General 1 yr Std 6 with Math NIC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr Std 7 Educare. Hair Care NSC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr NIC Educare, Hair Care NCert: N4-N6 General: Hair Care 6 mths per N level N3 Durban Central Technical College Durban Central Technical College (Centec) (Centec) MC Business: Administrative 1 yr Std 7 with Std 5 Math + 16 yrs of age NSC Business: Administrative 1 yr NIC + Std 5 Math NCert N4-N6 Business: Financial Management, Human Resources Management, 6 mths per N level f/t Std lOor N3 Management Assistant, Marketing Management, Public Relations- NIC General: Art, Food Services 1 yr fit Std 7 + 16 yrs of age NSC General: Art, Food Services 1 yr f/t NC Senior Cert (Std 10) General NCert N4 General: Art 6 mths f/t Std 10 Artportfolio or SW 10 with: MO stitnclard or NSC Art + NCert: N4 (Introductory) General: Art 6 mths f/t Std 10 with Art or Std 10 (without Art) + portfolio NCert: N4-N6 General: Hospitality Services 6 mths per N level SW 10 Durban Technical College Durban Technical College NCert: N1-N3 Engineering: Civil, Electrical (L/C & H/C), Mechanical, Motor 3 mths per N level Std 8 with Math + Science. Technology Students in possession of Std 7 with Math + Science will be required to complete the Bridging Course NCert: Orientation (Bridging Engineering 3 mths Std 7 with Math + Science Programme) NCert: N4-N6 Engineering: Electrical (H/C & L/C), Mechanical 3 mths per N level N3 with 4 subjs, one of the subjs being Math East London College: Aliwal North East London College: Aliwal North Campus Campus NCert N4 (l ntroductory) Business 6 mths Std 10 or N3 with Eng 40% NCert: N4-N6 (f/t + p/t) Business: Business Management, Human Resources Management, 1 or 2 yrs . Std 10 or N3 with Eng 40% Management Assistant East London College: King Campus East London College: King Campus NSC (f/t + p/t) Business 2 yrs f/t (An NC is Std 8 or Std 9 with Eng 1st obtained after the 1st yr)Language 4036 or Eng + Afr 2nd Language HG SO% plus 5096av NCert: N4 (Introductory) Business 6 mths Std 10 or N3 with Eng 40% NCert: N4-N6 (f/t or p/t) Business: Business Management, Financial Management, Management 1 or 2 yrs SW 10 or N3 with Eng 40% Assistant, Public Management NCert: N4 (Introductory) General: Clothing Production 6 mths Std 10 with Enq 40% NCert N4-N6 General: Clothing Production 2 yrs Std 10 with Eng 40% 133 Technical Colleges 123 Course Field of Study Duration Entry Requirements East London College: Main Campus East London College: Main Campus NSC (f/t) Business 2 yrs f/t. (An NIC is Std 8 or Std 9 with Eng 1st obtained after the 1st yr)Language 40% or Eng + Afr 2nd Language HG 50% plus 50% av NSC (p/t) Business 2 yrs p/t Std 7 IAC Dip: Business Management Business: Business Administration, Marketing Management Std 10 + 16 yrs of age NCert: N4 (Introductory) Business 6 mths Std 10 or N3 with Eng 40% NCert: N4-N6 (f/t Business: Business Management, Financial Management, Human 1 or 2 yrs Std 10 or N3 with Eng 40% Resources Management, Management Assistant, Marketing Management, Public Management NDip: Marketing Business: Marketing 3 yrs Std 10 with a record of ability NDip: Sport Administration & Business: Sport Administration & Marketing 3 yrs f/t (in conjunction Std 10 (HG or SG) with a record of Marketing with Border Technikon) ability and achievement in a sport Hair Care (Module 1-6 p/t) General: Hair Care 2 yrs + 9 mths p/t Std 8 Dip Tech: Fine Art (in conjunction General: Fine Art 3 yrs f/t (B.Tech. degree Std 10 HG or SG (no lower grade with Port Elizabeth Technikon) can be obtained with 1 yrsubjs). 1st Language HG 40% or SG additional f/t or 2 yrs 50% + interview + portfolio additional p/t study) NCert: N4 (Introductory) General: Clothing Production, Fine Art, Graphic Design 6 mths Std 10 NCert: N4-N6 General: Clothing Production, Fine Art, Graphic Design, Tourism 2 yrs f/t Std 10. Tourism option: Eng 50% (Geography will be an advantage). Clothing Production option: Eng HG or SG 40% NDip: Graphic Design (in General: Graphic Design 3 yrs f/t (A Higher Dip Std 10 HG Or SG (no LG subjs). 1st conjunction with Port Elizabeth can be obtained with 1 yrLangoage'ROC66 or St 50%+ Technikon) . additional f/t or 2 yrs intenrieW+;POrifigki additional p/t study) NDip: Information Technology (inGeneral: Information Technology 3 yrs Std 10 with a record of ability conjunction with Port Elizabeth Technikon) East London College: St Marks Campus East London College: St Marks Campus Motor, Diesel & Tractor Course (1 Engineering: Motor, Diesel & Tractor 3 mths per N level Std 7 ,- & 2) Integrated NCert: Ni -N3 (Orientation Engineering: Engineering Studies 3 mths per N level f/t or Std 7 with Math + Science included) p/t NCert N4-N6 Engineering: Electrical, Mechanical 3 mths per N level f/t orN3 or Std-10(TedinicaD with 3 p/t appropriate subjs Si Access Engineering Course (in Engineering: Electrical, Mechanical 1 yr Std 10 or N3 (50% av) with Math + conjunction with Border Phys Sc HG (F symbol) or SG (E Technikon) symbol) Engcobo Technical College Engcobo Technical College NIC Business 1 yr Std 8 with Eng 40% + commercial subjs ("1: NSC Business 1 yr Std 9 with Eng 40% + commercial subjs NCert: N4-N6 Business: Human Resources Management, Management Assistants 6 mths per N level N4 introductory or Std 10 with Eng 50% + commerdal subjs 4096 NCert: N1 -N3 Engineering: Bricklaying & Plastering, Carpentry 3 mths per N level Math + Science SG 40% NIC Clothing Production General: Clothing Production 1 yr Std 8 With Eng 40% + Needlework 40% NSC Clothing Production General: Clothing Production 1 yr MC Clothing Production NCert: N4-N6 General: Clothing Production 6 mths per N level Introdudo0144 or Std 10 with Eng 40%+ Needlework 40% Enyenyezi Technical College Enyenyezi Technical College Access Course Business 1 yr Std 7, fluency in English and an entrance test 139 124 Technical Colleges Course Field of Study Duration Entry Requirenients Enyenyezi Technical College Enyenyezi Technical College NCert: N2 Business: Secretarial 1 yr Std 8, fluency in English and an entrance test NCert: N3 Business: Administrative, Secretarial I yr N2 Cert NCert: N4 (Introductory) Business 6 mths Std 10, fluency in English and an entrance test Adult Basic Education & Training: Engineering: Bricklaying 3 mths Bricklaying NCert: Ni -N3 Engineering: Electrical, Mechanical 3 mths per N level Practical Modular Course (Level 1-Engineering: Electrical, Motor Mechanics 3 mths per level 3) Adult Basic Education & Training General: Educare, Garment Making 3 mths per level (Level 1 -3) Ermelo Kollege Ermelo Kollege NIC Business 1 yr f/t Std 7 + admission test NIC or Std 9 with Acc + TS/ping NSC Business 1 yr f/t NCert: N4-N6 Business: Business Management, Secretarial 6 mths per N level N4 Introductory or NSC. Secretarial option: Typing. Business Management option: Acc NCert: N1 -N3 Engineering: Electrical 3 mths per N level Std 7 + admission test Ezakheni Technical College Ezakheni Technical College NCert: N1 -N3 Engineering: Carpentry & joinery, Electrical (H/C), Motor Body Repair, 3 mths per N level Std 8. 16 yrs of age Motor Mechanics, Welding & Metalwork Germiston College Germiston College NIC Business: Business Studies 1 yr Std 8 NSC Business: Business Studies 1 yr Std 9 NCert: N4-N6 Business: Management 6 mths Std 10 NCert: N I -N3 Engineering: Aviation, Computer, Electrical, Electronic, Mechanical 3 mths per N level Std 7 with any subj, but preferably Math + Science NCert: N4-N6 Engineering: Aviation, Computer, Electrical, Electronic, Mechanical 3 mths per N level Std.] 0 *Nair/ subj, hit:. preferablY Malt' + Science Hillside View College Hillside View College Std 8 + merit + aptitude test NCert: N1 -N3 Business N2: I yr; N3: 6 mths NCert: N4-N6 Business 6 mths per N level Std 10 or N3 Std 8 with Math + merit + aptitude NCert: N1 -N3 Engineering: Civil, Electrical, Mechanical 3 mths per N level tests N3 with 40)6in 3 subjs, Including a NCert: N4-N6 Engineering: Civil, Electrical, Mechanical 3 mths per N level relevant trade theory lqhayiya College lqhayiya College Std 8 NCert: N2 Business: Secretarial 1 yr N2 (new course) NCert: N3-N4 Business 1 yr Std 8 NIC Business 1 yr NIC NSC Business I yr N3 (new course) NCert: N4-N6 Business: Management Assistant 6 mths per N level 140 Technical Colleaes 125 Course Field of Study Duration Entry Requirernents lqhayiya College lqhayiya College Engineering Studies Practical Engineering: Basic Entrepreneur Training; Basic Skills Training 10 weeks per course Basic Skills Training: Std 8 with Courses (Briddaying, Carpentry, Electrical, Electronic, Fitting & Machining, Motor Math + Science or the NCert Mechanic, Panel-beating, Plumbing, Sheetmetal, Spray-painting, (Orientation). Intensive Skills Welding); Intensive Skills Training Training: Basic Skills with Ni. Basic Entrepreneur Training: Intensive Skills NCert: Ni -N3 Engineering: Civil, Electrical, Mechanical 3 mths per N level Std 8 with Math + Science NCert Orientation Engineering 3 mths Students without Std 8 with Math + Science NCert: N4-N6 Engineering: Civil, Electrical, Mechanical 3 mths per N level N3 Isidingo Technical College lsidingo Technical College NCert: N2-N3 Business: Management Assistant 1 yr per N level Std 7 NCert: N4 Business: Computerised Financial Accounting 6 mths N3 Acc NCert: N4-N6 Business: Computer Practice 6 mths per N level Basic keyboarding NCert: N4-N6 Business: Management Assistant 6 mths per N level Std 10 or N3 with relevant subjs NCert: N1 -N3 Engineering: Electrical, Mechanical 3 mths per N level f/t orNCert (Orientation) or Std 7 with p/t Math + Science or Std 8 Technical Training Course Engineering: Carpentry, Electrical, Fitting & Machining, Metalwork & 1 yr Std 7 with Math + Science Welding, Motor Body Repair, Motor Mechanics NCert N4-N6 Engineering: Electrical, Mechanical 3 mills per N level N3 or equivalent with 3 relevant subjs NCert: N4 (Introductory) General: Educare 6 mths Std 10 Kathu Technical College Kathu Technical College NIC Business 1 yr Std 7 NSC Business 1 yr NIC NCert N4 (introductory) Business 6 mths NSC or Still 0 + appropriate subjs NCert: N4-N6 Business: Management Assistant 6 mths per N level NSC or Std 10 + appropriate subjs NCert: Ni -N3 Engineering: Electrical, Mechanical, Surface Mining 3 mths per N level S t d 7 (S G ) Math ,+ Phys Sc Surface Miritrig:,Std ZW1th Math + Phys Sc + candidates must be employed at asurface mine NCert: Orientation Engineering 3 mths Std 7 with Math + Phys Sc NCert N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 or Std 10 (Technical) Kempton College Kempton College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 NSC Business: Accounting, Administrative, Secretarial 1 yr MC or Std 9 with Typing + Acc NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level NSC or N3 Resources Management, Management Assistant, Marketing Management NCert N1 -N3 Engineering: Electrical & Electronics, Mechanical 3 mths per N level Std 7 wittO of the followirig subjs: Math, Phys Sc,lechrtIcal praMng, Trade Theiii NCert: Orientation Engineering 3 mths NCert: N4-N6 Engineering: Building & Crvil, Electrical & Electronics, Mechanical 3 mths per N level N3 with 3 of the following subjs: Math, Phys Sc, Technical Drawing, Trade Thew- Hair Care for Apprentices General: Hair Care 3 yrs p/t Std 8 Senior Cert (Std 1 0)/NSC General 1 yr p/t Hair Care (Module 1-6) General: Hair Care 1 yr f/t Std 10 NCert N4 (Introductory) General: Educare 6 mths NSC or N3 NCert: N4-N6 General: Educare, Tourism 6 mths per N level NSC or N3 141 126 Technical Colleges Course Field of Stildy Duration Entry Requirenients Kimberley College Kimberley College NCert: N2-N3 Business: Secretarial 6 mths per N level Std 7 NCert: N4 (Introductory) Business: Management Assistant, Marketing Management 6 mths Std 10 NCert: N4-N5 Business: Human Resources Management 6 mths per N level Std 10 NCert: N4-N6 Business: Financial Management, Management Assistant, Marketing 6 mths per N level Financial Management option: NSC Management with related subjs or Std 10 with Acc. Management Assistant option: NSC with related subjs or Std 10 with Typing or N4 Introductory (Management Assistant). Marketing Management option: NSC with related subjs or N4 Introductory (Marketing Management) NCert: N4-N6 Business: Computer Studies 6 mths per N level NCert: N4 General: Educare 6 mths N3 ( Educare) or N4 Introductory (Educare) NCert: N4 (Introductory) General: Educare 6 mths Std 10 Kroonstad College Kroonstad College Std 7 or Std 8 + 16 yrs of age NIC Business: Accounting, Administrative, Secretarial 1 yr f/t MC or Std 9 with appropriate subjs NSC Business: Accounting, Administrative, Secretarial 1 yr f/t NCert: N4-N6 Business: Business Management, Computer Practice, Management 6 mths per N level f/t or3 Std 10 or N3 Assistant, Marketing Management, Public Management yrs p/t NCert: N I -N3 Engineering P/t 1 subj per trimester NIC/N2 General: Educare, Food Service Supervision 1 yr f/t Std 7 + 16 yrs of aqe NSC/N3 General: Educare, Food Service Supervision 1 yr f/t NIC or Std 9 with appropriate subjs Senior Cert (Std 10) General 1 yr Std 9 or NIC NCert: N4-N6 General: Educare, Hospitality Services 6 mths per N level f/t or3 Std 10 or N3 yrs p/t Krugersdorp College Krugersdorp College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 + 16 yrs of age Std 10 or N3 or NIC NSC Business: Accounting & Computer Practice, Secretarial 1 yr NCert: NI -N3 Engineering: Electrical, Electronic, Mechanical 3 mths per N level Std 7 with Math + Phys Sc NCert N4-N6 Engineering: Electrical, Electronic, Mechanical 6 mths per N level N3 NIC General: Hair Care & Cosmetics 1 yr Std 7 or 16 yrs of age NSC General: Hair Care & Cosmetics 1 yr MC Kwa Nobuhle College Kwa Nobuhle College NCert: N2-N3 Business: Secretarial 1 yr per N level Std 8 or Std 9 or Std 10 NCert: N3-N6 Business: Computer Practice NCert: N4-N6 Business: Business Management, Management Assistant, Secretarial 6 mths per N level Std 10 or N3 NCert Ni -N3 Engineering: Building & Crvil, Electrical, Mechanical 3 mths per N level f/t or p/t NCert: Orientation Engineering 3 mths f/t Std 6 NSC Engineering 3 mths NCert: N4-N6 Engineering: Building & Civil, Electrical, Mechanical 3 mths per N level f/t or p/t Kwazulu-Natal Midlands Technical Kwazulu-Natal Midlands Technical College (Midtech) College (Midtech) Std 8 NIC/N2 Business 1 yr NIC/N2 NSC/N3 Business: Accounting, Administrative, Secretarial 1 yr i 49 Technical Colleaes 127 Course Field of Study Duration Entry Requirements Kwazulu-Natal Midlands Technical Kwazulu-Natal Midlands Technical College (Midtech) College (Midtech) NCert: N4 (Introductory) Business 6 mths Std 10 NCert: N4-N6 Business: Business Management, Management Assistant, Public 6 mths per N level Business Management and Public Relations Relations options: preceding certificate. Management Assistant option: Std 10 with Acc HG 50% NCert: NI -N3 Engineering: Electrical, Mechanical 3 mths per N level All students will be subjected to an interview to ensure correct placement NCert: Orientation Engineering: Electrical, Mechanical 3 mths All students will be subjected to an interview to ensure correct placement NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 L.C. Johnson Technical College LC. Johnson Technical College NCert: NI -N3 Engineering: Civil, Electrical, Mechanical 3 mths per N level Std 8 with Math + Science NCert: Orientation Engineering: Engineering Studies 3 mths Std 8 with Math + Science NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 with Math + Science Ladysmith College Ladysmith College NIC Business I yr Std 8 (A strong academic Std 7 will be considered) NSC Business 1 yr NIC or Std 9 with 2 commercial subjs B.Business Admin (BM) Business: Business Administration 3 yrs (semester courses) UM with Acc or Math M.Business Admin (MBA) Business: Business Administration 2 - 3 yrs (semester Any degree + 2 yrs work courses) experience NCert: N4 (Introductory) Business 6 mths Std 10 NCert: N4-N6 Business: Human Resources Management, Management Assistant 6 mths per N level Std 10 or NSC. Human Resources Management option: Eng 50% NCert: NI -N3 Engineering: Electrical, Electronic 3 mths per N level Std 7 with Math + Science 60% or Std 8 with Math + Science (SG) NCert: N4-N6 General: Educare 6 mths per N level Std 10 Lazarus Nhlapo Technical College Lazarus Nhlapo Technical College NCert N4-N6 Business: Business Management, Human Resources Management, 6 mths or 1 yr per N level Std 10 Management Assistant NCert: N1-N3 Engineering: Civil, Electrical, Mechanical 3 mths per N level Std 7 with Math + Science + 16 yrs of age NCert: N4 Engineering: Civil, Electrical, Mechanical 3 mths N3 with Math + Science NCert: N4-N6 General: Educare, Hair Care & Cosmetics 6 mths or 1 yr per N levelStd 10 Lekoa Technical College Lekoa Technical College NCert: N4-N6 Business: Business Management, Management Assistant 3 mths per N level Std 10 with Commerce + Math NCert: NI -N2 Engineering: Metalwork, Motor 3 mths per N level Std 7 with Math + admission test + 16 yrs of age NCert: NI -N3 Engineering: Electrical/Electronic, Fitting & Turning 3 mths per N level Std 7 with Math + admission test + 16 yrs of age NCert: Orientation Engineering: Mathematics, Science 3 mths p/t School results with required subj for upgrading. Math + Science 40% NCert: N4 Engineering: Electrical/Electronic 3 mths N3 NCert: N2 General: Food Service 1 yr Std 9, but preferably Std 10, with languages 143 128 Technical Colleaes 'Entry 'Requirements Lekoa Technical College Lekoa Technical College Std 9, but preferably Std 10, with NCert: N3 General: Care of the Aged 1 yr languages Hospitality Service option: Std 9, NCert: N4-N6 General: Educare. Hospitality Services 6 mths per N level but preferably Std 10, with languages. Educare option: Std 10 with any subj Lichtenburg College Lichtenburg College Std 8 + 16 yrs of age MC Business 1 yr 1 yr NIC NSC Business Std 10 NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level Std 7 with Math + Science or NCert NCert: NI -N3 Engineering: Electrical, Motor & Diesel 3 mths per N level (Orientation) N3 NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level Manu Technical College Manu Technical College Std 7 + 16 yrs of age NCert: N2-N3 Business: Business Studies (Secretarial) 1 yr per N level Std 10 with Acc HG 40% or SG SO% NCert: N4 Business: Business Management 6 rnths + 16 yrs of age Std 10 with Acc HG 40% or SG 50% NCert: N4-N5 Business: Management Assistant 6 mths per N level 16 yrs of age Std 7 + 16 yrs of age Initial Course General: Music I yr Std 7 + 16 yrs of age. Music NCert: N2-N3 General: Art, Educare, Music 1 yr per N level option: Audition Std 10 + 16 yrs of age NCert: N4-N6 General: Art 6 mths per N level Mavhoi Technical College Mavhoi Technical College Std 7 with Math + Science or Std NCert: N1 -N3 Engineering: Bricklaying & Concrete Making & Plastering, Carpentry & 3 mths per N level 10 with or without Math Science Joinery&Cabinet Making, Plumbing Std 7 with Math + Science or Std NCert: NI -N3 Engineering: Motor Body Repairs, Motor Mechanical, Welding 3 mths per N level 10 with or without Math + Science Std 7 with Math + Science or Std NCert: N1 -N3 Engineering: Electrical (H/C & L /C), Electronics 3 mths per N level 10 with or without Math + Science Std 10 or N3 with Math NCert N4-N6 Engineering: Electrical (-1/C & L/C) 3 mths per N level Std 10 or N3 with Math NCert: N4-N6 Engineering: Motor Body Repairs, Motor Mechanical 3 mths per N level Std 1 0 or N3 NCert N4-N6 Engineering: Plumbing 3 mths per N level Std 10 or N3 with Math NCert: N4-N6 Engineering: Motor Body Repairs, Motor Mechanical 3 mths per N level Std 7 with Math or Std 10 with or NCert: NI -N3 General: aothing Production 1 yr without Math + Science Std 10 with or without Math + NCert: N4 General: Clothing Production 1 yr Science Middelburg Technical College Middelburg Technical College Std 10 NCert N4 (Introductory) Business 6 mths Std 10, N3 or NSC NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level Qualifications that do not comply Elementary Technical Cert Engineering: Technical with the prerequisites of the National N-courses Elementary Technical Cert or Std 7 NCert: NI -N3 Engineering: Electrical, Mechanical 3 mths per N level with 3 applicable SG subjs N3 or 3 applicable Std 10 SG subjs NCert: N4 (Introductory) Engineering: Electrical, Mechanical 3 mths N3 or 3 applicable Std 10 SG subjs NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level Std 10 NCert: N4 (Introductory) General: Educare 6 mths N4 Introductory (Educare) NCert: N4-N6 General: Educare 6 mths per N level 144 Technical Colleaes 129 Course Field of Study Duration Entry Requirements Mpondozankomo Technical College Mpondozankomo Technical College NCert: N4 (Introductory) Business 6 mths Std 10 NCert: N4-N6 Business: Financial Management, Human Resources Management, 6 mths per N level N4 Introductory Management Assistant NCert: N1-N3 Engineering 3 mths per N level NTC Orientation NTC: Orientation Engineering: Technical 3 mths Std 7 or 16 yrs of age NCert: N4-N6 Engineering 3 mths per N level N3 NCert: N4-N6 General: Educare 6 mths per N level Std 10 Msunduzi College Msunduzi College NIC Business 1 yr Std 7 NSC Business 1 yr NIC NCert: N4 (Introductory) Business 6 mths Std 10 or NSC NCert: N4-N6 Business: Business Management, Human Resources Management, 6 mths per N level Std 10 Legal Secretary, Management Assistant, Marketing Management NCert: Ni -N3 Engineering: Auto Electrical, Electrical, Electronics, Fitting & Machining, 3 mths per N level Introductory Course or Std 8 or Std Motor 9 without Math or Std 10 (LG) NCert: Orientation Engineering 3 mths NCert: N4-N6 Engineering: Electro/Mechanical, Electrical, Mechanical 3 mths per N level N3 Namakwaland College Namakwaland College NCert: NI -N3 Business Std 7 + 16 yrs of age NIC Business Std 7 + 16 yrs of age NSC Business NIC or Std 9 NCert: N4-N6 Business NSC or Std 10 NCert: Ni -N3 Engineering Std 7 + 16 yrs of age NCert: N4N6 Engineering N3 or Std 10 Senior Cert (Std 10) General NIC or Std 9 Nelspruit Technical College Nelspruit Technical College NIC Business 1 yr f/t Std 7 NSC Business 1 yr f/t NIC, N2 or Std 9 with Acc or Typing NCert: N4 (Introductory) Business 6 mths NSC or N3 or Std 10 with 4 subjs 40%(2 on SG), induding the 1st Language and 2 of the following: Econ, Business Econ, Mercantile Law, Acc, Snelskrif, Shorthand, Typing NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level NSC or N3 or N4 Introductory or Std 10 with 4 subjs 40% (2 on SG), including the 1st Language and 2 of the following: Econ, Business Econ, Mercantile Law, Acc, Snelskrif, Shorthand, Typing NCert: N4-N6 General: Tourism 6 mths per N level Std 10 or N3 Newcastle Technical College (Newtek) Newcastle Technical College (Newtek) NIC Business 1 yr Std 7 NSC Business 1 yr . NIC NCert: N4-N6 Business 6 mths per N level Std 10 or N3 NCert: Ni -N3 Engineering: Electrical, Instrumentation, Mechanical 3 mths per N level f/t orStd 7 p/t 145 130 Technical Colleges Course Field of Study Duration' Entry Requirenients Newcastle Technical College (Newtek) Newcastle Technical College (Newtek) NCert: N4-N6 Engineering: Electrical, Instrumentation, Mechanical 3 mths per N level f/t or N3 or Std 10 p/t Hair Care & Cosmetics (Module 1- General: Hair Care & Cosmetics 2 yrs Std 7 6) Northdale Technical College Northdale Technical College NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level Std 10. Business Management and Resources Management, Legal Secretary, Management Assistant, Financial Management options: Marketing Management, Medical Secretary, Public Management, Public Acc HG or SG 4096. Management Relations Assistant, Medical Secretary, Legal Secretary and Public Relations options: Typing HG or SG 40% Std 7, but preferably SW 10 NCert: N2-N3 General: Hair Care & Cosmetics I yr per N level Senior Cert (Std 10) /NSC General 2 yrs Std 7 Std 10 with Typing HG or SG 40% NCert: N4-N6 General: Tourism 6 mths per N level Ntuzuma Technical College & Training Ntuzuma Technical College & Training Centre Centre Std 10 NIC Business 1 yr Std 10 NSC Business I yr Std 7 with Math + Science NCert: N1 -N3 Engineering: Electrical, Motor 3 mths per N level Odi Manpower Centre Odi Manpower Centre NCert: Ni -N3 (Office Practice) Business: Office Practice 3 mths per N level Std 8 Candidate must have passed 4 NCert: N4-N6 Business: Accounting, Legal Practice, Management, Personnel 3 mths per N level Management subjs at N3 level, or Std 10 with 2 commercial subjs Std 7 with Math + Science NCert: NI -N3 Engineering: Civil (Building & Fumiture Trades), Electrical, Mechanical 3 mths per N level (Motor & Metal Trades) Std 7 with Math + Science NCert: N4-N6 Engineering: Civil, Electrical, Mechanical 3 mths per N level Std 7 or equivalent NIC General: Care of Children, Care of the Aged, Care of the Handicapped, yr fit Clothing Production, Ethicare, Food Service SuperVisiOn- NIC or Std 9 or equivalent NSC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr f/t Clothing Production, Educare, Food Service Supervision Paarl College Paarl College Std 7 NIC Business: Accounting, Administrative, Secretarial 1 yr MC NSC Business: Accounting, Administrative, Secretarial I Yr Std 10, NSC or N3 NCert: N4 (Introductory) Business 1 yr Std 10, NSC or N3. Financial NCert: N4-N6 Business: Financial Management, Legal Secretary, Management N4-N6: 2 yrs (bridging Assistant, Marketing Management, Medical Secretary, Personnel course included) Management option: Acc Management, Public Relations SW 7 NIC General: Care of the Disabled, Educare 1 yr NIC NSC General: Care of the Disabled, Educare 1 yr Std 10, NSC or N3 NCert: N4-N6 General: Art & Design, Clothing Production, Educare, Hospitality & 2 yrs (bridging course Catering Services included) Parktown College Parktown College Grade 9 (Std 7) + 16 yrs of age NIC/N2 Business: Accounting, Administrative, Management, Secretarial 1 yr 146 Technical Colleaes 131 Course Field of Study Duration Entry Requirements Parktown College Parktown College NSC/N3 Business: Accounting, Administrative, Management, Secretarial 1 yr Grade 11 (Std 9), N2 or NIC with applicable subjs NCert: N4 (Introductory) Business 6 mths Grade 12 (Std 10), NSC or N3 without applicable subjs NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level N3, NSC or Grade 12 (Std 10) with Resources Management, Marketing Management, Public Management, applicable subjs Public Relations, Business Assistant (Secretarial) NIC/N2 General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr Grade 9 (Std 7) + 16 yrs of age Clothing Production, Educare, Food Services, Hair Care & Cosmetics, Interior Decorating NSC/N3 Genera): Care of Children, Care of the Aged, Care of the Handicapped,1 yr Grade 11 (Std 9), N2 or NIC with Clothing Production, Educare, Food Services, Hair Care & Cosmetics, applicable subjs Interior Decorating NCert: N4 (Introductory) General: Art, Educare, Food Services 6 mths per N level Grade 12 (Std 10) without applicable subjs NCert: N4-N6 General: Art, Catering Entrepreneurship, Clothing Production, Educare, 6 mths per N level N3, NSC or Grade 12 (Std 10) with Hospitality Services, Interior Decorating applicable subjs Phalaborwa College Phalaborwa College NIC Business: Secretarial 1 yr Std 7 NSC Business: Administrative, Secretarial 1 yr NC or Std 9 with Typing + Acc NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level Std 10 with Typing or Acc NCert. Ni -N4 Engineering 3 mths per N level NCert: Orientation Engineering 3 mths Only an aptitude test MC General: Educare 1 yr Std 7 NSC General: Educare 1 yr Std 9 or NIC NCert: N4 (Introductory) General: Educare 6 mths Std 10 NCert: N4-N6 General: Educare 6 mths per N level Std 10 Pinetek Pinetek NIC Business: Secretarial, Accounting, Management I yr Std 7 (no LG subjs) NSC Business: Secretarial, Accounting, Management I yr MC NCert: N4-N6 Business: Financial Management, Legal Secretary, Management 6 mths per N level Std 10 SG. Financial Mangement Assistant, Marketing Management option: Acc + Math SG 40% NC General: Food Service 1 yr Std 7 (no LG subjs) NSC General: Food Service 1 yr NC- NCert: N4-N5 General: Catering Entrepreneurship 6 mths per N level Std 10 with Home Econ SG 40% or NSC/N3 Food Service NCert: N4-N6 General: Tourism 6 mths per N level Std 10 SG* NCert: N6 General: Food Service 6 mths N5 Plessislaer College Plessislaer College NCert: N2-N3 Business 1 yr per N level Std 9 NCert: N4-N5 Business 6 mths per N level N3 NCert: N1 -N3 Engineering: Civil, Electrical, Mechanical 3 mths per N level Std 8 with Math, Phys Sc or Blot Potchefstroom Technical College Potchefstroom Technical College NIC Business: Administrative, Secretarial 1 yr Std 8 + 16 yrs of age NSC Business: Accounting, Administrative, Secretarial 1 yr MC NCert: N4 (Introductory) Business 6 mths Std 10 without commercial subjs NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level Std 10. Seretarial options: Typing Resources Management, Legal Secretary, Management Assistant, (35 w.p.m.) Marketing Management, Public Management NCert: Ni -N3 Engineering 3 mths per N level Std 7 + 16 yrs of age 147 132 Technical Colleges Course Field of Study DUration Entry Requirerrrent Potchefstroom Technical College Potchefstroom Technical College 3 mths per N level N3 or Std 10 (Technical) or Std 10 NCert: N4-N6 Engineering: CMI, Electrical, Electronic, Mechanical (HG) NCert: NI -N3 General: Hair Care 6 mths per N level Std 8 I yr Std 7 + 16 yrs of age NIC General: Cosmetics, Educare 1 yr NIC NSC General: Cosmetics, Educare Std 10 with Eng HG 60% NCert: N4-N6 General: Hospitality Services, Tourism 6 mths per N level Tech-Puk Vocational Preparation General: BA. Course, City & Regional Planning, Economic & 1 yr Std 10 with conditional exemption Programme (These courses qualifyManagement Course (B.Com.), Natural Sciences Course (B.Sc., Pharrn., students for admission to a degreeB.Engineering), Nursing or diploma course at Potch Univ) Potgietersrus Technical College Potgietersrus Technical College Std 7 or Std 8 NIC Business 1 yr 1 yr NIC or Std 9 NSC Business: Accounting, Administration, Management Assistant Std 10, NSC or N3 NCert: N4-N6 Business: Business Management, Management Assistant 6 mths per N level Std 7 NCert: Ni -N3 Engineering: Electrical 3 mths per N level 3 mths per N level N3 NCert: N4-N6 Engineering: Electrical At least 16 yrs of age Senior Cert (Std 10) with or without General 1 yr f/t or p/t university admission 1 yr f/t or p/t At least 16 yrs of age Std 8 General Pretoria College Pretoria College 1 yr Std 7 + 16 yrs of age NIC Business 1 yr NIC or Std 9 with relevant subjs NSC Business Std 10 (LG subjs only acceptable if NCert: N4 (Introductory) Business 6 mths not applicable for course) Std 10 (11G 40% or SG 5030 or N3 NCert: N4-N6 Business: Business Management, Human Resources Management, 6 mths per N level Public Management Std 10 (HG 40% or SG 50%) or N3 NCert: N4-N6 (Distance Education) Business 6 mths per N level Std 7 + 16 yrs of age Hair Care (Module 1 -6) General: Hair Care 1 yr f/t + 2 yrs as apprentice 3 yrs p/t (1 day per week) Std 8 + 16 yrs of age and f/t Hair Care for Apprentices General: Hair Care employed at a hairdressing salon Std 7 + 16 yrs of age NIC General: Clothing Production, Food Service Supervision, Hair Care & 1 yr Cosmetics 1 yr NIC NSC General: Clothing Production, Food Service Supervision, Hair Care & Cosmetics 16 yrs of ages: NSC (Distance Education) General: School Subjects 1 yr Std 9 + 16 yrs of age NSC: School Subjects on SG or HG General: School Subjects Varies (University exemption) Std 10 (but does not qualify for N4 NCert: N4 (Introductory) General: Food Services 6 mths Hospitality Services) 6 mths per N level Std 10 (HG 4096 or SG 50%) or NSC. NCert: N4-N6 General: Educare, Clothing Production, Hospitality Services, Tourism Tourism option: Eng HG 40% or SC 50%. Educare option: Std 10 Pretoria West College of Engineering Pretoria West College of Engineering 3 mths per N level f/t orStd 7 with Math + Science SG (4036 NCert: N1 -N3 Engineering: Civil/Building, Electrical (1/C & L/C), Horticulture, Instrumentation, Mechanical, Motor Mechanical p/t for Horticulture) and 16 yrs of age. Preference to matriculants Students who do not meet the Engineering 3 mths NCert: Orientation required qualifications for Ni 3 mths per N level f/t or N3 or Std 10 with Math + Science NCert: N4-N6 Engineering: Civil/Building, Electrical (H/C & L/C), Instrumentation, Mechanical, Motor Mechanical p/t SG 143 Tear!hninal Colleaes 133 Course Field of Study Duration Entry Requirements Protea College Protea College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7, but preferably Std 8 NSC Business: Accounting, Administrative, Secretarial 1 yr Std 9 (Typing included) or N2 NCert: N4 (Introductory) Business: Marketing Management 6 mths Std 10 NCert: N4-N6 Business: Financial Management, Management Assistant, Marketing 6 mths per N level Std 10 or NSC. Financial Management Management option: Acc 50% NIC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr Std 7 Clothing Production, Educare, Food Services, Interior Decorating NSC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr NIC, N2 or Std 8 Clothing Production, Educare, Food Services, Interior Decorating NCert: N4 (Introductory) General: Clothing Production, Educare, Hospitality Services, Human 6 mths Std 10 Resources Management NCert: N4-N6 General: Clothing Production, Educare, Hospitality Services, Interior 6 mths per N level Std 10, N3 or NSC. Human Decorating, Human Resources Management Resources Management option: Business subjects e.g. Econ, Business Econ, Acc, Typing etc. Queenstown Technical College Queenstown Technical College NIC Business 1 yr Std 7, but preferably Std 8 NSC Business 1 yr NIC or Std 9 NCert: N4 (Introductory) Business: Human Resources Management, Management Assistant, 6 mths Std 10 with no background in Marketing Management Computer Practice and Management subjs at Std 10 level NCert: N4-N6 Business: Human Resources Management, Management Assistant, 6 mths per N level Std 10 (45% av) plus the Marketing Management Introduction Course, N3 or Std 10 with at least Information Processing, Computer Practice, Office Practice and Small Business as subjs R.M. Mshuqwana Technical College R.M. Mshuqwana Technical College NIC Business 1 yr Std 7 with Math + commercial subjs NSC Business 6 mths NIC NCert: NI -N3 Engineering: Electrical Trade, Carpentry & joinery, Motor Mechanics N1: 6 mths. N2-N3: 3 Std 7 with Math + Science mths per N level Randfontein College Randfontein College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 or 16 yrs of age NSC Business: Accounting, Administrative, Secretarial 1 yr NIC or Std 9 NCert: N4-N6 Business: Human Resources Management, Legal Secretary, 6 mths per N level Secretarial options: SW 10 or NSC Management Assistant, Public Relations Secretary Business Studies. Human Resources Management option: SW 10 with Econ + Business Econ SG 5096or NSC Business Studies NCert: NI -N3 Engineering: Chemical (Metallurgy), Electrical, Electronic, Mechanical 3 mths per N level Std 7 + 16 yrs of age NCert: N4-N6 Engineering 6 mths per N level N3 or SW 10 with Math + Phys Sc SG 50% Senior Cert (Std 10) General Roodepoort College Roodepoort College NIC Business 1 yr f/t (also available p/t) Std 7 SG NSC Business: Administrative, Secretarial 1 yr f/t (also available p/t) Std 9 with Acc or Typing NCert: N4-N6 Business: Legal Practice, Management Assistant, Public Relations 6 mths per N level f/t Std 10 or N3 or N4 Introductory (also available p/t) 149 134 Technical Colleges Course Field of Study Duration Entry ReqUireMents Roodepoort College Roodepoort College NCert: N4-N6 Business: Business Management 6 mths per N level f/t Std 10 or N3 (50% av). Acc or (also available p/t) Applied Acc SG where applicable + Math 60% for Financial Acc or Computerised Financial Systems NCert Ni -N3 (Introductory Engineering: Electrical, Electronic, Mechanical 3 mths per N level Std 7 Course included) NCert: N4-N6 Engineering: Electrical, Electronic, Management, Mechanical 3 mths per N level N3 NIC General: Art, Child Care, Hair Care & Cosmetics 1 yr Std 7 NSC General: Art, Educare, Hair Care & Cosmetics 1 yr NIC (Art) or Std 9 with appropriate subjs NCert: N4 (Introductory) General: An, Catering, Educate, Hospitality Services, Tourism 6 mths SW 10 or N3 NCert: N4-N6 General: Art, Catering, Educare, Hospitality Services, Tourism 6 mths per N level Std 10 or N3 or N4 Introductory. Tourism option: Eng SG 60% Russel Road College Russel Road College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 + 16 yrs of age NIC/N2 NSC Business: Accounting, Administrative, Secretarial 1 yr NCert N4 (introductory) Business: Business Studies 6 mths N3, NSC or SW 10. Introductory Acc option: Acc NCert: N4-N6 Business: Financial Management, Management Assistant, Marketing 6 mths per N level NSC, Std 10 or N3 Management Motor, Diesel & Tractor Course Engineering: Motor, Diesel & Tractor 3 mths per level 16 yrs of age. Previous (1&2) qualifications will determine entry level NCert: N1-N3 Engineering: Electrical, Electronic, Mechanical 3 mths per N level 16 yrs of age. Previous qualifications will determine entry level NCert N4-N6 Engineering: Electrical, Electronic, Mechanical 3 mths per N level N3 NIC General: Art & Design, Food Services, Hair Care & Cosmetics, Interior 1 yr Std 7 + 16 yrs of age Decorating MC NSC General: An & Design, Food Services, Hair Care & Cosmetics, Interior 1 yr Decorating NCert: N4 (Introductory) General: Art & Design, Food Services, Interior Decorating 6 mths NSC or Std 10 NCert N4-N6 General: Art & Design, Hospitality & Catering Services, Interior 6 mths per N level Std10 with:prescribed subjs or N4 Decorating IntroduCtory. Art& Design option: SW 10 with bask portfolio Rustenburg Technical College Rustenburg Technical College NIC Business 1 yr f/t Std 7 NIC, N2 or SW 9 with Acc or NSC Business 1 yr f/t Typing SG' NCert: N4 (Introductory) Business 6 mths NCert N4-N6 Business: Business Management, Human Resources Management, 6 mths per N level NSC or N3 or SW 10 (SQ or 4 SW Management Assistant, Marketing Management 10 subjs with 40% per sub] NCert: NI -N3 Engineering: Electrical, Mechanical 3 mths per N level f/t or p/t NCert N4-N6 Engineering: Electrical, Mechanical 3 mths per N level f/t or p/t Std 7. Music and Light Music NIC General: Hair Care & Cosmetics, Light Music, Music 1 yr f/t options: Practical Music Grade 4 5 + Theory of Music Grade 3 - 4 NIC NSC General: Hair Care & Cosmetics, Light Music, Music 1 yr f/t Sasolburg College Sasolburg College Std 10 or NSC NCert: N4 (Introductory) Business: Business Assistant 6 mths 150 Technical-Colleges 135 Course Field of Study Duration Entry Requirements Sasolburg College Sasolburg College NCert: N4-N6 Business: Business Assistant, Business Management, Marketing 6 mths per N level Business Assistant option: Std 10 Management with Typing. Business Management option: Std 10 with Acc SG 40% Marketing Management option: Std 10 with Econ or Business Econ SG 40% NCert: NI -N3 General: Clothing Production 1 yr per N level Std 7 for N2. Std 8 for N3 NCert: N2-N3 General: Educare 1 yr per N level Std 7 + 16 yrs of age NCert: N4 (Introductory) General: Clothing Production 6 mths Std 10 NCert: N4-N6 General: Clothing Production, Educare 6 mths per N level Std 10. Clothing Production option: N4 Introductory Shikoane Matlala Technical College Shikoane Matlala Technical College NCert: N4 (Introductory) Business 6 mths NSC NCert: N4-N6 Business: Management Assistant 6 mths per N level N4 Introductory NCert: NI -N3 Engineering: Building & Civil, Electrical, Laboratory Assistants, 3 mths per N level Std 7 with Math + Phys Sc. The Mechanical, Water Purification Operators Water Purification course is for employees from Govemment Services, local authorities and private sector. No private students can be accepted NCert: N4-N6 Engineering: Building & Civil, Electrical, Laboratory Assistants, 3 mths per N level N3 Mechanical, Water Purification Operators Sivuyile College Sivuyile College NIC/N2 Business I yr Std 7 NSC/N3 Business 1 yr Std 9 NCert: N4 (Introductory) Business 6 mths or 1 yr Std 10 NCert: N4-N6 Business: Personnel Management, Secretarial Secretarial: 6 mths or 1 yr NSC, N3 or the Introductory per N level. Personnel Course Management: 6 mths per N level NCert: N1-N3 Engineering: Bricklaying, Carpentry, Electrical Work, Motor Mechanics 3 mths per N level Std 8 with Math + Science NCert: N4-N6 Engineering: Civil, Electrical, Mechanical 3 mths per N level N3 or Std 10 with Math + Science NCert: N4-N5 General: Tourism 1 yr NSC, N3 or the Introductory Course NHCert: N6-N7 General: Tourism 1 yr N5 (Tourism) South Peninsula College South Peninsula College Senior Cert (Std 10)/NSC Business: Accounting, Administrative, Secretarial 2 yrs f/t or p/t Std 7 NCert: N4 Business: Computer Practice & Accounting, Marketing Management, 6 mths p/t Std 10 Secretarial NCert: N4-N6 Business: Business Management, Financial Management, Marketing 3 yrs p/t Std 10 Management, Secretarial NCert N4-N6 Business: Computer Practice & Accounting, Marketing Management, 6 mths per N level f/t Std 10 Secretarial Studies St Oswald's Technical College St Oswald's Technical College MC Business 1 yr f/t Std 7 with general subjs NSC Business 1 yr f/t Std 9 or NIC with Acc SG 40% NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level Std 10 with general subjs or NSC Resources Management (Business Studies). Financial Management option: Acc SG 40% 151 136 Technical Colleges Entry RequireMents St Oswald's Technical College St Oswald's Technical College NCert: N1 -N3 Engineering: Electrical, Mechanical 3 mths per N level Electrical option: Std 8 with Math 40%+ Engineering Sc 40%. Mechanical option: Std 8 with Math 40%+ Physics 40% Orientation Course Engineering 3 mths Std 7 with Math + General Science + 16 yrs of age NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level Electrical option: N3 with Electrical Trade Theory 4094 Industrial Electronics 4096, Engineering Sc 40% and Math 40% Mechanical option: N3 with Mechanotedinology 4094 Engineering Sc 40%, Math 40% and Engineering Drawing 40% Standerton Technical College Standerton Technical College NIC Business: Accounting, Administrative, Secretarial 1 yr Std 7 NSC Business: Accounting, Administrative, Secretarial I yr NIC NCert: N4 (Introductory) Business: Business Studies 6 mths Std 10 without applicable subjs NCert: N4-N6 Business: Management Assistant 6 mths per N level Std 10 with applicable subjs, NSC or N4 (Introductory) NCert: NI -N3 Engineering: Electrical, Mechanical 3 mths per N level Std 7 with Math + Phys Sc NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 Stellenbosch College Stellenbosch College NCert: N4-N6 Business: Financial Management, Legal Practice, Management N4NS: 1 yr f/t; N6: 1 yr Std 10 (40% av). Financial Assistant, Marketing Management, Public Relations f/t Management option: Acc NCert: N4-N6 General: Educare, Hospitality Services, Tourism 6 mths per N level Std 10 (4096 av) Strand Technical College Strand Technical College NIC Business: Management, Secretarial 1 yr Std 7 MC or 5 subjs of MC NSC Business: Management, Secretarial 2 yrs NCert: N4-N6 Business: Management, Secretarial 6 mths per N level Std 10 Swinton Road Technical College Swinton Road Technical College NIC Business: Secretarial I yr Std 10 or NIC NSC Business: Secretarial 1 yr NCert: Ni -N3 Engineering: Boiler-making, Bricklaying, Carpentry, Civil, Electrical, 3 mths per N level Std 7 and 16 yrs of age or the Fitting, Motor Mechanical, Mechanical, Plumbing- NCert (Orlentation)-- NCert: N4-N6 Engineering: CM!, Electrical, Mechanical 3 mths per N level N3 Technical College of South Africa Technical College of South Africa (Technisa) (Technisa) NCert N2-N3 Business: Accounting, Administrative, Secretarial 1 yr per N level Std 7 Std 7 NIC Business: Accounting, Administrative, Secretarial I yr I yr NIC NSC Business: Accounting, Administrative, Secretarial NSC, N3 or Std 10 NCert: N4-N6 Business: Legal Secretary, Management Assistant 3 mths per N level Cert in Combustion Principles & Engineering: Combustion Principles & Practice Practice Technical Colleaes 152 137 Course Field of Study Duration Entry Requirements Technical College of South Africa Technical College of South Africa (Technisa) (Technisa) NCert Engineering: Mining, Paint Technology, Pest Control, Pulp & Paper Mining and Textile Manufacturing Making, Textile Manufacturing options: Std 7 with Math + Phys Sc. Paint Technology option: Std 8 with Math + Phys Sc or NI with Math, Engineering Sc + Industrial Chemistry. Pest Control option: Std 8 or N1. Pulp & Paper Making: Std 7 NCert: N1 -N3 Engineering: Building, Electrical, Electronics, Mechanical, Power Station3 mths per N level Std 7 or NCert (Orientation) or ET5 Operators, Water Treatment (Elementary Technisa Studies) NCert: N4-N6 Engineering: Engineering Studies 3 mths per N level N3 or Std 10 with appropriate subjs Cert in Funeral Directing General: Funeral Directing Std 8 Elementary Technisa Studies (ETS)General Students without Std 7 Hair Care for Apprentices (Module General: Hair Care 2 yrs Registration with the Industrial 1-6) Council for Hair Care as an apprentice NIC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr Std 7 Educare, Hair Care NSC General: Care of Children, Care of the Aged, Care of the Handicapped,1 yr NIC Educare, Hair Care NCert: N4-N6 General: Hair Care 6 mths per N level Std 10 or N3 Tosa Technical College Tosa Technical College NIC Business: Accounting & Administrative, Secretarial I yr Std 7 or Std 8 + 16 yrs of age NSC Business: Accounting & Administrative, Secretarial 1 yr NIC or Std 9 with appropriate subjs NCert: N4 (Introductory) Business 6 mths Std 10 with appropriate subjs or N3 NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level f/t orStd 10 with appropriate subjs or Resources Management, Management Assistant, Marketing p/t N3 Management, Public Management NCert: NI -N2 Engineering 3 mths per N level Std 7 or Std 8 + 16 yrs of age NCert: N3 Engineering 3 mths per N level N2 or Std 9 with applicable subjs NCert: N4-N6 Engineering 3 mths per N level f/t orStd 10 with appropriate subjs or p/t N3 NIC General: Educare, Food Services, Hair Care & Cosmetics 1 yr Std 7 or Std 8 + 16 yrs of age NSC General: Educare, Food Services, Hair Care & Cosmetics 1 yr NIC or Std 9 with appropriate subjs NCert: N4 (Introductory) General: Educare 6 mths Std 10 with appropriate subjs or N3 NCert: N4-N6 General: Educare, Food Services 6 mths per N level f/t orStd 10 with appropriate subjs or p/t N3 Tygerberg College Tygerberg College NSC Business: Administrative, Secretarial 2 yrs Std 8 IAC Dip Business: Accounting, Business Management, Company Secretaries, 3 yrs Std 10. Acc, Company Secretary + Cost & Management Accounting, Industrial Relations, Marketing Cost and Management Acc option: Management, Personnel Management Std 10 Acc NCert: N4 (Introductory) Business: Management, Marketing Management, Public Management, 6 mths Std 10 Secretarial NCert: N4-N6 Business: Computer Secretary, Financial Management, Human 6 mths per N level N3 (Commerce) or Std 10. Resources Management, Legal Secretary, Management Assistant, Financial Management option: Acc Marketing Management, Medical Secretary, Public Management, Public or equivalent Relations Hair Care for Apprentices General: Hair Care I yr f/t or 3 yrs p/t Std 8 Music Course General: Music Std 8 NSC General: Care of the Aged, Educare 2 yrs Std 8 NCert: N4-N6 General: Educare 6 mths per N level f/t or 1Std 10 yr per N level p/t NCert: N4-N6 General: Tourism 6 mths per N level Std 10 (60% av) with Eng HG 50% and strong language proficiency 153 138 Technical Colleges CourS'e Field of Study Duration Entry Requirements Tygerberg College Tygerberg College NCert: N4-N6 General: Food Services & Clothing 6 mths per N level Tzaneen College Tzaneen College NIC Business: Accounting, Administrative, Secretarial Std 7 or Std 8 NSC Business: Accounting, Administrative, Secretarial NIC or Std 9 NCert: N4-N6 Business: Business Management, Secretarial Std 10 NCert: Ni -N3 Engineering: Electrical 3 mths per N level Std 7 with Math + Phys Sc + entrance examination Umlazi Technical College Umlazi Technical College NCert: N2-N3 Business: Business Management 1 yr per N level Std 10 NCert: NI -N3 Engineering: Civil, Electrical, Laboratory Assistant, Mechanical, Plant 3 mths per N level Std 8 with Math + Science Operators, Water Treatment NCert: N4-N6 Engineering: Civil, Electrical, Mechanical 3 mths per N level N3 with appropriate subjs Upington College Upington College NIC Business I yr Std 7 NSC Business 1 yr NIC NCert: N4-N6 Business: Business Management, Legal Secretary, Management N4-N5: 6 mths per N Std 10 Assistant, Marketing Management, Public Relations level; N6: 1 yr NCert: N4-N6 General: Catering, Educare N4 + N5: 6 mths each; Std 10 N6: 1 yr Van Der Bijlpark College Van Der Bijlpark College NIC Business 1 yr NSC Business 1 yr NIC NCert: N4 (introductory) Business 6 mths f/t Std 10 NCert: N4-N6 Business: Business Management, Financial Management, Human 6 mths per N level Std 10, N3 or N4 Introductory. Resources Management, Legal Secretary, Management, Management Secretarial option: Typing or Acc Assistant, Marketing Management, Medical Secretary, Public Management, Public Relations NCert: N1 (Introductory) Engineering NCert: N1-N3 Engineering: Electrical, Mechanical Std 7 with Math + Phys Sc + 16 yrs of age NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 or Std 10 (Technical) with 3 appropriate subjs NIC General: Art, Clothing Production 1 yr Std 7 NSC General: Art, Clothing Production 1 yr Std 7 for Art. NICfor Clothing. Production NCert: N4 (Introductory) General: Art 1 yr Std 10 NCert: N4-N6 General: Clothing Production, Fine Art, Graphic Design 6 mths per N level NSC or N3 with portfolio of Art Vereeniging College Vereeniging College NCert Business: Computer Studies NCert: N2-N3 Business: Secretarial I yr Std 7 + 14 yrs of age NIC Business 1 yr Std 7 + 14 yrs of age NSC Business: Secretarial 1 yr Std 7 + 14 yrs of age NCert: N4 (Introductory) Business 6 mths Std 10 with Eng SC NCert: N4-N6 Business: Management Assistant 6 mths per N level Std 10 + appropriate subjs Introductory Course Engineering 154 Technical Colleges 139 Course 'Field of Study Duration Entry Requirements Vereeniging College Vereeniging College NCert: N1-N3 Engineering: Electrical, Mechanical 3 mths per N level Std 7 NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 Cert: Hair Care & Cosmetics General: Hair Care & Cosmetics 2 yrs f/t or 3 yrs p/t for F/t: Std 7. P/t: Std 8 or N2 in Hair apprentices Care & Cosmetics NIC/N2 General: Food Service Supervision 1 yr NSC/N3 General: Food Service Supervision 1 yr N2 NCert: N4-N6 General: Catering Entrepreneurship 6 mths per N level Std 10 Western Province Technical College Western Province Technical College Elementary Technical Cert Engineering: Technical Students without Std 7 Math and Science NCert: Ni -N3 Engineering: Building & Civil, Electrical, Horticulture, Mechanical, Motor 3 mths per N level Std 7 or 16 yrs of age Mechanics NCert: N4-N5 (Multi-DisciplinaryEngineering: Multi-Disciplinary Drawing Office Practice 3 mths per N level N3 Drawing Office Practice) NCert: N4-N6 Engineering: Building & Civil, Electrical, Mechanical, Motor Mechanics 3 mths per N level N3 with 3 applicable subjs Westlake Technical College Westlake Technical College Modular Based Practical Training Engineering: Boiler-maker/Plater & Welder, Carpenter & Joiner /Wood The number of Practical ability plus Std 8 with (Basic Level 1&2) Machinist, Electrical & Electronics, Fitter & Turner, Motor & Diesel prescribed modules Math + Phys Sc or N2 for Mechanic, Motor Body Repairer & Spray - painter, Plumber & Sheetmetal completed by trimester Engineering Studies Worker depends on the working ability and productivity of the student NCert: N1-N3 Engineering: Building, Electrical, Mechanical, Motor Mechanics 3 mths per N level 8 with Math + Phys Sc or Std 7 with Math + General Sc + 16 yrs of age + the NCert (Orientation) NCert: Orientation Engineering 3 mths Wingfield Technical College Wingfield Technical College NCert: Ni -N3 Engineering: Electrical, Mechanical 3 mths per N level Std 7 and/or 16 yrs of age with Math + Science 40%SG NCert: N4-N6 Engineering: Electrical, Mechanical 3 mths per N level N3 Adult Basic Education & Training General: Basic Skills, Languages, Mathematics People with no schoolteaching or teaching only up to Std 2 Worcester College Worcester College NCert/NHCert: Farm Management Business: Farm Management NCert: 1 yr; NHCert: 1 yrN3 or Std 10 (40% av) + 4 subjs on HG or SG NCert: N4-N6 Business: Business Management, Financial Management, Marketing N4-N5: 1 yr f/t; N6: 1 yr N3 or Std 10 (40% av) + 4 subjs on Management f/t (certain p/t courses HG or SG available) NCert: N4-N6 Business: Legal Secretary, Management Assistant, Public Relations N4-N5: 1 yr f /t; N6: 1 yr N3 (Commerce) or Std 10 f/t (certain p/t courses available) 155 140 Technical Colleges Introduction Once you have selected a suitable career and the type of tertiary institution you wish to attend, you need to start thinking about how you will finance your studies. Lack of funds should not prevent you from attaining your goal. No deserving student should be unable to further his or her education on account of financial restraints. FINANCIAL ASSISTANCE There are several ways in which you can fund your studies. You may choose to work before you begin your studies, save your money and then pay for your studies yourself. You can also study part-time or work part- time in order to finance your studies. Alternatively, you can apply for a scholarship, bursary or loan. A scholarship is a form of financial assistance given to scholars who have achieved outstanding aca- demic results. This means that you must have obtained high marks in matric in order to qualify for a scholar- ship. Employment conditions are not usually attached to a scholarship. Financial aid differs from one scholar- ship to another. Some forms of aid provide for tuition and books only, whereas others cover all expenses. A bursary is usually awarded on merit but may also be given to any promising student who needs the money. Bursaries sometimes have specific conditions attached to them. For example, you may have to work for the company that awarded the bursary during university holidays or for a specified period once you have completed your studies.Bursaries are awarded for one year, two years or for the entire period of study de- pending on your academic achievement. The amount of money differs from one bursary to another and may or may not cover all your expenses. If you are unable to obtain a scholarship or a bursary, you may apply for a loan at a bank, training insti- tution or university at a relatively low interest rate. However, it may be difficult to obtain a loan for your first year of study. Remember that you have to repay the loan, usually after completion of yourstudies.It is im- portant to find out how much interest you will have to pay. The institution awarding the loan will also need someone other than yourself to guarantee that the money will be repaid if you are unable to repaythe loan. Remember to apply for scholarships, bursaries or loans in good time. The application form must be obtained, completed and submitted before the closing date indicated for the award. Do not apply for bursaries and loans for which you are not eligible as bursary donors usually adhere strictly to the conditions thereof. How to use this section The aim of this section is to provide a summary of the financial assistance that is available for obtaining a cer- tificate, diploma or degree at a university, college or technikon. The bursaries, loans and other forms of finan- cial aid are arranged in alphabetical order. The following suggestions will help you find information on the awards: Awards are usually offered for a specific field of study and the index of fields of study is a useful aid for tracing the awards. Look for the field of study in which you are interested and consult the page numbers in order to locate the awards. Many awards are not connected to a specific field of study. These awards are listed under the section "Any field of study". Use the index of institutions where awards are tenable in the same way as the index of fields of study. 1.3G Rlircaripg 141 A.E. ROSENZWEIG BURSARY Closing date: 30 September University of Pretoria Field of study Any field of study Further information: PRETORIA 0002 Value: Approximately R2 000 The Senior Assistant Registrar Duration: 1 year, renewable for 3 years Financial Aid and Scholarships AGAR HAMILTON TRUST BURSARY Tenable at: University of Stellenbosch University of the Witwatersrand Field of study. Any field of study Eligibility Awarded on the basis of merit and financial Private Bag 3 Value: Amount varies need to a first-year student from the Free State WITS 2050 Duration: 1 year, renewable if progress is satisfactory Service contract: None Tenable at Any tertiary institution Closing date: 15 January ABSA BANKING GROUP (LOANS) Eligibility. A needy SA English-speaking male, under Further information: Field of study. Any field of study 25 years, who is a member of the Anglican Church, The Registrar (Bursaries and Loans) Value: Amount varies predominantly of British descent and of good University of Stellenbosch Tenable at: Any tertiary institution in SA character Private Bag X1 Eligibility. Undergraduate students Service contract: None MATIEIAND 7602 Service contract: No Closing date: 15 November Closing date: Contact any ABSA branch Further information: A.L. NORDEN EDUCATIONAL TRUST BURSARY Further information: The Administrator Field of study. Any field of study Any ABSA branch The Agar Hamilton Trust Value: At the discretion of the University PO Box 206 Duration: 1 year, renewable subject to continued ACHIEVEMENT BURSARY (PROSPECTIVE CAPE TOWN 8000 financial need, satisfactory academic performance STUDENTS) and availability of funds Field of study. Any field of study AGGREY FUND Tenable at: University of the Witwatersrand Value: R750 R6 500, depending on symbols of the Field of study. Any field of study Eligibility Awarded on the basis of financial need and 6 best matric subjects Value: Amount varies academic performance. Preference will be given to Duration: 1 year Duration: 1 year sons of widowed mothers, whose intelligence, ability Tenable at: University of Pretoria Tenable at: Any tertiary institution and character would justify promoting their further Eligibility. Matriculants who obtained six or more Eligibility. Aglican Communicant pupils and students education at University distinctions in the matric final examination in Diocese of Pretoria ONLY. For Std 9 10 pupils and Service contract: None Service contract None students for study at a college, technikon or univer- Closing date: 30 September Closing date: 15 October sity Further information: Further information: Service contract: None The Senior Assistant Registrar The Head: Study Financing Closing date: 1 April (forms available between 1 Financial Aid and Scholarships University of Pretoria January and 31 March each year only) University of the Witwatersrand PRETORIA 0002 Further information: Private Bag 3 The Secretary WITS 2050 ACHIEVEMENT BURSARY (SENIOR UNDER- Aggrey (Anglican) Bursary Fund GRADUATE STUDENTS) Diocese of Pretoria ABELIS LEIBOVICIUS BURSARY Field of study. Any field of study PO Box 1032 Field of study. Any field of study Value: RI 600R3 800, depending on applicable PRETORIA 0001 Value: At the discretion of the University previous achievements Information not confirmed Duration: 1 year, renewable Duration: 1 year Tenable at University of the Witwatersrand Tenable at: University of Pretoria AKASIA CITY COUNCIL BURSARY Eligibility. Awarded on the basis of financial need and Eligibility. Awarded on the basis of academic merit to Field of study. Any field of study academic performance to undergraduate students students from the second year of study Value: Determined annually Service contract None Service contract: None Duration: 1 year, renewable on reapplication Closing date: 30 September Closing date: 15 October Tenable at Technikon Pretoria Further information: Further information: Eligibility Awarded on the basis of outstanding The Senior Assistant Registrar The Head: Study Financing academic performance and financial need to a Financial Aid and Scholarships University of Pretoria registered full-time student who is a bona fide University of the Witwatersrand PRETORIA 0002 resident of Akasia Private Bag 3 Closing date: 30 September (year) and 30 April MIS 2050 AFRIKAANSE SAKEKAMER PIETERSBURG- (semester courses in the same year) BEURSFONDS Further information: ABRAHAM AND SARAH SKAPINKER BURSARY Field of study. Any field of study The Chairman: Bursary Committee FUND Value: Amount varies Technikon Pretoria Field of study Any field of study Duration: 1 year Private Bag X680 Value: At the discretion of the University up to a Tenable at: University of Pretoria PRETORIA 0001 maximum of the tuition fees payable Eligibility. Awarded on the basis of academic Duration: 1 year, renewable achievement and financial need to full-time students ALFRED BEIT SCHOLARSHIP Tenable at: University of the Witwatersrand from the Pietersburg distict Field of study. Any field of study Eligibility. Awarded on the basis of financial need and Service contract: None Value: RI 000 p.a. academic performance to students of the Hebrew Closing date: 15 October Duration: 1 year faith Further information: Tenable at Rhodes University Service contract: None The Head: Study Financing Eligibility Awarded on the basis of first-year results. Value: Amount varies ALLAN AND GERRY SIMPSON MEMORIAL Holders must proceed to a degree at Rhodes Duration: 1 year, renewable if progress is satisfactory BURSARY University Tenable at Any tertiary institution Field of study. Any field of study Service contract: None Eligibility. Students in the second and subsequent Value: R400 p.a. Closing date: 1 December years of study Duration: 1 year only Further information: Service contract: None Tenable at University of the Witwatersrand The Financial Aid Officer Closing date: 31 October Eligibility. Awarded on the basis of financial need and Rhodes University Further information: academic performance to second-year students of P 0 Box 94 The Honorary Secretary any race, colour or religion. Preference to students GRAHAMSTOWN 6140 Aligarh Old Boys Scholarship Trust who believe in racial harmony in the world, equal Information not confirmed PO Box 42406 opportunities and education for all. Students are FORDSBURG 2033 required to submit a covering letter with the applica- ALIGARH OLD BOYS SCHOLARSHIP TRUST Information not confirmed tion form declaring their views on this matter Field of study. Any field of study Service contract: None 157 142 Closing date: 30 September Further information: I APOSTOLIC FAITH MISSION OF SA BURSARY Further information: The Administrator Field of study. Any field of study The Senior Assistant Registrar Amatie Memorial Scholarship Value: R860 to R8 030 p.a. Financial Aid and Scholarships PO Box 21111 Duration: 1 year, renewable University of the Witwatersrand DURRHEIM 7491 Tenable at Rand Afrikaans University Private Bag 3 Information not confirmed EligibilityFull-time undergraduate and postgraduate WITS 2050 students who are members of the AFM Church AMRIT BHOWAN MEMORIAL SCHOLARSHIP Service contract: None ALLIED BANK STUDENT LOANS FUND Closing date: 15 November Field of study. Any field of study Field of study. Any field of study Further information: Value: Amount and interest rates depends on field of Tenable at: Peninsula Technikon The Registrar (Finance) study and academic year Eligibility. Students who intend to do the National Rand Afrikaans University Duration: 1 year, renewable for duration of the Diploma course PO Box 524 course, provided the student passes Service contract: None AUCKLAND PARK 2006 Tenable at: Any university, technikon or college of Further information: education in South Africa The Secretary ARTHUR AIKEN SCHOLARSHIP Eligibility: First-year students at university with at Amrit Bhowan Memorial Field of study. Any field of study least a C symbol average in the matriculation Scholarship Fund Value: R1 250 p.a. examination or first-year students at technikon with P 0 Box 42375 Duration: 1 year, renewable for a further 2 years if at least a D symbol average in the matriculation FORDSBURG 2033 progress is satisfactory examination or senior students with at least a D Information not confirmed Tenable at: University of the Witwatersrand symbol average in the previous year of study Eligibility. Awarded on the basis of outstanding Service contract: None ANALENE DU PLESSIS MEMORIAL TRUST academic performance to full-time students as from Closing date: None Field of study. Any field of study the second year of study Further information: Value: Amount varies Service contract: None Any Allied Bank branch Duration: 1 year Closing date: 10 January Information not confirmed Tenable at: Potchefstroom University for CHE Further information: Eligibility. Awarded on the basis of academic The Financial Aid & ALUMNI FUND BURSARY achievement and financial need Scholarships Office Field of study. Any field of study Service contract: None University of the Witwatersrand Value: R10 000 Closing date: 15 October PO Box 3 Duration: 1 year Further information: WITS 2050 Tenable at University of the Witwatersrand The Director (Bursaries and Loans) Eligibility Awarded on the basis of financial need and PU for CHE ASICS SOCCER BURSARIES academic performance Private Bag X6001 Field of study. Any field of study Service contract: None POTCHEFSTROOM 2520 Value: Not specified Closing date: 30 September Duration: 1 year, renewable on reapplication for the Further information: ANDRIES OLIVIER BURSARIES (ANDRIES OLIVIER duration of the course subject to satisfactory The Senior Assistant Registrar YSTERKOPPE, VICTORIA-WES FONDS) academic and soccer performance Financial Aid and Scholarships Field of study Any field of study Tenable at: University of the Witwatersrand University of the Witwatersrand Value: Amount varies Eligibility Awarded on the basis of outstanding ability Private Bag 3 Duration: 1 year, renewable in soccer and satisfactory academic performance to MTh 2050 Tenable at: University of Cape Town registered students, full-time or part-time Eligibility. Preference to students in any year of study Service contract: None ALUMNI SPORT BURSARIES with the surname of Olivier from Victoria West or Closing date: 10 January Field of study. Any field of study Cape Platteland and who are supporters in general of Further information: Value: Not specified the political principles of the late General Smuts The Senior Assistant Registrar Duration: 1 year, renewable on reapplication for the Service contract: None Financial Aid and Scholarships duration of the course subject to satisfactory sporting Closing date: 15 October University of the Witwatersrand and academic ability Further information: Private Bag 3 Tenable at University of the Witwatersrand Kempen & Kempen WITS 2050 Eligibility. Awarded on the basis of sporting excel- PO Box 24 lence and satisfactory academic performance to full- VICTORIA WEST 7070 ASSOCIATION OF HELENES FROM EGYPT AND time or part-time students. Financial need will be Information not confirmed SUDAN BURSARY FUND taken into account if there are two students of equal Field of study. Any field of study sporting and academic ability ANGLO AMERICAN CORPORATION OPEN Value: RI 000 p.a. Service contract: None SCHOLARSHIP Duration: 1 year, renewable annually for the duration Closing date: 10 January Field of study Any field of study of the course Further information: Value: Tuition and residence fees plus a cash Tenable at: University of the Witwatersrand The Senior Assistant Registrar allowance of R6 000. One return airfare from Eligibility Awarded on the basis of financial need and Financial Aid and Scholarships Johannesburg to London during year of study academic performance to male or female candidates University of the Witwatersrand Duration: Renewable annually for the duration of the domiciled in SA. The candidate's home language Private Bag 3 course if progress is satisfactory must be Greek and parents must be of Greek origin, WITS 2050 Tenable at: Any university in SA preferably born in Egypt or Sudan Eligibility. Prospective students who are in matric and Service contract: None AMATIE MEMORIAL SCHOLARSHIP have high intellectual and academic ability (three or Closing date: 30 September Field of study. Any field of study more distinctions) and who may be expected to Further information: Value: R2 500 p.a. become leaders in the career of their choice. Available The Senior Assistant Registrar Duration: 1 year to citizens or permanent residents of SA Financial Aid and Scholarships Tenable at University of Cape Town, Stellenbosch Service contract: None University of the Witwatersrand and Westem Cape, Cape Technikon, Peninsula Closing date: 30 September Private Bag 3 Technikon, ICOSA Further information: WITS 2050 Eligibility. Awarded on the basis of leadership The Scholarship & Bursary Unit potential and academic merit to female students of Anglo American Corporation of SA Ltd ATHLETICS BURSARY FUND the Islamic faith as from the second year of study PO Box 61587 Field of study Any field of study Service contract: None MARSHALLTOWN 2107 Value: Not specified Closing date: 31 December 153 Bursaries 143 Duration: 1 year, renewable on reapplication for the AVRIL FRIEDA MALAN STUDY LOAN FUND Town Council of Bedfordview duration of the course subject to satisfactory Field of study. Any field of study PO Box 3 performance Value: Maximum of R6 160 p.a. BEDFORDVIEW 2008 Tenable at University of the Witwatersrand Duration: 1 year, renewable Information not confirmed Eligibility. Awarded to full-time or part-time students Tenable at Rand Afrikaans University with outstanding ability in athletics and adequate Eligibility. Full-time promising, needy students of BENJAMIN AND MIRIAM DRIEBAND BURSARY academic ability strong character FUND Service contract: None Service contract. None Field of study: Any field of study Closing date: 10 January Closing date: 15 November Value: At the discretion of the University Further information: Further information: Duration: 1 year The Senior Assistant Registrar The Registrar (Finance) Tenable at University of the Witwatersrand Financial Aid and Scholarships Rand Afrikaans University Eligibility. Awarded on the basis of financial need and University of the Witwatersrand PO Box 524 academic performance to students of any population Private Bag 3 AUCKLAND PARK 2006 group or religion WITS 2050 Service contract: None B,SM AND HC GOLDSTEIN BURSARY Closing date: 30 September ATKB REDENAARSKOMPETISIE-BEURS Further information: Field of study. Any field of study The Senior Assistant Registrar Field of study. Any field of study Value: Amount varies Financial Aid and Scholarships Value: Winner: RI 000; runner-up: R500 Duration: 1 year, renewable University of the Witwatersrand Tenable at: Potchefstroom University for CHE Tenable at Any university Eligibility Winner and runner-up of the Afrikaanse Eligibility. Awarded on the basis of academic Private Bag 3 Taal- en Kultuurbond orator competition achievement and financial need to undergraduate WITS 2050 Service contract: None students as from the second year of study onwards. BENNO AND LEAH MARGULIES BURSARY Closing date: 15 October Students must be SA citizens Further information: Service contract None Field of study Any field of study The Director Closing date: Contact the university concerned Value: At the discretion of the University Bursaries and Loans Further information: Duration: 1 year, renewable PU for CHE The Registrar of the university concerned Tenable at University of the Witwatersrand Private Bag X60001 Eligibility. Awarded on the basis of financial need and POTCHEFSTROOM 2520 BACHE BABOO BENEVOLENT FUND academic performance to Jewish students in any year of study ATKV STUDY LOAN Field of study Any field of study Value: Amount varies Service contract None Closing date: 30 September Field of study Any field of study Duration: 1 year Value: R4 000 p.a. Tenable at: University of the Western Cape, Peninsula Further information: Duration: Duration of study Technikon The Senior Assistant Registrar Tenable at: Any approved tertiary institution Eligibility. Full-time undergraduate and diploma Financial Aid and Scholarships Eligibility ATKV members and their dependent students from Kimberley or immediate environment University of the Witwatersrand children Service contract None Private Bag 3 Service contract: None Further information: WITS 2050 Closing date: 15 October The Secretary BETHAL TOWN COUNCIL STUDY LOAN Further information: 15 Plum Street The Managing Director KIMBERLEY 8301 Field of study Any field of study ATKV Information not confirmed Value: Amount varies PO Box 4586 Duration: Duration of the course RANDBURG 2125 BANK OF TRANSKEI BURSARY Tenable at Any technikon or university Eligibility. Students or prospective students living in Field of study. Any field of study AVBOB BURSARY Bethel Value: R4 640 Field of study. Any field of study Tenable at University of Transkei Service contract: Available at Bethal Town Council Closing date: 31 December Value: Amount varies Eligibility. Awarded on the basis of academic Duration: 1 year, renewable on reapplication achievement to Transkeian bom students Further information: The Town Secretary Tenable at: Technikon Pretoria Closing date: Contact the University Eligibility Awarded on the basis of outstanding Further information: PO Box 3 BETHAL 2310 academic performance and financial need to regis- The Bursary Officer tered full-time students Financial Aid Bureau BONA PEOPLE'S FUND Service contract: None University of Transkei Closing date: 30 September (year) and 30 April Private Bag X1 Field of study Any field of study (semester courses in the same year) UNITRA 5117 Value: R5 000 p.a. Further information: Duration: 1 year, renewable if progress is satisfactory The Chairman: Bursaries Committee BEDFORDVIEW BURSARY SCHEME Tenable at: Most Southern African universities Technikon Pretoria Eligibility. Awarded on the basis of financial need and Reld of study. Any field of study Private Bag X680 satisfactory academic progress PRETORIA 0001 Value: Amount varies Duration: Duration of the course if progress is Service contract: None Closing date: Apply early in the year AVRIL FRIEDA MALAN BURSARY satisfactory Tenable at: Any university or educational college in Further information: The Chairman Field of study Any field of study South Africa Value: Amount varies Eligibility. Awarded on the basis of scholastic Bona People's Fund Bursaries Republican Press (Pty) Ltd Duration: 1 year achievement (normally an average of 60 % is required) Tenable at: University of Pretoria and financial need to full-time undergraduate PO Box 32083 Eligibility Awarded on the basis of merit and financial students whose parents or guardians have been MOBENI 4060 Information not confirmed need to full-time students born Malan residing in the municipal area of Bedfordview for at Service contract: None least 5 years and/or whose parents, guardians or Closing date: 15 October husbands have been in the employ of the Council for BONA PEOPLE'S FUND BURSARY Further information: at least 2 years Field of study Any field of study The Head: Study Finance Service contract: None Value: At the discretion of the University University of Pretoria Closing date: 15 January Duration: 1 year, renewable PRETORIA 0002 Further information: Tenable at University of the Witwatersrand The Town Secretary 159 144 Bursaries Service contract: None Eligibility: Awarded on the basis of financial need and Eligibility: Only second- and third-year National Closing date: 28 February academic performance to black students Diploma students, National Higher Diploma and Further information: Service contract: None 3.Tech. students who attained 60% aggregate in Department of Head Closing date: 30 September previous examinations qualify. Proof of indigency Management Services Further information: 'eauired (income of both parents not to exceed R50 PO Box 145 The Senior Assistant Registrar 000 p.a.) GERMISTON 1400 Financial Aid and Scholarships Closing date: Apply before 31 January (first semester University of the Witwatersrand and year courses) or 31 July (for second semester) C.T.J. VAN DER WALT BURSARY LOAN SCHEME Private Bag 3 Further information: WITS 2050 The Registrar Field of study: Any field of study Cape Technikon Value: RI 000R5 000 p.a. according to need BRAKPAN TOWN COUNCIL BURSARY LOANS PO Box 652 Duration: Duration of the course FOR TERTIARY STUDY CAPE TOWN 8000 Tenable at: University of Stellenbosch Eligibility: Awarded on the basis of financial need and Field of study: Any field of study BURSARIES TO DEPUTY HEADBOYS AND Value: Universities: R5 000 p.a.: college of education merit to full-time undergraduate students DEPUTY HEADGIRLS (RAU) or other tertiary educational institutions: R4 000 p.a. Closing date: 15 January Duration: Renewable annually if progress is satisfac- Field of study: Any field of study Further information: The Registrar (Bursaries and Loans) tory, for a period not exceeding 6 years Value: RI 050 Tenable at: Any university, college or other tertiary Duration: Awarded once only University of Stellenbosch Private Bag X1 educational institution Tenable at: Rand Afrikaans University Eligibility: Students who have resided in the Brakpan Eligibility: Awarded on the basis of leadership to full- MATIELAND 7602 municipal area for at least 3 years and who have time first-year students who have been deputy passed the matriculation examination with a mini- headboys and deputy headgirls of their schools CALTEX BURSARY mum average of 50% within a period of 2 years Service contract: None Field of study: Any field of study before the date of application Closing date: 15 November Value: R15 000 Service contract: None Further information: Duration: 1 year Closing date: Advertised annually The Registrar (Finance) Tenable at: University of Transkei Further information: RAU Eligibility: Awarded on the basis of merit to Transke- The Town Secretary PO Box 524 ian born students Town Council of Brakpan AUCKLAND PARK 2006 Closing date: Contact the University PO Box 15 Further information: SRAKPAN 1540 BURSARIES TO HEADBOYS AND HEADGIRLS The Bursary Officer information not confirmed (RAU) Financial Aid Bureau Field of study: Any field of study University of Transkei BREBNER BURSARY Value: RI 600 Private Bag XI Field of study: Any field of study Duration: Awarded once only UNITRA 5117 Value: Approximately R730 p.a. Tenable at: Rand Afrikaans university CAPE TECHNIKON LOANS Duration: 3 years Eligibility: Awarded on the basis of leadership to full- Tenable at: University of the OFS rime first-year students who have been headboys or Field of study: Any field of study Eligibility: Awarded on the basis of financial need to headgirls of their schools Value: Maximum amount restricted to class fees only male students born in the OFS and who are commu- Service contract: None Duration: 1 year/semester nicant Protestants. Preference to candidates who wish Closing date: 15 November Tenable at: Cape Technikon to study a technical education subject Further information: Eligibility: Needy students for National Diploma, Service contract: None The Registrar (Finance( National Higher Diploma and B.Tech. study. Proof of Closing date: 31 December RAU indigency required (gross income of both parents not Further information: PO Box 524 to exceed R60 000 p.a.) The Director AUCKLAND PARK 2006 Closing date: Apply before 31 January (for first Dept of Education semester and year) or 31 July (for second semester) PO Box 521 BURSARIES TO WINNERS IN SUBJECT OLYMPI- Further information: BLOEMFONTEIN 9300 ADS The Registrar Information not confirmed Field of study: Any field of study Cape Technikon Value: Winner: R5 000 and runner-up: R3 000 PO Box 652 BRUCE MURRAY CRICKET BURSARY Duration: Awarded once only CAPE TOWN 8000 Field of study: Any field of study Tenable at: Rand Afrikaans University CAPE TECHNIKON MERIT BURSARIES Value: Not specified Eligibility: Winners as well as runners-up of the Duration: I year subject olympiads in Afrikaans. History, Accounting Field of study: Any field of study Tenable at: University of the Witwatersrand and Mathematics enrolling at RAU as full-time first- Value: RI 000 Eligibility: Awarded to full-time or part -time students year students Duration: 1 semester/year with outstanding ability in cricket and adequate Service contract: None Tenable at: Cape Technikon academic ability. Award will also be based on financial Closing date: 15 November Eligibility: First-year students who apply for study need if there are two candidates of equal sporting Further information: direct after matriculating. Requirements: an A ability and academic merit The Registrar (Finance, aggregate for the Senior Certificate or a head girl/boy Service contract: None Rand Afrikaans University with at least a C aggregate for the Senior Certificate or Closing date: 10 January P 0 Box 524 provicial colours in a Technikon sport (submission of Further information: AUCKLAND PARK 2006 proof) The Senior Assistant Registrar Closing date: Apply before 31 January (for first Financial Aid and Scholarships BURSARY SCHEME OF TRANSITIONAL LOCAL semester and year) or 31 July (for second semester) University of the Witwatersrand COUNCIL OF GREATER GERMISTON Further information: PO Box 3 Field of study: Any field of study The Registrar WITS 2050 Value: Determined each year Cape Technikon Duration: Duration of study (Provided the student is PO Box 652 BURSARIES ADMINISTERED BY THE CAPE promoted to the following year) CAPE TOWN 8000 TECHNIKON Tenable at: Any recognised university, technikon or CAPE TIMES BURSARY FUND Field of study: Any field of study technical college in South Africa Value: Amount varies Eligibility: Any SA citizen residing within the area of Field of study: Any field of study Duration: 1 semester/year jurisdiction of the Transitional Local Council of Value: Amount varies Tenable at: Cape Technikon Greater Gemiston BEST COPY AVAILABLE u orcAriac 145 Duration: 1 year, renewable annually if progress is PO Box 94 satisfactory GRAHAMSTOWN 6140 CLAUDE HARRIS LEON FOUNDATION BUR- Tenable at Any university, technikon or college of Information not confirmed SARIES education Field of study. Any field of study Eligibility Awarded on the basis of financial need and CHRIS KOKKORIS BURSARY Value: Amount varies academic merit to matriculants entering first year who Field of study. Any field of study Duration: 1 year, renewable are resident in the Western Cape Value: R860 to R8 030 p.a. Tenable at Rhodes University Service contract: None Duration: 1 year, renewable Eligibility Awarded on the basis of academic ability Closing date: 31 October Tenable at Rand Afrikaans University and with great emphasis placed on financial need of Further information: Eligibility. Awarded on the basis of financial need and students for their second and third years of degree The Bursary Secretary merit to undergraduate and postgraduate Afrikaans- study SAIIR (Cape Western) speaking students Service contract: None 5 Long Street Service contract: None Closing date: 1 December MOWBRAY 7700 Closing date: 15 November Further information: Further information: The Financial Aid Officer CARL AND EMILY FUCHS BURSARY The Registrar (Finance) Rhodes University Field of study. Any field of study Rand Afrikaans University PO Box 94 Value: Amount varies PO Box 524 GRAHAMSTOWN 6140 Duration: 1 year AUCKLAND PARK 2006 Information not confirmed Tenable at University of the Western Cape Eligibility. Awarded on the basis of financial need and CHRISTINE FERREIRA FUND CLIVE ULYATE RUGBY BURSARY academic achievement to full-time undergraduate Field of study Any field of study Field of study Any field of study students Duration: 1 year Value: Not specified Service contract None Tenable at University of the OFS Duration: 1 year Closing date: New first-year students: 1 March. Eligibility. Awarded on the basis of financial need to Tenable at University of the Witwatersrand Current (Senior) students: 31 October of the previous undergraduate and postgraduate students who are Eligibility. Registered full-time undergraduate and year descendants of the late Chief Commander I.S. postgraduate students. The award is based on the Further information: Ferreira, during his lifetime, from De Stadesfontein, ability to play rugby, a proven record and satisfactory The Registrar Ladybrand district academic performance University of the Western Cape Service contract None Service contract None Private Bag X17 Closing date: 15 December Closing date: 10 January BELLVILLE 7535 Further information: Further information: Director. Student Financial Assistance The Senior Assistant Registrar CARL ZIERVOGEL BURSARY University of the OFS Financial Aid and Scholarships Field of study Any field of study PO Box 339 University of the Witwatersrand Value: R860 to R4 680 p.a. BLOEMFONTEIN 9300 PO Box 3 Duration: 1 year, renewable WITS 2050 Tenable at Rand Afrikaans University CHT PEPLER TRUST/ MOLLER BURSARIES Eligibility Awarded on the basis of financial need and Field of study. Any field of study CLUB 10-100 merit to full-time undergraduate students Value: Maximum of R800 p.a. which will be adjusted Field of study Any field of study Service contract. None according to the consumer price index Value: R860 - R4 680 p.a. Closing date: 15 November Duration: Academic performance is taken into Duration: 1 year, renewable Further information: account Tenable at Rand Afrikaans University The Registrar (Finance) Tenable at Any tertiary institution Eligibility. Awarded to full-time undergraduate Rand Afrikaans University Eligibility. Awarded on the basis of financial need to students on the basis of financial need and academic PO Box 524 scholars from Cradock High School, Grens High achievement AUCKLAND PARK 2006 School, East London and Clarendon Girls High School, Service contract None East London. Only white children of German, English Closing date: 15 November CENTRAL OFS ADMINISTRATION BOARD or Afrikaans descent and who belong to a Protestant Further information: BURSARY FUND Church will be considered. Bursaries will only be The Registrar (Finance) Field of study Any field of study awarded to needy children with preference to those of Rand Afrikaans University Value: At the discretion of the Board widows PO Box 524 Tenable at Peninsula Technikon Service contract None AUCKLAND PARK 2006 Eligibility National Diploma students Closing date: 31 January Service contract None Further information: COCA-COLA BURSARY Further information: The Trustee Field of study. Any field of study The Secretary CHT Pepler Trust/Moller Bursaries Value: Amount varies Central OFS Admin Board P/A ABSA Trust Beperk Duration: 1 year C/O Thabong Council POBox 1033 Tenable at Any technikon in South Africa P 0 Box 1 SANLAMHOF 7532 Eligibility. Awarded on the basis of financial need and MOTSETHABONG 9460 merit to students as from the second year of study Information not confirmed CITRUSDAL BURSARY LOAN SCHEME Service contract None Field of study Any field of study Closing date: Contact the technikon concerned CHARLES EGAN BURSARY Value: RI 000R5 000 p.a. Further information: Field of study Any field of study Duration: Duration of the course The Registrar of the technikon concerned Value: Amount varies Tenable at University of Stellenbosch Duration: 1 year, renewable Eligibility. Awarded on the basis of financial need and COCA-COLA BURSARY Tenable at Rhodes University merit to prospective full-time undergraduate Field of study Any field of study Eligibility. Awarded on the basis of financial need and students who are matriculants at Citrusdal High Value: R2 500 each academic ability to any undergraduate student or School Tenable at University of Transkei prospective student, but first preference is given to Service contract None Eligibility. Awarded on the basis of academic merit to the grandchildren of Mrs Hulda Egan Closing date: 15 January Transkeian born students Service contract. None Further information: Closing date: Contact the University Closing date: 1 December The Registrar Bursaries and Loans Further information: Further information: University of Stellenbosch The Bursary Officer The Financial Aid Officer Private Bag X1 Financial Aid Bureau Rhodes University MAT1ELAND 7602 University of Transkei Private Bag X1 COUNCIL OF TECHNIKON PRETORIA LOAN Further information: UNITRA 5117 FUND The Senior Assistant Registrar Field of study: Any field of study Financial Aid and Scholarships University of the Witwatersrand COMMUNITY PRESTIGE BURSARY FUND Value: Determined annually Private Bag 3 Field of study Any field of study Duration: 1 year, renewable annually WITS 2050 Value: R3 000 p.a. Tenable at: Technikon Pretoria Duration: 1 year Eligibility: Prospective as well as registered students DELTA MOTOR CORPORATION BURSARY Tenable at: Any university or college Service contract: Loan must be repaid within 3 years Eligibility: Awarded on the basis of scholastic of completion of the course Field of study: Any field of study achievement to post matriculants and students Closing date: 30 September (year) and 30 April Duration: 1 year reading for a first degree and whose parents or legal (semester courses in the same year) Tenable at: Peninsula Technikon guardians have been resident in the area of the Further information: Eligibility: Diploma students whose parents are Lethabong Metropolitan Local Council for at least 18 The Chairman: Bursary Committee employees of the company ONLY months Technikon Pretoria Closing date: 31 January Service contract: None Private Bag X680 Further information: Closing date: 31 January PRETORIA 0001 The Co-ordinator Further information: Bursaries The City Secretary CTPA BURSARY PO Box 1137 PORT ELIZABETH 6000 Edenvale Modderfontein Metropolitan Sub Field of study: Any field of study Information not confirmed PO Box 25 Value: Amount varies EDENVALE 1610 Duration: 1 year DEPARTMENT OF EDUCATION BURSARY LOAN Tenable at: Peninsula Technikon COROBRIK POST-MATRICULATION BURSARY Eligibility: Awarded on the basis of academic merit SCHEME Field of study Any field of study and financial need Field of study: Any field of study Value: Amount varies Closing date: 15 Marchsame year Value: Tuition fees Duration: 3 years Further information: Duration: 1 year, renewable Tenable at: Any university or technikon The Bursary Secretary Tenable at: Technikon Port Elizabeth Eligibility: Only candidates whose parents have Private Bag X12 Eligibility: Awarded on the basis of financial need and worked for Corobrik for at least 3 years and are still in KASSELSVLE1 7533 academic achievement employment Information not confirmed Closing date: 15 August Service contract: None Further information: Closing date: 19 October DAISY MOSKOW BURSARIES The Bursary Officer Technikon Port Elizabeth Further information: Field of study: Any field of study Private Bag X6011 Human Resources Value: Approximately R1 300 p.a. PORT EUZABETH 6000 Development Manager Duration: 1 year, renewable for the duration of the Corobrik (Ply) Ltd course subject to satisfactory academic performance DETTMAN TRUST BURSARY PO Box 1517 and continued financial need DURBAN 4000 Tenable at: University of the Witwatersrand Field of study: Any field of study Eligibility Awarded on the basis of financial need and Value: Amount varies CORPORATION (DUKE OF YORK) SCHOLARSHIP academic performance Tenable at: Potchefstroom University for CHE Field of study Any field of study Service contract: None Eligibility: White orphans from the RSA Value: RI 000 p.a. Closing date: 30 September Service contract: None Duration: 3 years, renewable for fourth year Further information: Closing date: 15 October Tenable at: University of Cape Town The Senior Assistant Registrar Further information: Eligibility. First-year students whose parents must Financial Aid and Scholarships The Director (Bursaries and Loans) have resided in Cape Town for at least 10 years prior University of the Witwatersrand PU for CHE to the award. Whites and coloureds may apply Private Bag 3 POTCHEFSTROOM 2520 Service contract: None WITS 2050 Closing date: Advertised annually in January when DEVELOPMENT COMMITTEE BURSARY FUND available DARRAS HELLENIC BURSARY Field of study: Any field of study Further information: Field of study: Any field of study Value: R860R4 680 p.a. The Town Clerk's Department Value: At the discretion of the University Duration: 1 year, renewable Scholarship Executor Committee Duration: 1 year, renewable annually subject to Tenable at: Rand Afrikaans University PO Box 298 satisfactory academic performance Eligibility: Awarded on the basis of financial need to CAPE TOWN 8000 Tenable at: University of the Witwatersrand full-time undergraduate students Information not confirmed Eligibility: Awarded on the basis of financial need and Service contract: None academic performance to male candidates whose Closing date: 15 November COUNCIL OF TECHNIKON PRETORIA BURSARY parents were born in Greece, or whose home Further information: FUND language is Greek. Students must be domiciled in SA The Registrar (Finance) Field of study Any field of study Service contract: None Rand Afrikaans University Value: Determined annually Closing date: 30 September PO Box 524 Duration: 1 year, renewable on reapplication Further information: AUCKLAND PARK 2006 Tenable at: Technikon Pretoria The Senior Assistant Registrar Eligibility: Awarded to registered full-time students Financial Aid and Scholarships DIOCESE OF DUNDEE BURSARY FUND with good academic and non-academic performance University of the Witwatersrand Field of study: Any field of study and financial need Private Bag 3 Value: Determined by sponsor depending on funds Service contract: None WETS 2050 available Closing date: 30 September (year) and 30 April Duration: 1 year. renewable (second semester of current year) DAVID FREEMAN BURSARIES Tenable at: Any university or other tertiary training Further information: Field of study: Any field of study institution The Chairman: Bursary Committee Value: At the discretion of the University Eligibility: Undergraduate students who are members Technikon Pretoria Duration: 1 year, renewable of the Roman Catholic Church in the diocese of Private Bag X680 Tenable at: University of the Witwatersrand Dundee PRETORIA 0001 Eligibility: Awarded on the basis of financial need and Service contract: None academic performance Closing date: End of December Service contract: None Further information: Closing date: 30 September The Administrator Bursary Fund b Bursaries 147 Diocese of Dundee Service contract None Duration: 1 year, renewable if progress is satisfactory PO Box 425 Closing date: 30 September (year) and 30 April for a maximum of 3 years LADYSMrTH 3370 (semester courses in the same year) Tenable at Any university Information not confirmed Further information: Eligibility. Awarded on the basis of academic per- The Chairman formance for full-time undergraduate study to DIOCESE OF NATAL BURSARY Bursary Committee DURBAN HIGH SCHOOL PUPILS ONLY Field of study. Any field of study Technikon Pretoria Closing date: 31 October Value: Maximum RI 000 Private Bag X680 Further information: Duration: 1 year PRETORIA 0001 The Head Master Tenable at: Any tertiary institution PO Box 50001 Eligibility Undergraduate students who are members DR J.H. MULLER BURSARY MUSGRAVE 4062 of the Anglican Church in the diocese of Natal Field of study. Any field of study Service contract: None Value: Amount varies DURBANVILLE MEN'S FORUM BURSARY Closing date: 31 October Duration: 1 year, renewable Field of study Any field of study Further information: Tenable at University of Stellenbosch Value: RI 000 The Diocesan Secretary Eligibility. Awarded on the basis of financial need to Duration: 1 year Diocese of Natal students from the Free State Tenable at: University of Stellenbosch, University of PO Box 47439 Service contract None the Western Cape, Peninsula Technikon GREYVILLE 4023 Closing date: 15 January Eligibility. Second-year students living in Durbanville Further information: Service contract None DIOCESE OF RUSTENBURG BURSARY The Registrar. Bursaries and Loans Closing date: 31 January Field of study Any field of study University of Stellenbosch Further information: Value: Amount varies Private Bag X1 The Secretary Duration: Duration of the course if progress is MAT1ELAND 7602 Durbanville Men's Forum satisfactory PO Box 452 Tenable at: Mainly colleges of education or technik- DR T.E. D(tm)NGES BURSARIES DURBANVILLE 7550 ons Field of study. Any field of study Information not confirmed Eligibility. Undergraduate and postgraduate students Value: R4 000 each pa. from within the diocese Duration: Duration of the course if progress is DUTCH REFORMED CHURCH OF AFRICA Closing date: 24 January of year of study satisfactory BURSARY Further information: Tenable at Any university or technikon in SA Field of study. Any field of study The Bursary Secretary Eligibility. Awarded on the basis of financial need and Value: R860 R4 680 p.a. Diocese of Rustenburg outstanding academic merit to prospective first-year Duration: 1 year, renewable PO Box 107 students Tenable at: Rand Afrikaans University RUSTENBURG 0030 Service contract None Eligibility. Full-time meritworthy students from the Information not confirmed Closing date: Contact the university or technikon Witwatersrand Presbyterian Area of the Dutch concerned Reformed Church of Africa DIOCESE OF WITBANK BURSARY Further information: Service contract: None Field of study. Any field of study The Bursary office of the university or technikon Closing date: 15 November Value: Amount varies concerned Further information: Duration: 1 year, renewable The Registrar (Finance) Tenable at: Universities, technikons and colleges of DS. J.H. NEETHLING BURSARY Rand Afrikaans University education Field of study Any field of study PO Box 524 Eligibility. Students (Catholics as well as non- Value: R500 AUCKLAND PARK 2006 Catholics) whose home is in the diocese of Witbank Tenable at: University of Stellenbosch Service contract: None Eligibility. Descendants of the late reverend J.H. E BELLAIRS TRUST BURSARY Closing date: September Neethling Field of study Any field of study Further information: Service contract: None Value: Amount varies Application forms obtainable from Closing date: 15 January Duration: 1 year, renewable on reapplication the priest in charge at applicant's Further information: Tenable at. Technikon Pretoria parish The Registrar. Bursaries and Loans Eligibility Awarded on the basis of outstanding Information not confirmed University of Stellenbosch academic performance and financial need to regis- Private Bag X1 tered full-time students DORA FALCKE TRUST LOAN MAT1E1AND 7602 Closing date: 30 September (year) and 30 April Field of study. Any field of study (semester courses in the same year) Value: Amount varies DU TOIT HUGENOTE BURSARY Further information: Duration: 1 year, renewable Field of study. Any field of study The Chairman: Bursary Committee Tenable at Any tertiary institution Value: Amount varies Technikon Pretoria Eligibility Students in any year of study who are SA Duration: 1 year Private Bag X680 citizens and who reside specifically within the Tenable at: University of Stellenbosch PRETORIA 0001 Southern Cape Peninsula Eligibility. Awarded on the basis of academic Service contract None achievement, leadership potential and financial need E.G. PELZER BURSARY FUND Closing date: 31 December to undergraduate students. Preference to Huguenot Field of study. Any field of study Further information: decendants if everything is equal Value: Amount varies The Secretary Service contract: None Duration: 1 year Dora Falcke Foundation Closing date: 15 January Tenable at: University of the OFS PO Box 22134 Further information: Eligibility Awarded on the basis of academic FISH HOEK 7974 The Registrar (Bursaries and Loans) achievement and financial need, preferably to first- University of Stellenbosch year students from the Northern Cape region DR J.H. MEYER BURSARY Private Bag X1 Service contract: None Field of study. Any field of study MATIELAND 7602 Closing date: 15 December Value: Amount varies Further information: Duration: 1 year, renewable on reapplication DURBAN HIGH SCHOOL AND OLD BOYS' Deputy Director Tenable at Technikon Pretoria MEMORIAL TRUST BURSARIES Student Financial Assistance Eligibility Awarded on the basis of outstanding Field of study. Any field of study PO Box 339 academic performance and financial need to regis- Value: Approximately R5 000 p.a. BLOEMFONTEIN 9300 tered full-time students 163 148 Bursaries E.J. LOMBARDI BURSARY TRUST Further information: Tenable at: Technikon Pretoria The Registrar: Bursaries and Loans Eligibility. Awarded on the basis of outstanding Field of study. Any field of study University of Stellenbosch academic performance and financial need to regis- Value: Amount varies Private Bag Xl tered full-time students Duration: 1 year/semester MATIELAND 7602 Service contract: None Tenable at: Peninsula Technikon only Closing date: 30 September (year) and 30 April Eligibility: Awarded on the basis of good academic ELAINE FORSYTH MEMORIAL TRUST BURSARY (semester courses in the same year) performance to diploma students from Grabouw, Further information: Field of study: Any field of study Elgin or Vyeboom areas only The Chairman: Bursaries Committee Value: Amount varies Service contract: None Technikon Pretoria Closing date: Applications can only be made during Duration: 1 year, renewable if progress is satisfactory Private Bag X680 registration until advertised closing date Tenable at: Any tertiary institution in the Western PRETORIA 0001 Further information: Cape Eligibility: Diploma and undergraduate students who The Bursary Secretary ESTCOURT INDIAN ONE CENT BURSARY E J Lombardi Bursary Fund normally reside in the Westem Cape PO Box 1906 Service contract: None Field of study: Any field of study BELLVILLE 7530 Closing date: 5 January Value: Amount varies Further information: Duration: 1 year E.J.A. LOERINCZ SCHOLARSHIP The Trustees Tenable at: Any university Elaine Forsyth Memorial Trust Eligibility: Undergraduate students Field of study: Any field of study PO Box 206 Service contract: None Value: At the discretion of the University CAPETOWN 8000 Closing date: 31 October Duration: 1 year, renewable if progress is satisfactory Further information: Tenable at: University of the Witwatersrand ELISE VISSER BURSARY The Secretary Eligibility: Awarded on the basis of outstanding Estcourt Indian One Cent Bursary Field of study: Any field of study academic performance to undergraduate students PO Box 135 Value: R500 Service contract: None ESTCOURT 3310 Closing date: 10 January Duration: 1 year, renewable Tenable at: University of Stellenbosch Further information: ESTHER AND DAVID NORWICH SCHOLARSHIPS The Senior Assistant Registrar Eligibility. Awarded on the basis of merit and financial Financial Aid and Scholarships need to undergraduate students who belong to the Field of study: Any field of study University of the Witwatersrand Dutch Reformed Church of the Cape. Preference Value: At the discretion of the University Duration: 1 year, renewable for a further 2 years PO Box 3 given to applicants who were bom in the districts of subject to satisfactory progress WITS 2050 Wellington and Paarl Service contract: None Tenable at: University of the Witwatersrand EBEN AND FREDA VAN ZYL STUDY LOAN FUND Closing date: 15 January Eligibility: Awarded on the basis of financial need and Further information: academic performance to matriculants or under- Field of study: Any field of study The Registrar: Bursaries and Loans graduate students Value: Maximum of R6 160 p.a. University of Stellenbosch Service contract: None Duration: 1 year, renewable Private Bag XI Closing date: 30 September Tenable at: Rand Afrikaans University MATIELAND 7602 Further information: Eligibility: Full-time needy students who cannot get The Senior Assistant Registrar bursaries as a result of limited adacemic achievement. ELIZABETH MARAIS BURSARY Financial Aid and Scholarships Candidates must however be able to attain good University of the Witwatersrand Field of study: Any field of study results in courses they are registered for Private Bag 3 Value: Amount varies Service contract: None WITS 2050 Closing date: 15 November Duration: Maximum of 3 years Tenable at: Preferably University of Stellenbosch. Also Further information: ETHEL MARY SMITH BEQUEST BURSARY The Registrar (Finance) valid at another university or abroad Rand Afrikaans University Eligibility Students who are direct descendants of Field of study: Any field of study Value: At the discretion of the University PO Box 524 Abraham Barend de Villiers and Theophile Antonia de AUCKLAND PARK 2006 Villiers (née van der Lingen) Duration: 1 year, renewable Service contract: None Tenable at: University of the Witwatersrand Eligibility Awarded on the basis of financial need and EDENVALE JUBILEE BURSARY FUND Closing date: 15 January Further information: academic performance Field of study. Any field of study The Registrar: Bursaries and Loans Service contract: None Value: RI 000 each p.a. University of Stellenbosch Closing date: 30 September Duration: For the duration of a first degree/diploma if Private Bag XI Further information: progress is satisfactory MATIELAND 7602 The Senior Assistant Registrar Tenable at: Any university, college or technikon Financial Aid and Scholarships Eligibility: Post-matriculants whose parents or ELIZABETH VILJOEN TRUST BURSARY University of the Witwatersrand guardians have been resident in the municipal area of Private Bag 3 Lethabong Metropolitan Local Council for at least 18 Field of study: Any field of study WITS 2050 months. Awarded on the basis of scholastic achieve- Value: Amount varies ments and general characteristics Duration: 1 year, renewable EVANGELICAL LUTHERAN CHURCH IN SA Tenable at: University of Stellenbosch Service contract: None BURSARY Closing date: 31 January Eligibility. Descendants and adopted children of the Field of study: Any field of study Further information: late Miss Elizabeth Viljoen's brothers and sisters Value: Amount varies The City Secretary Service contract: None Tenable at: Any university or technikon PO Box 25 Closing date: 15 January Eligibility: Undergraduate Lutheran students belong- EDENVALE 1610 Further information: The Registrar: Bursaries and Loans ing to the ELCSA-SED Service contract: None EIKENHOF-MOULTON BURSARY University of Stellenbosch Private Bag Xl Closing date: 30 September Field of study: Any field of study MAT1ELAND 7602 Further information: Value: R500 The Executive Secretary Duration: 1 year ERNEST OPPENHEIMER MEMORIAL TRUST Evangelical Lutheran Church in SA Tenable at: University of Stellenbosch BURSARY Private Bag X9204 Eligibility: A matriculant of the Hoer Meisieskooi MAPUMULO 4470 Field of study: Any field of study Bloemhof Information not confirmed Service contract: None I Value: Amount varies Closing date: 15 January Duration: 1 year, renewable on reapplication 164 Bursaries 149 EVE ANDERSON BURSARY Eligibility. Awarded to the fifth and following children Field of study Any field of study FEMNET ELIZABETH LOUW BURSARY from the same parents who study at the University of Value: R10 000 Field of study. Any field of study the OFS, irrespective of how many children are Duration: 1 year Value: RI 000 studying simultaneously at the University Tenable at: University of the Witwatersrand Tenable at: University of Stellenbosch Service contract: None Eligibility Awarded on the basis of financial need and Eligibility. Awarded on the basis of financial need to a Closing date: 15 December academic performance child of a pensioner, employee or widow of Transnet Further information: Service contract: None who is, or was, a member of the Transnet pension Deputy Director Closing date: 30 September fund Student Financial Assistance Further information: Service contract: None PO Box 339 The Senior Assistant Registrar Closing date: 15 January BLOEMFONTEIN 9300 Financial Aid and Scholarships Further information: University of the Witwatersrand The Registrar. Bursaries and Loans FOSCHINI BURSARY Private Bag 3 University of Stellenbosch Field of study. Any field of study WITS 2050 Private Bag XI Value: Amount varies MAT1ELAND 7602 Duration: 1 year EXPO FOR YOUNG SCIENTISTS BURSARY Tenable at: University of the Western Cape Field of study. Any field of study FINNISH GOVERNMENT BURSARY Eligibility. Full-time undergraduate students who are Value: RI 000 Field of study. Any field of study children of employees of the Foschini Group Duration: 1 year Value: Amount varies Service contract None Tenable at: University of Pretoria Duration: 1 year Closing date: New first-year students: 1 March. Eligibility Gold medalists who undertake further Tenable at University of the Western Cape Current (Senior) students: 31 October of the previous studies for the first time after manic Eligibility. Awarded on the basis of financial need and Year Service contract: None academic achievement to full-time undergraduate Further information: Closing date: 15 October students The Registrar Further information: Service contract: None University of the Westem Cape The Head: Study Finance Closing date: New first-year students: 1 March. Private Bag X17 University of Pretoria Current (Senior) students: 31 October of the previous BELLVILLE 7535 PRETORIA 0002 year Further information: FOURTH CHILD BURSARY F.W. KNACKE BURSARY The Registrar Field of study. Any field of study Field of study. Any field of study University of the Western Cape Value: R600 p.a. Value: Amount varies Private Bag X17 Duration: Duration of the course if progress is Duration: Duration of the course renewable for BELLVILLE 7535 satisfactory postgraduate studies Tenable at University of Stellenbosch Tenable at: University of Stellenbosch FIRST NATIONAL BANK OF SA LTD STUDENT Eligibility. The fourth and following child(ren) of the Eligibility. Awarded on the basis of financial need and LOAN same family who attend the university merit to German-speaking students Field of study. Any field of study Service contract: None Service contract: None Value: Tuition fees plus RI 000 for books Closing date: 15 January Closing date: 15 January Duration: Duration of the course if progress is Further information: Further information: satisfactory The Registrar. Bursaries and Loans The Registrar. Bursaries and Loans Tenable at: Any tertiary institution University of Stellenbosch University of Stellenbosch Eligibility. Awarded on the basis of merit to under- Private Bag X1 Private Bag XI graduate and postgraduate students MAT1ELAND 7602 MAT1ELAND 7602 Service contract None Closing date: None FRENCH EMBASSY IN SA BURSARIES FAMILY BURSARY Further information: Field of study. Any field of study Field of study. Any field of study Nearest branch office of First National Bank of SA Ltd Value: Amount varies Value: 10% discount on tuition fees for two children Information not confirmed Duration: 1 year, renewable and 20% discount for three or more children Tenable at University of Cape Town Duration: 1 year, renewable on application FIRST NATIONAL BANK UNIVERSITY AND Eligibility-. SA citizens in any year of study Tenable at University of Pretoria TECHNIKON SCHOLARSHIP Service contract None Eligibility When two or more children from one family Field of study. Any field of study Closing date: 31 October study full-time at the university at the same time, Value: 75% of tuition and residence fees; a subsis- Further information: application for discount may be submitted tence allowance if not in residence The Bursary Secretary Service contract. None Duration: Duration of the course Cultural Section of the French Embassy Closing date: 15 October Tenable at Any university or technikon in South Africa PO Box 29086 Further information: Eligibility. Awarded for full-time study on the basis of SUNNYSIDE 0132 The Head: Study Finance academic merit to children of staff who have ma- Information not confirmed University of Pretoria triculated or who are first-year students, as well as PRETORIA 0002 pensioners or deceased members of the First GADRA BURSARY National Bank Ltd Field of study Any field of study FELIX EN CHRISTINE GUT BURSARY LOAN Service contract None Value: Amount varies (approximately half the cost of (GENERAL) Closing date: Mid October tuition fees) Field of study Any field of study Further information: Duration: 1 year, renewable if progress is satisfactory Value: RI 000 - R5 000 p.a. The Manager Tenable at Any tertiary institution Duration: Duration of the course Recruitment & Selection Eligibility. Awarded on the basis of financial need to Tenable at. University of Stellenbosch First National Bank Ltd undergraduate and diploma students who are Eligibility. Awarded on the basis of financial need and PO Box 1153 residents of Grahamstown or district merit to white full-time students JOHANNESBURG 2000 Service contract None Service contract: None Information not confirmed Closing date: 31 October Closing date: 15 January Further information: Further information: FIVE OR MORE CHILDREN AT UOFS BURSARY The Bursaries Officer The Registrar. Bursaries and Loans Field of study Any field of study Gadra Educational Welfare University of Stellenbosch Value: Amount varies PO Box 126 Private Bag X1 Duration: 1 year GRAHAMSTOWN 6140 MATIELAND 7602 Tenable at. University of the OFS Information not confirmed 165 150 Bursaries CAPE TOWN 8000 Closing date: 15 October Further information: GAVIN COOKE CANOEING BURSARY GIDEON ROOS BURSARY The Director (Bursaries and Loans) Field of study Any field of study PU for CHE Field of study. Any field of study Value: At the discretion of the University Private Bag X6001 Value: R5 000 p.a. Duration: 1 year, renewable on reapplication subject POTCHEFSTROOM 2520 to satisfactory academic and sporting performances Duration: 1 year Tenable at: University of Stellenbosch Tenable at: University of the Witwatersrand GOVERNMENT BURSARIES Eligibility: Awarded to full-time or part-time, Eligibility: Matriculants of Paul Roos Gymnasium in registered students with outstanding ability in any year of study Field of study: Any field of study canoeing and adequate academic ability Service contract: None Value: Determined annually Service contract: None Closing date: 28 February Tenable at: Potchefstroom University for CHE Closing date: 10 January Further information: Eligibility: Deserving students with good conduct Further information: The Registrar Closing date: 15 October Financial Aid & Scholarship Office University of Stellenbosch Further information: University of the Witwatersrand Private Bag X1 The Director (Financial Bureau) Private Bag 3 MATELAND 7602 PU for CHE Private Bag X6001 WITS 2050 GILLETE SA LTD BURSARY POTCHEFSTROOM 2520 GAWIE HENDRIKSZ BURSARY Field of study: Any field of study GRAHAMSTOWN CITY BURSARY Field of study Any field of study Value: Amount varies Value: Approximately R2 250 Duration: 1 year Field of study: Any field of study Duration: 1 year, renewable Tenable at: Any technikon Value: R2 000 p.a. Tenable at: University of Stellenbosch Eligibility: Awarded on the basis of academic merit Duration: 1 year Eligibility. Awarded on the basis of financial need to and financial need to technikon students Tenable at: Any university, training college or orphans or children who reside in a children's home Closing date: Contact the donor technikon as a result of the divorce of their parents Further information: Eligibility: Awarded on the basis of financial need and academic ability to students whose parents have been Service contract: None The Secretary domiciled within the Grahamstown municipal area for Closing date: 15 January Gillete SA Ltd a period of at least 3 years Further information: Private Bag 11 The Registrar (Bursaries and Loans) GARDEN VIEW 2047 Service contract: None University of Stellenbosch Information not confirmed Closing date: 15 January Private Bag X1 Further information: Manager Human Resources MAT1ELAND 7602 GILLETTE SA LTD BURSARY City of Grahamstown Field of study: Any field of study PO Box 176 GEORGE HOME BURSARY Value: Amount varies GRAHAMSTOWN 6140 Field of study: Any field of study Duration: 1 year Tenable at: University of the Western Cape Value: R900 GREATER LOUIS TRICHARDT TRANSITIONAL Eligibility Full-time undergraduate students Duration: 1 year LOCAL COUNCIL BURSARY LOAN SCHEME Tenable at: University of Stellenbosch Service contract: None Eligibility. Awarded on the basis of financial need to Closing date: First-year students 1 March: seniors 30 Field of study: Any field of study undergraduate students who matriculated at November of the previous year Value: Variable Worcester High School, Montana High School and a Further information: Duration: Duration of the course Tenable at: Any university, college or technikon school in Stellenbosch The Registrar Eligibility: Employees and children of employees of Service contract: None University of the Western Cape the Greater Louis Trichardt Transitional Local Council Closing date: 15 January Private Bag X17 Service contract: Is required Further information: BELLVILLE 7535 The Registrar (Bursaries and Loans) Information not confirmed Closing date: 30 September University of Stellenbosch Further information: The Town Clerk Private Bag X1 GODIMO BURSARY FUND PO Box 96 MAT1ELAND 7602 Field of study Any field of study LOUIS TRICHARDT 0920 Value: Tuition, accommodation and book fees Information not confirmed GEORGE JACOBUS PETERSEN SCHOLARSHIP Duration: 1 semester, renewable Tenable at: Technikon North West Field of study: Any field of study GREENSLADE SCHOLARSHIP Value: Amount varies Eligibility: Awarded to full-time, deserving students Field of study: Any field of study Duration: 1 year on the basis of academic achievement and financial Tenable at: University of the Western Cape need which is directly related to the income of the Value: R100 p.a. Eligibility. Final-year or Honours students student's family. The student should have registered Duration: 3 years Tenable at: Rhodes University Service contract: None for at least 3 instructional offerings and passed them Eligibility: Awarded on the basis of financial need and Closing date: 31 October of the previous year in 1 sitting. Not more than 1 instructional offering matriculation examinations to pupils of the Aliwal Further information: should be failed North High School The Registrar Closing date: At least 1 month before the end of the University of the Western Cape previous semester Service contract: None Closing date: 15 January Private Bag X17 Further information: Further information: BELLVILLE 7535 The Student Liason Officer Financial Aid Office The Principal GERTRUIDA C. DU TOIT MEMORIAL TRUST Technikon North-West Aliwal North High School PO Box 911-1263 ALJWAL NORTH 5530 Field of study Any field of study ROSSLYN 0200 Information not confirmed Value: R3 000 Information not confirmed Duration: 1 year N.A. KOCH SCHOLARSHIP Tenable at: Cape Technikon GOEDE LOAN FUND Eligibility. Students who are connected to the ACVV Field of study: Any field of study Value: R1 800 Service contract: None Field of study Any field of study Duration: Duration of the course Closing date: 31 July Duration: 1 year Tenable at: Any tertiary institution Further information: Tenable at: Potchefstroom University for CHE The Director Eligibility: Full-time undergraduate students who are ACVV direct decendants of the Goede family PO Box 3834 Service contract: None 166 Bursaries 151 Eligibility: Pupils who have attended a school under HELEN SUZMAN BURSARY Closing date: 15 December the Natal Education Department in the local authority Field of study Any field of study Further information: areas of Gingindlovu, Mtunzini, Empangeni, Eshowe Value: R10 000 Deputy Director or the Amatikulu district Duration: 1 year Student Financial Assistance Service contract: None Tenable at University of the Witwatersrand PO Box 339 Closing date: 31 October Eligibility. Awarded on the basis of financial need and BLOEMFONTEIN 9300 Further information: satisfactory performance to black, Coloured or Indian The Director of Education women students HOSPITAL WELFARE AND MUSLIM EDUCA- Natal Education Department Service contract: None TIONAL MOVEMENT BURSARY-LOAN Private Bag X9044 Closing date: 30 September Field of study. Any field of study PIETERMARITZBURG 3200 Further information: Value: Amount varies The Senior Assistant Registrar Duration: 1 year, renewable HARRY COLMAN MEMORIAL SCHOLARSHIP Financial Aid & Scholarhsips Tenable at: Peninsula Technikon, University of the Field of study. Any field of study University of the Witwatersrand Western Cape and University of Cape Town Value: Approximately RI 100 Private Bag 3 Eligibility Awarded on the basis of financial need to Duration: 1 year, renewable WITS 2050 SA citizens from the Western Cape Tenable at: University of the Witwatersrand Service contract: None Eligibility. Awarded on the basis of financial need and HELLENIC BURSARY OF LODGE PYTHAGORAS Closing date: 15 January academic performance Field of study Any field of study Further information: Service contract None Value: R2 500 p.a. The Secretary Closing date: 30 September Duration: Duration of the course renewable annually Muslim Educational Movement Further information: subject to satisfactory progress PO Box 4021 The Senior Assistant Registrar Tenable at University of the Witwatersrand CAPE TOWN 8000 Financial Aid and Scholarships Eligibility. Awarded on the basis of financial need and Information not confirmed University of the Witwatersrand academic performance to students of Greek parents. Private Bag 3 Preference given to children or relatives of Freema- IA APPEL BURSARY WITS 2050 sons Field of study Any field of study Service contract: None Value: Amount varies HARRY LAMPERT ATHLETICS BURSARY Closing date: 30 September Duration: 1 year Field of study. Any field of study Further information: Tenable at: University of the Western Cape Value: At the discretion of the University The Senior Assistant Registrar Eligibility. Awarded on the basis of financial need to Duration: 1 year, renewable on reapplication for the Financial Aid and Scholarships full-time undergraduate students residing in duration of the course subject to satisfactory University of the Witwatersrand Kensington performance Private Bag 3 Service contract: None Tenable at: University of the Witwatersrand WITS 2050 Closing date: New first-year students: 1 March. Eligibility. Awarded on the basis of outstanding ability Current (Senior) students: 31 October of the previous in athletics and adequate academic performance to a HELPING HAND TRUST BURSARIES year full-time or part-time student Field of study. Any field of study Further information: Closing date: 10 January Value: At the discretion of the University The Registrar Further information: Duration: 1 year, renewable University of the Western Cape Financial Aid & Scholarship Office Tenable at: University of the Witwatersrand Private Bag X17 University of the Witwatersrand Eligibility. Awarded on the basis of financial need and BELLVILLE 7535 P/Bag 3 academic performance to black women students only WITS 2050 Service contract. None IAN FRASER MEMORIAL BURSARY FUND Closing date: 30 September (BURSARIES FOR THE BLIND) HARVEY PIRIE BURSARY FUND Further information: Field of study. Any field of study Field of study Any field of study The Senior Assistant Registrar Value: Amount varies Value: At the discretion of the University Financial Aid and Scholarships Duration: 1 year, renewable if progress is satisfactory Duration: 1 year, renewable University of the Witwatersrand Tenable at Any university or technikon Tenable at University of the Witwatersrand Private Bag 3 Eligibility Registered blind students from second year Eligibility. Awarded on the basis of financial need and WETS 2050 of study only. Applicants must submit proof of academic performance blindness Service contract: None HERMANN OHLTHAVER BURSARY Service contract: None Closing date: 30 September Field of study. Any field of study Closing date: January Further information: Value: R500 Further information: The Senior Assistant Registrar Duration: 3 years The Bursary Officer Financial Aid and Scholarships Tenable at University of Stellenbosch Ian Fraser Memorial Bursary Fund University of the Witwatersrand Eligibility. Awarded on the basis of merit and extreme PO Box 125 Private Bag 3 financial need to first-year students HOWARD PLACE 7450 WETS 2050 Service contract: None Closing date: 15 January IMMIGRANT CHILD BURSARY HEADBOY AND HEADGIRL BURSARIES Further information: Field of study. Any field of study (PRETORIA) The Registrar (Bursaries and Loans) Value: Amount varies Field of study. Any field of study University of Stellenbosch Duration: 1 year, renewable Value: RI 000 Private Bag X1 Tenable at University of Stellenbosch Duration: 1 year MATlaAND 7602 Eligibility. Awarded on the basis of financial need Tenable at University of Pretoria and/or merit to children of immigrants who have Eligibility. Awarded to academic headboys and HIGH SCHOOL MODEL BURSARY been living in SA for 3 years or less headgiris for first-time study after matric Field of study. Any field of study Service contract: None Service contract: None Value: Amount varies Closing date: 15 January Closing date: 15 October Duration: 1 year Further information: Further information: Tenable at University of the OFS The Registrar (Bursaries and Loans) The Head (Financial assistance) Eligibility Undergraduate students. Preference to past University of Stellenbosch University of Pretoria pupils of the Model Primary and High Schools. If no Private Bag X1 PRETORIA 0002 applications are received, pupils of the City Bloem- MAT1ELAND 7602 fontein will be concidered Service contract: None 167 152 Bursaries INDEPENDENT DEVELOPMENT TRUST Further information: Duration: 1 year The Registrar Tenable at University of the OFS, Potchefstroom Field of study. Any field of study University of the Western Cape University for CHE Value: Amount varies Private Bag Xl 7 Eligibility Preference to descendants of the brothers Duration: 1 year, renewable BELLVILLE 7535 and sisters of the late Mr Havenga and thereafter Tenable at: University of the OFS descendants of the sister of his former wife the late Eligibility: Awarded to black students, preferably ITHAQUESIAN PHILANTHROPIC SOCIETY OF SA Mrs Anna Catharina Petronella Havenga (née Noeth). undergraduate Thereafter white Afrikaans students will be consid- Service contract: None BURSARY ered Closing date: 15 October Field of study Any field of study Further information: Value: R5 000 x 2 p.a. Service contract: None Closing date: 15 October Deputy Director Duration: 1 year, renewable annually for the duration Further information: Student Financial Assistance of the course subject to satisfactory progress The Director of the university concerned UOVS Tenable at University of the Witwatersrand PO Box 339 Eligibility. Awarded on the basis of financial need and J.H. HOFMEYER SCHOLARSHIP FUND BLOEMFONTEIN 9300 academic performance to students domiciled in SA with parents of Greek origin from Ithaca or their Field of study. Any field of study INDIAN CENTENARY SCHOLARSHIP TRUST decendants Value: R400 p.a. LOAN/BURSARY Service contract: None Duration: One year, renewable for the duration of the Field of study: Any field of study Closing date: 30 September course provided that academic standard has been maintained Value: Amount varies Further information: Duration: Duration of the course The Senior Assistant Registrar Tenable at: University of the Witwatersrand Eligibility: Awarded on the basis of academic merit to Tenable at: Any technikon or university Financial Aid and Scholarships promising white male SA students under the age of Eligibility Students of all races who are SA citizens University of the Witwatersrand 23 as at December of the year which the application Service contract: None Private Bag 3 is made for a scholarship. Must undertake to further Closing date: Only apply from November to 31 WITS 2050 their studies at the University of the Witwatersrand December uninterruptedly for a period of at least three years Further information: J AND B BENNUM BURSARY Service contract: None Indian Centenary Scholarship Trust Field of study Any field of study Closing date: 30 September PO Box 48387 Value: At the discretion of the University Further information: QUALBERT 4087 Duration: One year, renewable Tenable at: University of the Witwatersrand The Senior Assistant Registrar Financial Aid and Scholarships ISAAC AND SARAH SCHNEIDER BURSARIES Eligibility Awarded on the basis of financial need and academic achievement University of the Witwatersrand Field of study. Any field of study Private Bag 3 Service contract: None Value: At the discretion of the University WITS 2050 Duration: 1 year, renewable Closing date: 30 September Further information: Tenable at: University of the Witwatersrand J.L.C. DU PLESSIS BURSARY Eligibility: Awarded on the basis of financial need and The Senior Assistant Registrar Field of study: Any field of study academic performance to students who were Financial Aid and Scholarships Value: Amount varies formerly pupils of Randfontein High School University of the Witwatersrand Duration: 1 year, renewable on reapplication Service contract: None Private Bag 3. Tenable at: Technikon Pretoria Closing date: 30 September WITS 2050 Eligibility. Awarded on the basis of outstanding Further information: academic performance and financial need to regis- The Senior Assistant Registrar J. TOXOPEUS BURSARY FUND tered full-time students Financial Aid and Scholarships Field of study: Any field of study Closing date: 30 September(year) and 30 April University of the Witwatersrand Value: Amount varies (semester courses in the same year) Private Bag 3 Duration: 1 year Further information: WITS 2050 Tenable at: Potchefstroom University for CHE Eligibility Awarded on the basis of financial need and The Chairperson Bursary Committee ISAAC GREENBERG BURSARY academic merit to undergraduate students Technikon Pretoria Field of study Any field of study Service contract: None Closing date: 15 October Private Bag X680 Value: R3 000 PRETORIA 0001 Duration: 3 years, if progress is satisfactory Further information: The Director Tenable at: University of Stellenbosch J.M. HATTINGH STUDY FUND Eligibility Prospective first-year SA citizens of Dept Bursaries and Loans Field of study Any field of study Afrikaans, English or Jewish origin, with exceptionally PU for CHE Value: Amount varies high scholastic achievements. Evidence of language Private Bag X6001 Duration: 1 year group is required POTCHEFSTROOM 2520 Tenable at: Potchefstroom University for CHE Service contract: None J.C. VAN DER MERWE BURSARY FUND Eligibility Direct descendants of the late prof. J.M. Closing date: 15 January Hattingh. If no applications are received, needy Further information: Field of study: Any field of study Afrikaans-speaking students will be considered The Registrar (Bursaries and Loans) Value: R860 to R4 680 p.a. Service contract: None University or Stellenbosch Duration: 1 year, renewable Closing date: 15 October Private Bag X1 Tenable at: Rand Afrikaans University Further information: MAT1ELAND 7602 Eligibility. Full-time Afrikaans-speaking undergradu- ate students. Preference to students from the The Director (Bursaries & Loans) PU vir CHO ITALIAN BURSARY Eikenhof area Private Bag X6001 Field of study: Any field of study Service contract: None Closing date: 15 November POTCHEFSTROOM 2520 Value: Amount varies Further information: Duration: 1 year JACK ELLERT BURSARY FUND Tenable at: University of the Western Cape The Registrar (Finance) Field of study. Any field of study Eligibility. Awarded on the basis of financial need and Rand Afrikaans University Value: Amount varies academic achievement to full-time undergraduate PO Box 524 AUCKLAND PARK 2006 Duration: 1 year students Tenable at: University of the Western Cape Service contract: None Eligibility: Undergraduate students from Upington Closing date: New first-year students: 1 March. J.F. HAVENGA TRUST BURSARIES Current (Senior) students: 31 October of the previous Field of study: Any field of study Service contract: None Further information: year Value: Amount varies 6 5 Bursaries 153 The Secretary Eligibility. Awarded on the basis of ability in rugby and PO Box 22 JAMES DAVID LENNOX MEMORIAL FUND proven record to a registered full-time student. LOUISVALE 8809 Field of study. Any field of study Aptitude for academic work and personal circum- Information not confirmed Value: At the discretion of the University stances will also be taken into account Duration: 1 year, renewable subject to satisfactory Service contract: None JACK PALMER EDUCATION TRUST BURSARY progress for a maximum period of 4 years Closing date: 10 January Further information: Field of study. Any field of study Tenable at University of the Witwatersrand Financial Aid & Scholarship Office Value: Tuition and books Eligibility. Awarded on the basis of financial need and University of the Witwatersrand Duration: 1 year academic performance to students registered for Private Bag 3 Tenable at: University of Natal, University of South professional degrees at the University of the Witwa- WITS 2050 Africa or any technikon tersrand Eligibility. White male undergraduate students aged Service contract. None JOEY HANEKOM BURSARY 14 to 23, resident in Natal, who are earning their own Closing date: 30 September living and are in need of financial assistance to enable Further information: Field of study. Any field of study them to prepare for an examination which is a The Senior Assistant Registrar Value: Amount varies necessary preliminary of admission to a profession in Financial Aid and Scholarships Tenable at University of Stellenbosch the RSA University of the Witwatersrand Eligibility. Awarded on the basis of financial need and Service contract: None Private Bag 3 merit to women students Closing date: 30 November WITS 2050 Closing date: 15 January Further information: Further information: The Trustees JAMES ROBERTSON BURSARY The Registrar (Bursaries and Loans) Jack Palmer Education Trust (Ref 0) Field of study. Any field of study University Private Bag Xl c/o Standard Trust Ltd Value: As decided by the Trustees PO Box 933 Duration: As decided by the Trustees MAT1ELAND 7602 JOHANNESBURG 2000 Tenable at University of the OFS JOHAN AND WILLIE SPIES BURSARY Information not confirmed Eligibility. Matriculants of Wepener Service contract: None Field of study. Any field of study JACOB AND PAULINE PERTZ SCHOLARSHIP Closing date: 31 January Value: Amount varies Field of study. Any field of study Further information: Duration: Duration of the course if progress is Value: At the discretion of the University The Magistrate satisfactory Duration: 1 year Private Bag X4 Tenable at: University of Stellenbosch Tenable at: University of the Witwatersrand WEPENER 9944 Eligibility Decendants of the late Johannes Jacobus Eligibility. Awarded on the basis of academic merit to Spies and Wilhelmina Christina Spies for an under- undergraduate students JAN AND MARTIE BOOT BURSARY graduate course at Stellenbosch or elsewhere Service contract: None Field of study Any field of study Service contract: None Closing date: 15 January Closing date: 10 January Value: Amount varies Further information: Duration: 1 year, renewable on reapplication Further information: The Registrar (Bursaries and Loans) The Financial Aid Office Tenable at: Technikon Pretoria University of the Witwatersrand Eligibility. Awarded on the basis of outstanding University of Stellenbosch Private Bag 3 academic performance and financial need to regis- Private Bag X1 WITS 2050 tered full-time students MAT1ELAND 7602 Closing date: 30 September (year) and 30 April JOHAN VAN RENSBURG STUDY FUND JACOB FRANK SCHOLARSHIP (semester courses in the same year) Field of study. Any field of study Further information: Field of study. Any field of study Value: R450 pa. The Chairperson Value: Amount varies Duration: Minimum duration of the course Bursary Committee Duration: 1 year Tenable at: University of Cape Town Technikon Pretoria Tenable at University of Stellenbosch Eligibility. First-year students whose parents have Private Bag X680 Eligibility. Awarded on the basis of merit and financial resided in Cape Town for at least ten years prior to PRETORIA 0001 need. Preference will be given to candidates from the the award and continue to do so for the duration of Uniondale district who matriculated at the High the scholarship JANE KUMMER BURSARY School Uniondale Service contract: None Field of study Any field of study Closing date: 15 January Closing date: Advertised annually in January when Value: At the discretion of the University Further information: available Duration: One year, renewable on reapplication The Registrar (Bursaries and Loans) Further information: subject to satisfactory academic performance and University of Stellenbosch The City Administration Dept continued financial need Private Bag Xl PO Box 298 Tenable at University of the Witwatersrand MATIELAND 7602 CAPE TOWN 8000 Eligibility. Awarded on the basis of financial need and JOHANNESBURG CITY COUNCIL BURSARIES Information not confirmed academic achievement to students who matriculated at Springs Boys' or Girls' High Schools UNIVERSITY- ADMINISTERED JACOBS FAMILY BURSARY Service contract None Field of study Any field of study Field of study. Any field of study Closing date: 30 September Value: 50%- 100% of tuition fees Value: Tuition and residence fees Further information: Duration: One year, renewable subject to satisfactory Duration: Maximum of 3 years The Senior Assistant Registrar progress for the prescribed duration of one bachelor's Tenable at University of Stellenbosch or University of Financial Aid and Scholarships degree up to a maximum of 6 years the OFS University of the Witwatersrand Tenable at University of the Witwatersrand Eligibility. Awarded on the basis of financial need and Private Bag 3 Eligibility. Awarded on the basis of financial need and merit to students who are direct descendants of Jan WITS 2050 academic performance to matriculants and students Abraham Jacobs and members of the Dutch Re- in any year of study who are residents of Johannes- formed Church JOE KAMINER RUGBY BURSARY burg and surrounding areas Service contract: None Field of study. Any field of study Service contract None Closing date: 15 January Value: Not specified Closing date: 30 September Further information: Duration: 1 year Further information: The Senior Assistant Registrar The Registrar (Bursaried and Loans) Tenable at: University of the Witwatersrand University of Stellenbosch Financial Aid and Scholarships Private Bag Xl University of the Witwatersrand MAT1ELAND 7602 Private Bag 3 169 154 Bursaries WETS 2050 JUNIOR RAPPORTRYERSKORPS DEBATSKOMPE- Eligibility Full-time students who are permanent TISIE-BEURSE residents of Kempton Park JOHN BRUNTON WHITE BURSARY Field of study. Any field of study Service contract: None Closing date: End of October Field of study: Any field of study Value: One year's tuition fees for the winner and Further information: Value: Amount varies RI 000 for the runner-up for undergraduate studies. Head Duration: 1 year, renewable Regional winners receives R500 Management Tenable at: Rhodes University Duration: 1 year Kempton Park City Council Eligibility: Awarded on the basis of financial need and Tenable at: Potchefstroom University for CHE academic ability, with first preference being given to Eligibility Winners and runners-up of the JRK Debate PO Box 13 the children of old Rhodians Competition KEMPTON PARK 1620 Information not confirmed Service contract: None Closing date: 15 October Closing date: 1 December Further information: Further information: Director: Student Financial Assistance KENNETH B. GLOAG BURSARY The Financial Aid Officer PU for CHE Field of study. Any field of study Rhodes University P/Bag X1006 Value: Amount varies PO Box 94 POTCHEFSTROOM 2520 Duration: 3 years GRAHAMSTOWN 6140 Tenable at Rhodes University Information not confirmed JUTA BURSARY FUND Eligibility: Awarded on the basis of financial need and Field of study Any field of study academic ability to pupils of the Collegiate School, JOHN HURWITZ BURSARY Value: Amount varies Port Elizabeth, and Riebeek College, Uitenhage, who have been in continuous attendance at one of these Field of study. Any field of study Duration: 1 year schools for not less than 3 years at the time of the Value: At the discretion of the University Tenable at: University of the Western Cape award of the bursary Duration: One year, renewable on reapplication and Eligibility: Awarded on the basis of financial need and Service contract: None satisfactory academic progress academic achievement to full-time undergraduate Closing date: 15 January Tenable at: University of the Witwatersrand students Eligibility. Awarded on the basis of financial need and Service contract: None Further information: The principal of the school concerned academic performance Closing date: New first-year students: 1 March. Information not confirmed Service contract: None Current (Senior) students: 31 October of the previous Closing date: 30 September year KIMBERLEY AND KURUMAN DIOCESAN BUR- Further information: Further information: SARY FUND The Senior Assistant Registrar The Registrar Financial Aid and Scholarships University of the Westem Cape Field of study. Any field of study University of the Witwatersrand Private Bag X17 Value: Amount varies Private Bag 3 BELLVILLE 7535 Duration: 1 year, renewable WITS 2050 Tenable at: Any university, technikon, technical KANGWANE BURSARY college, teacher's training college, agricultural college, JOHN SAVOPOULOS BURSARIES Field of study Any field of study nursing college Field of study Any field of study Value: Amount vanes Eligibility. An Anglican resident in the Diocese of Kimberley and Kuruman for undergraduate study Value: R500 p.a. Duration: 1 year, renewable Duration: One year, renewable for the duration of the Tenable at: Any university Service contract: None Closing date: 30 November course Eligibility: Black undergraduate and postgraduate Further information: Tenable at: University of the Witwatersrand students The Diocesan Secretary Eligibility. Awarded on the basis of financial need and Service contract: One year service in Kangwane for academic performance to students domiciled in SA each year for which the bursary was awarded PO Box 45 and whose parents were bom in Greece or whose Closing date: 30 October KIMBERLEY 8300 home language is Greek. Preference will be given to Further information: KIMBERLEY CITY COUNCIL BURSARY applicants who are domiciled in the Transvaal The Secretary Service contract: None Dept of Education KNgwane Government Field of study. Any field of study Closing date: 30 September Private Bag X1002 Value: Amount varies Further information: LOUWS CREEK 1302 Duration: 1 year The Senior Assistant Registrar Information not confirmed Tenable at: Any university Financial Aid and Scholarships Eligibility. Kimberley residents only University of the Witwatersrand KEMPTON PARK CITY COUNCIL PRESTIGE Service contract: None Private Bag 3 BURSARY Closing date: 31 January WITS 2050 Field of study. Any field of study Further information: Value: R3 500 The City Secretary JOSEPH VAN PRAAGH TRUST BURSARY Duration: 1 year Kimberley Municipality Field of study: Any field of study Tenable at: Rand Afrikaans University Private Bag X5030 KIMBERLEY 8300 Value: Amount varies Eligibility. Awarded to matriculants from Kempton Duration: Duration of the course if progress is Park who obtain 6 or more distinctions KING SOLOMON MAPHUMZANA BURSARY satisfactory Service contract: None FUND Tenable at: Any university or institution for higher Closing date: 31 October technical education Further information: Field of study. Any field of study Eligibility. Awarded on the basis of financial need to The Manager Value: R500 pa. white matriculants or students who are resident in Management Services Duration: 1 year, renewable on application Kimberley or the district of Kimberley. Award is based Town Council of Kempton Park Tenable at: Any university, technikon or college of on academic merit and personal qualities such as PO Box 13 education leadership, perseverance, etc. KEMPTON PARK 1620 Eligibility Undergraduate students Service contract: None Information not confirmed Service contract: None Closing date: 31 July Closing date: 31 October Further information: KEMPTON PARK CITY COUNCIL BURSARY Further information: Bloemboard SCHEME The Secretary King Solomon Maphumzana Bursary PO Box 335 Field of study: Any field of study BLOEMFONTEIN 9300 Value: RI 500 each Private Bag X09 Information not confirmed Duration: Single payment ULUNDI 3838 Tenable at: Any university or technikon in South Africa Information not confirmed 170 Bursaries 155 KLERKSDORP ROTARY CLUB LOAN FUND PO Box 524 Eligibility. Awarded on the basis of financial need and AUCKLAND PARK 2006 academic performance Field of study: Any field of study Service contract None Value: Amount varies KRUGERSDORP TOWN COUNCIL BURSARY Closing date: 30 September Duration: 1 year, renewable if'progress is satisfactory LOAN Further information: Tenable at: Potchefstroom University for CHE The Senior Assistant Registrar Eligibility: Matriculants from Klerksdorp, Orkney, Field of study. Any field of study Financial Aid and Scholarships Hartbeesfontein or Stilfontein Value: R3 000 p.a. University of the Witwatersrand Service contract: None Duration: Duration of the course Closing date: 15 October Tenable at: Any technikon, university or teacher's Private Bag 3 Further information: training college WITS 2050 The Director Eligibility. Students whose parents have been LANGENHOVEN CENTENARY BURSARY Dept Bursaries & Loans residential tax payers of Krugersdorp for at least three PU for CHE years Field of study. Any field of study Private Bag X6001 Service contract None Value: R750 POTCHEFSTROOM 2520 Closing date: 15 January Duration: Three years Further information: Tenable at: University of Stellenbosch KLERKSDORPSE AFRIKAANSE SAKEKAMER The Town Treasurer Eligibility English-speaking SA citizens whose MERIETEBEURS PO Box 94 scholastic work was of a high standard and who can furnish evidence of extramural cultural and/or sports Field of study. Any field of study KRUGERSDORP 1740 activities Value: Amount varies Duration: 1 year KUSHLICK/KAPLAN BURSARY SCHEME Service contract: None Closing date: 15 January Tenable at: Potchefstroom University for CHE Field of study. Any field of study Further information: Eligibility. On the basis of extramural achievements to Value: Amount varies The Registrar (Bursaries and Loans) a matriculant who attended a high school in Duration: Normal duration of a course University of Stellenbosch Klerksdorp or Stilfontein Tenable at Any tertiary institution P/Bag Xl Service contract: None Eligibility. Awarded on the basis of outstanding MATIELAND 7602 Closing date: 15 October academic results and/or financial need to under- Further information: graduate students LEADERSHIP (CATEGORY WINNERS US DEBAT- The Director Service contract None ING COMPETITION) BURSARIES Dept Bursaries & Loans Closing date: Mid August PU for CHE Further information: Field of study Any field of study Private Bag X6001 The Secretary Value: R100R300 POTCHErs i ROOM 5250 Kushlick/Kaplan Bursary Duration: Awarded annually Cape Gate (Ply) Ltd Tenable at: University of Stellenbosch KOBUS VERSTER STUDY FUND PO Box 54 Eligibility Undergraduate students who are winners and runners-up of the orator and debating competi- Field of study. Any field of study VANDERBULPARK 1900 tions Value: At the discretion of the Trustees Service contract: None Tenable at: Any Afrikaans university L.M.C. BENDIKS-BEURS Closing date: None Eligibility. Awarded on the basis of financial need and Field of study. Any field of study Further information: satisfactory academic performance to students who Value: Amount varies The Registrar (Bursaries and Loans) intend to study at an Afrikaans university Tenable at. University of Stellenbosch University of Stellenbosch Service contract: None Eligibility: Awarded on the basis of financial need and Private Bag Xl Closing date: Contact the university concemed merit to undergraduate students MATIELAND 7602 Further information: Service contract None The bursary officer of the university concerned Closing date: 15 January Further information: LEADERSHIP (HEADPREFECTS) BURSARY KOOS DU TOIT AND LOWISA GRIEBENOW The Registrar (Bursaries and Loans) Field of study. Any field of study STUDY LOAN FUND University of Stellenbosch Value: R1 000 Duration: 1 year Field of study. Any field of study Private Bag Xl Tenable at University of Stellenbosch Value: Maximum of R6 160 p.a. MATIELAND 7602 Eligibility. Awarded to first-year students who were Duration: 1 year headprefects Tenable at Rand Afrikaans University LADYSMITH CITY COUNCIL BURSARY Service contract None Eligibility. Awarded on the basis of financial need and Field of study. Any field of study Closing date: 15 January academic merit to white full-time undergraduate and Value: Approximately R300 each Further information: postgraduate students who are Christian national Duration: 1 year, renewable up to 4 years maximum The Registrar (Bursaries and Loans) orientated Tenable at Any tertiary institution University of Stellenbosch Service contract: None Eligibility. South Africans who have resided in P/Bag X1 Closing date: 15 November Ladysmith and been educated in Ladysmith for a MATIELAND 7602 Further information: continuous period of five years preceding the date of The Registrar (Finance) award. Applications from outside the Ladysmith area LEADERSHIP (PRESIDENT SCOUTS) BURSARY Rand Afrikaans University will NOT be considered PO Box 524 Service contract None Field of study. Any field of study AUCKLAND PARK 2006 Closing date: December Value: RI 000 Further information: Duration: 1 year KRUGERSDORP KRUGER FESTIVAL STUDY LOAN The Town Secretary Tenable at: University of Stellenbosch FUND PO Box 29 Eligibility. First-year students who received the President Scouts award Field of study. Any field of study LADYSMITH 3370 Service contract None Value: R6 160 p.a. Information not confirmed Closing date: 15 January Duration: 1 year Further information: Tenable at: Rand Afrikaans University LAKOFSKI BURSARIES The Registrar (Bursaries and Loans) Eligibility. Awarded on the basis of financial need and Field of study. Any field of study University of Stellenbosch merit to pupils from the district of Krugersdorp Value: At the discretion of the University P/Bag Xl Service contract: None Duration: One year, renewable annually for the MAT1EIAND 7602 Closing date: 15 November duration of the course subject to satisfactory progress Further information: and conduct The Registrar (Finance) Tenable at University of the Witwatersrand Rand Afrikaans University 156 171 Bursaries LEADERSHIP (US HONORARY AWARD AND PO Box 206 Eligibility Awarded on the basis of financial need and JUNIOR RAPPORTRYERS DEBATING COMPETI- CAPE TOWN 8000 merit to white undergraduate students TION) BURSARY Service contract None Closing date: 15 January Field of study Any field of study LO MING-YUAN SCHOLARSHIP Further information: Value: R500R1 000 Field of study. Any field of study The Registrar (Bursaries and Loans) Duration: Awarded annually Value: R500 p.a. University of Stellenbosch Tenable at University of Stellenbosch Duration: Iyear, renewable Private Bag Xl Eligibility. Undergraduate students who are recipients Tenable at: Any university MATIELAND 7602 of honorary cultural achievement awards by the Eligibility. Matriculants of Chinese parentage who are University as well as winners and semi-final winning entering the university for the first time M.M. ROBERTSON BURSARY team of the annually Rapportryers Debating Compe- Service contract: None tition Closing date: 31 January Field of study Any field of study Service contract: None Further information: Value: Amount varies Closing date: 15 January The Administrator Duration: 1 year Further information: LO Ming-Yuan Scholarship Fund Tenable at: University of Stellenbosch The Registrar (Bursaries and Loans) PO Box 25202 Eligibility. Awarded on the basis of financial need and University FERREIRASTOWN 2048 merit P/Bag Xl Information not confirmed Service contract: None MATIELAND 7602 Closing date: 15 January LOUIS LANDAU SCHOLARSHIP Further information: The Registrar (Bursaries and Loans) LEADERSHIP (WINNER ATKB ORATOR COMPE- Field of study Any field of study University of Stellenbosch TITION) BURSARY Value: At the discretion of the University Private Bag X1 Field of study Any field of study Duration: One year, renewable for a maximum of 3 MATIELAND 7602 Value: RI 000 p.a. years subject to satisfactory progress Duration: 3 years Tenable at: University of the Witwatersrand M.S.B. KRITZINGER BURSARY Tenable at: University of Stellenbosch Eligibility. Awarded on the basis of financial need and Eligibility. Awarded to the winner of the Afrikaanse academic performance to students of European Field of study: Any field of study Taal-- en Kultuurbond orator competition parentage born in SA or in Zimbabwe Value: Determined annually Service contract: None Service contract: None Duration: 1 year Closing date: 15 January Closing date: 30 September Tenable at: University of Pretoria Further information: Further information: Eligibility Awarded to Kritzinger descendants with The Registrar (Bursaries and Loans) The Senior Assistant Registrar preference to those who find it financially difficult to University of Stellenbosch Financial Aid and Scholarships study Private Bag X1 University of the Witwatersrand Service contract: None MATIELAND 7602 Private Bag 3 Closing date: 15 October WITS 2050 Further information: LEADERSHIP BURSARIES The Head (Study Finance) University of Pretoria Field of study. Any field of study LOUIS OSTROWIAK MEMORIAL BURSARY PRETORIA 0002 Value: RI 000 maximum Field of study: Any field of study Duration: 1 year Value: At the discretion of the University MAKRO SA (PTY) LIMITED BURSARY Tenable at: University of Pretoria Duration: One year, renewable annually for a Eligibility. Candidates entering university for the first maximum of 3 years subject to satisfactory progress Field of study. Any field of study time and who fulfilled a leadership role in Std 9 or and good conduct Value: Approximately R6 000 matric in school or extra-murally in the fields of Tenable at: University of the Witwatersrand Tenable at: Any university sport, culture or other activities Eligibility Awarded on the basis of financial need and Eligibility. Makro employees' dependants only who Service contract: None academic performance to students who have intend to do undergraduate or postgraduate studies Closing date: 15 October successfully completed their first year of study in any Closing date: 1 S July Further information: degree course Further information: The Head (Study Financing) Service contract: None Bursary Committee University of Pretoria Closing date: 30 September Makro SA (Pty) Ltd PRETORIA 0002 Further information: PO Box 471 The Senior Assistant Registrar JOHANNESBURG 2000 LETTIE FOUCHE TRUSTFUND LOAN Financial Aid and Scholarships MALAN BURSARY Field of study. Any field of study University of the Witwatersrand Value: According to merit Private Bag 3 Field of study. Any field of study Duration: 1 year WITS 2050 Value: R800 Tenable at: University of the OFS Duration: 1 year Eligibility. ONLY students who matriculated at LOUISE AND NELLIE HERMAN BURSARY Tenable at: University of Stellenbosch Rouxville, Free State Field of study: Any field of study Eligibility. Awarded on the basis of financial need and Closing date: 31 October Value: Amount varies merit to students, born Malan Further information: Duration: 1 year, renewable if progress is satisfactory Service contract: None J. Fouche & Kie Tenable at: Any university Closing date: 15 January PO Box 54 Eligibility. Male or female Jewish students Further information: ROUXVILLE 9958 Service contract: None The Registrar (Bursaries and Loans) Closing date: 31 October University of Stellenbosch LEWIS COWAN BURSARY Further information: Private Bag Xl MATIELAND 7602 Field of study. Any field of study The Trustees Louise & Nellie Herman Bursary Value: Amount varies MARIA CILLIE BURSARY Duration: 1 year, renewable if progress is satisfactory PO Box 206 Tenable at: Any tertiary institution CAPE TOWN 8000 Field of study Any field of study Eligibility Jewish students and non-white orphans Value: RI 000 each who live and wish to study in the Western Cape M.M. HATTINGH STUDY BURSARY Duration: 1 year Service contract: None Field of study: Any field of study Tenable at University of Stellenbosch Closing date: 31 December Value: R2 500 p.a. Eligibility: Awarded on the basis of financial need to Further information: Duration: 1 year, renewable if progress is satisfactory female students (first-year students excluded) The Trustees Tenable at: University of Stellenbosch Closing date: 15 January Lewis Cowan Trust Further information: 172 Bursaries 157 The Registrar (Bursaries and Loans) Eligibility Headboys and headgirls from high schools MOBIL FOUNDATION BURSARIES Service contract None University of Stellenbosch Field of study. Any field of study Private Bag X1 Closing date: 15 October Value: RI 0 000 available to 10 students MATIE1AND 7602 Further information: Tenable at University of Transkei The Director (Financial Bureau) Eligibility Awarded on the basis of academic MARIA MALAN CLUB BURSARY PU for CHE achievement to Transkeian born students P/Bag X1006 Reld of study. Any field of study Closing date: Contact the University Value: R860 to R4 680 pa. POTCHEFSTROOM 2520 Further information: Duration: 1 year, renewable The Bursary Officer Tenable at: Rand Afrikaans University MERIT BURSARY OF THE DEAN OF STUDENT Financial Aid Bureau Eligibility: Needy and meritworthy full-time under- AFFAIRS (TECHNIKON PRETORIA) University of Transkei graduate students (SA citizens) from the West Rand Field of study: Any field of study Private Bag X1 area Value: Determined annually UNITRA 5117 Service contract: None Duration: 1 year, renewable on reapplication Closing date: 15 November Tenable at Technikon Pretoria MUNICIPAL UNIVERSITY SCHOLARSHIP Further information: Eligibility. Awarded on the basis of outstanding Reld of study Any field of study The Registrar (Finance) academic performance and financial need to regis- Value: RI 000 each Rand Afrikaans University tered full-time students Duration: Minimum duration of the course PO Box 524 Closing date: 30 September (year) and 30 April Tenable at: University of Cape Town AUCKLAND PARK 2006 (semester courses in the same year) Eligibility. First-year students whose parents have Further information: resided in the Cape Town municipal area for at least MARIA VAN RIEBEECK CLUB BURSARY The Chairman: Bursary Committee five years prior to the award. No concurrent awards Field of study. Any field of study Technikon Pretoria without city council's permission Value: R860 to R8 030 p.a. Private Bag X680 Service contract: None Duration: 1 year, renewable PRETORIA 0001 Closing date: January Tenable at: Rand Afrikaans University Further information: Eligibility. Needy and meritworthy undergraduate and METHODIST BURSARY FUND The Town Clerk's Department postgraduate students. Preference to students and Held of study. Any field of study Scholarship Executor Committee children of members of the Maria van Riebeeck Club Value: RI 500 p.a. PO Box 298 (proof of membership is required) Duration: 1 year, renewable for a maximum of 4 CAPE TOWN 8000 Service contract: None years Information not confirmed Closing date: 15 November Tenable at: Any tertiary institution Further information: Eligibility. Black students who are members of the N.F. PATTERSON BURSARY The Registrar (Finance) Methodist Church of Southem Africa, and who are Field of study Any field of study Rand Afrikaans University permanent residents in one of the three Gauteng Value: Rl 2 000 PO Box 524 districts of the church Duration: 1 year AUCKLAND PARK 2006 Service contract: None Tenable at University of the Witwatersrand Closing date: 30 September Eligibility Awarded on the basis of financial need and MARITZ JOHN PLEN BURSARY Further information: satisfactory academic performance to undergraduate Field of study. Any field of study The Methodist Church of SA students Value: Amount varies Northem District Finance Committee Service contract: None Duration: 1 year, renewable subject to satisfactory PO Box 1572 Closing date: 30 September performance and conduct JOHANNESBURG 2000 Further information: Tenable at University of the Witwatersrand The Senior Assistant Registrar Eligibility Awarded on the basis of financial need and METHODIST CHURCH OF SOUTHERN AFRICA - Financial Aid & Scholarships satisfactory academic performance to matriculants or BOARD OF EDUCATION BURSARY University of the Witwatersrand students in any year of study Field of study. Any field of study Private Bag 3 Service contract: None Value: R1 500 p.a. WITS 2050 Closing date: 30 September Duration: 1 year, renewable up to 4 years maximum Further information: Tenable at: Any tertiary institution NATAL COLOURED BURSARY FUND The Senior Assistant Registrar Eligibility. Students in any year of study who are Field of study Any field of study Financial Aid & Scholarships members of the Methodist Church of Southern Africa Value: Amount varies University of the Witwatersrand Service contract: None Duration: 1 year Private Bag 3 Closing date: 30 September Tenable at: University of the Western Cape, University WITS 2050 Further information: of Natal Connexional Bursary Eligibility. Students for first year of study MAUERBERGER FOUNDATION BURSARY Secretary Service contract: None Field of study. Any field of study Methodist Church of SA Closing date: 15 September Value: Amount varies PO Box 1572 Further information: Duration: 1 year JOHANNESBURG 2000 The Secretary Tenable at: University of the Western Cape Natal Coloured Bursary Trust Eligibility Full-time students MICHAEL ZARCHI BURSARY 57 Almond Road Service contract: None Field of study. Any field of study WOODLANDS Closing date: First-year students 1 March; seniors 31 Value: At the discretion of the University PIETERMARITZBURG 3201 October of the previous year Duration: 1 year, renewable Information not confirmed Further information: Tenable at: University of the Witwatersrand Financial Aid Office Eligibility: Awarded on the basis of financial need and NATIONAL BEVERAGE SERVICES (COCA-COLA) University of the Western Cape satisfactory academic performance BURSARY Private Bag X17 Service contract: None Field of study Any field of study BELLVILLE 7535 Closing date: 30 September Value: R5 000 Further information: Duration: 1 year, renewable if progress is satisfactory MERIT BURSARIES FOR HEADBOY AND The Senior Assistant Registrar Tenable at: University of the North West HEADGIRL (PU FOR CHE) Financial Aid & Scholarships Eligibility. Awarded on the basis of academic Reld of study: Any field of study University of the Witwatersrand achievement and financial need to enrolled students Value: R600 pa. Private Bag 3 or students planning to enrol Duration: 3 years WITS 2050 Service contract: None Tenable at: Potchefstroom University for CHE 158 173 Bursaries Closing date: Notices will be posted at the financial The Secretary Eligibility Members of the Dutch Reformed Church. aid office NUCT Their parents must reside in the OFS Further information: PO Box 4659 Service contract: None The Financial Aid Officer JOHANNESBURG 2000 Closing date: 31 August University of the North West Information not confirmed Further information: Private Bag X2046 Director MMABATHO 8681 NEDERDUITSCH HERVORMDE Administration & Finance Information not confirmed SUSTERSVERENIGING (NHSV) STUDY LOAN PO Box 399 Field of study: Any field of study BLOEMFONTEIN 9300 NATIONAL BEVERAGES BURSARY Value: R1 000 to R2 000 p.a. Field of study. Any field of study Duration: Duration of the course NORMAN BAXTER UNIVERSITY LOAN FUND Value: Amount varies Tenable at: Any university Field of study Any field of study Duration: 1 year Eligibility Students who are members of the Neder- Value: RI 000 Tenable at: University of the Western Cape duitsch Hervormde Kerk van Afrika Duration: 1 year, renewable if progress is satisfactory Eligibility. Full-time students Service contract: None Tenable at: Any university or other institution for Service contract: None Closing date: Contact the university concerned tertiary education Closing date: First-year students 1 March; seniors 31 Further information: Eligibility Undergraduate students who have October of the previous year The Administrator successfully completed their first year of study and Further information: Ned Hery Kerk van Afrika who are dependants of residents of East London Financial Aid Office PO Box 2368 Service contract: None University of the Western Cape PRETORIA 0001 Closing date: 31 January Private Bag X17 Information not confirmed Further information: BELLVILLE 7535 The Secretary NEIL SYMONS ATHLETIC BURSARY Norman Baxter University Loan Fund NATIONAL EXPO-COMPETITION BURSARY Field of study. Any field of study PO Box 13157 Field of study. Any field of study Value: Not specified VINTCENT 5217 Value: RI 500 (gold) for the winner and RI 000 Duration: 1 year, renewable subject to academic and (silver) and R500 (bronze) for the runners-up sporting achievement NORTHWOOD JUBILEE SCHOLARSHIP Duration: 1 year Tenable at: University of the Witwatersrand Field of study Any field of study Tenable at: Potchefstroom University for CHE Eligibility. Awarded on the basis of outstanding ability Value: R6 000 p.a. Eligibility Undergraduate students in athletics and acceptable academic performance to Duration: 1 year only Closing date: 15 October an undergraduate or postgraduate (full-time or part- Tenable at Any university in South Africa Further information: time) student Eligibility. Only full-time, undergraduate students The Director (Financial Bureau) Service contract: None who are past pupils of Northlands Boys High School, PU for CHE Closing date: 10 January Beachwood High School or Northwood School P/Bag X1006 Further information: Service contract: None POTCHEFSTROOM 2520 Financial Aid & Scholarship Office Closing date: 30 September University of the Witwatersrand Further information: NATIONAL OLYMPIAD BURSARIES P/Bag 3 The Secretary Field of study. Any field of study WITS 2050 Northwood High School Value: One year's tuition fees for the winner and RI PO Box 20079 000 for the runner-up NELSPRUIT TOWN COUNCIL BURSARY DURBAN NORTH 4016 Duration: 1 year Field of study Any field of study Information not confirmed Tenable at: Potchefstroom University for CHE Value: R2 500 for full-time Eligibility. The winner and runner-up of the National Duration: Duration of the course OK BAZAARS BURSARY Olympiads Tenable at: Any tertiary institution in SA Field of study Any field of study Service contract: None Eligibility: Residents of Nelspruit only Value: Tuition and residence fees when necessary Closing date: 15 October Service contract: None Duration: Renewable annually Further information: Closing date: 30 November Tenable at: Any tertiary institution in South Africa The Director (Financial Bureau) Further information: Eligibility. Children of employees who died while in PU for CHE The Town Clerk the service of OK Bazaars or children of staff or P/Bag X1006 Town Council of Nelspruit pensioners who have had at least 5 years' service with POTCHEFSTROOM 2520 PO Box 45 the OK. Awarded on the basis of academic adequacy, NELSPRUfT 1200 financial need and length of service of employee NATIONAL STUDENT FINANCIAL AID SCHEME Service contract: N.a. (NSFAS) NG GEMEENTE BLOEMFONTEIN-WES-BEURSE Closing date: 30 September Field of study. Any field of study Field of study Any field of study Further information: Value: Amount varies. R800RI 0 000 Duration: 1 year The Personnel Controller Duration: 1 year Tenable at: University of the OFS Bursary Department Tenable at: Any university or technikon in SA Eligibility. Undergraduate students living in the parish OK Bazaars (1929) Ltd Eligibility. Academically deserving students in financial of Bloemfontein West and who are members of the PO Box 3171 need. They must also be South Afican citizens Dutch Reformed Church JOHANNESBURG 2000 Closing date: Contact the institution concerned Closing date: 15 December Further information: Further information: OLD MUTUAL LOAN FUND The bursary office of the institution concerned Director (Financial Assistance) Field of study: Any field of study University of the OFS Value: RI 000R5 000 NATIONAL UNION OF COMMERCIAL TRAVEL- PO Box 339 Duration: Duration of the course LERS BURSARY BLOEMFONTEIN 9300 Tenable at: University of Stellenbosch Eligibility. Granted on the basis of financial need and Field of study. Any field of study merit to gifted undergraduate students Value: R260 p.a. NG KERK (VRYSTAAT) BEURSE Service contract: None Duration: 1 year, renewable Field of study: Any field of study Closing date: 15 January Tenable at: Any university in SA Value: Variable Eligibility: Undergraduate students vho are depend- Duration: 1 year Further information: The Registrar (Bursaries and Loans) ants of members of NUCT Tenable at: Technikon Free State, University of the University of Stellenbosch Service contract: None OFS, Bloemfontein Teacher's Training College or any P/Bag X1 Closing date: 31 January other university or technikon if the course is not MATIELAND 7602 Further information: offered in the OFS 174 Bursaries 159 Service contract: None Closing date: New first-year students: 1 March; Senior OLD RHODIAN UNION BURSARIES AND Closing date: 15 January students: 31 October of the previous year GRANTS Further information: Further information: Field of study Any field of study The Registrar (Bursaries and Loans) The Financial Aid Office Value: Amount varies University of Stellenbosch University of the Western Cape Duration: 1 year, renewal considered on reapplication P/Bag X1 Private Bag X17 Tenable at: Rhodes University MAT1ELAND 7602 BELLVILLE 7535 Eligibility. Awarded on the basis of financial need and academic ability. Preference to the dependants of Old ORKNEYSE AFRIKAANSE SAKEKAMER-BEURS P.W. BOTHA BURSARY Rhodians. Dependants of former choir members Field of study Any field of study Field of study. Any field of study receive preference for the Doc and Mamma Gruber Value: Amount varies Value: Tuition and residence fees Bursary Tenable at: Potchefstroom University for CHE Duration: 1 year, renewable Service contract: None Eligibility. Undergraduate or postgraduate students Tenable at Potchefstroom University for CHE, Closing date: 1 December from Orkney University of Port Elizabeth Further information: Closing date: 30 November Eligibility. Dependent children of members of the SA The Financial Aid Officer Further information: Defence force who as a result of military operations or Rhodes University The Chairman operational training die or are officially declared PO Box 94 Orkneyse Afrikaanse Sakekamer disabled GRAHAMSTOWN 6140 PO Box 1 Service contract: None Information not confirmed ORKNEY 2620 Closing date: 30 October Information not confirmed Further information: OLLEY AND MEYER BURSARY The Secretary Field of study. Any field of study OUD-MATIE GHOLFKLUB (TRANSVAAL) BEURS PW Botha Bursary Value: R860 up to R4 680 p.a. Field of study Any field of study Private Bag X686 Duration: 1 year, renewable Value: Amount varies PRETORIA 0001 Tenable at Rand Afrikaans University Duration: 1 year, renewable if progress is satisfactory Information not confirmed Eligibility: Awarded on the basis of financial need to Tenable at University of Stellenbosch full-time, Afrikaans-speaking students Eligibility. Awarded on the basis of financial need, PARKHURST DUTCH REFORMED COMMUNITY Service contract: None academic and sports achievements to full-time BURSARY Closing date: 15 November undergraduate students from the second year of Field of study. Any field of study Further information: study Value: R860 up to R4 680 p.a. The Registrar (Finance) Service contract. None Duration: 1 year, renewable Rand Afrikaans University Closing date: 15 January Tenable at Rand Afrikaans University PO Box 524 Further information: Eligibility. Full-time undergraduate students AUCKLAND PARK 2006 Oud-Matie Golf Club (Transvaal) Closing date: 15 November PO Box 48898 Further information: OPEN SOCIETY SCHOLARS FUND BURSARIES ROOSEVELTPARK 2129 The Registrar (Finance) Field of study. Any field of study Rand Afrikaans University Value: Amount varies OUD-MATIE GHOLFKLUB (SUIDE) PO Box 524 Duration: 1 year, renewable on reapplication subject Field of study. Any field of study AUCKLAND PARK 2006 to continued financial need Value: Amount varies Tenable at University of the Witwatersrand Duration: 1 year, renewable PATRICK FLANAGAN AND WILF ISAACS Eligibility. Awarded on the basis of financial need and Tenable at University of Stellenbosch CRICKET BURSARY satisfactory academic performance to black students Eligibility. Awarded on the basis of financial need, Field of study. Any field of study Service contract: None academic merit and golf performance to full-time Value: Amount varies Closing date: 30 September students Duration: 1 year, renewable Further information: Service contract: None Tenable at: University of the Witwatersrand The Senior Assistant Registrar Closing date: 15 January Eligibility. Registered full-time or part-time under- Financial Aid & Scholarships Further information: graduate or postgraduate students with an out- University of the Witwatersrand Oud-Matie-Gholf Klub (Suide) standing ability in cricket and a satisfactory academic Private Bag 3 Department of Public Relations performance. They must also be registered with the WITS 2050 University of Stellenbosch Wits Sports Council and be active members of the Private Bag X1 Cricket Club OPERATION EDUCATION AME CHURCH MAT1ELAND 7602 Service contract: None BURSARY Closing date: 10 January Field of study. Any field of study OUD-STUDENTELENINGSFONDS Further information: Value: Amount varies Field of study. Any field of study Senior Assistant Registrar Tenable at Peninsula Technikon Value: Amount varies Financial Aid & Scholarships Eligibility. Diploma students who are members of the Duration: 1 year University of the Witwatersrand AME Church ONLY Tenable at Potchefstroom University for CHE P/Bag 3 Service contract: None Eligibility Only a student with at least one parent who WITS 2050 Closing date: 31 August was a former student and is or was a donor Further information: Closing date: 15 October PAUL ROOS GYMNASIUM (PRG) BURSARY Operation Education Further information: Field of study. Any field of study C/o Mr G Longwe Snr The Director (Financial Bureau) Value: R300 p.a. 150 Eleventh Ave PU for CHE Duration: 3 years KENSINGTON 7405 P/Bag X1006 Tenable at Any tertiary institute Information not confirmed POTCHEFSTROOM 2520 Eligibility. A matriculant from Paul Roos Gymnasium for 3 consecutive years ORANJEBOND BURSARY P.M. ANDERSON EDUCATIONAL TRUST Service contract: None Field of study. Any field of study Field of study. Any field of study Closing date: 28 February Value: R400 for the purchase of books Value: Variable Further information: Duration: 1 year Duration: 1 year The Rector Tenable at: University of Stellenbosch Tenable at: University of the Western Cape Paul Roos Gymnasium Eligibility. Matriculants from the Kakamas, Keimoes, Eligibility Awarded on the basis of financial need and STELLENBOSCH 7600 Kenhardt and Upington high schools who have academic merit to full-time undergraduate students already completed their first year of study Service contract None 75 Bursaries PAUL ROOS GYMNASIUM (PRG) BURSARY MATIELAND 7602 Eligibility. Undergraduate students who are descen- Field of study: Any field of study dants of the late PJJ. and FJ. du Preez Value: R500 p.a. PHILIP AND ISAAC ALBOW SCHOLARSHIP A & B Service contract None Duration: 1 year Field of study Any field of study Closing date: 15 December Tenable at: Any tertiary institute Value: R375 each p.a. for Scholarship A: R435 each Further information: Eligibility. Matriculants from Paul Roos Gymnasuim in p.a. for Scholarship B Director (Financial Assistance) any year of study Duration: Minimum duration of the course University of the OFS Service contract: None Tenable at: Universities of Cape Town and the PO Box 339 Closing date: 28 February Western Cape and Peninsula Technikon BLOEMFONTEIN 9300 Further information: Eligibility. Scholarship A: Residents of Cape Town or The Rector the Western Cape. Preference to first-year students PIETERSBURG/POLOKWANE TRANSITIONAL Paul Roos Gymnasium who have attended Maitland High School. Scholarship LOCAL COUNCIL STELLENBOSCH 7600 B: Residents of the Western Cape, as from the first Field of study. Any field of study year of study. Both scholarships are awarded on the Value: R2 240 PAULINE CUZEN BURSARY basis of academic achievement Duration: Minimum duration of the course if progress Field of study. Any field of study Service contract: None is satisfactory Value: Amount varies Closing date: Advertised annually in January when Tenable at Any technikon, university or technical Duration: 1 year, renewable subject to satisfactory available college in South Africa, excluding overseas studies academic progress Further information: Eligibility. School-leaving matriculants who are Tenable at: University of the Witwatersrand The Town Clerk's Department legitimate children of residents of Pieters- Eligibility. Awarded to black students on the basis of Scholarship Executor Committee burg/Polokwane for full-time undergraduate study financial need and satisfactory academic performance PO Box 298 Service contract: None Service contract: None CAPE TOWN 8000 Closing date: Mid December Closing date: 30 September Information not confirmed Further information: Further information: Head Management Services The Senior Assistant Registrar PHILIP AND RACHEL LEVY DONATION BURSARY Pietersburg/Polokwane Financial Aid & Scholarships Office Field of study. Any field of study Transitional Local Council University of the Witwatersrand Value: Amount varies PO Box 111 Private Bag 3 Duration: 1 year PIETERSBURG 0700 WITS 2050 Tenable at University of the Western Cape Eligibility. Matriculants from the Steinkopf High School PLATINUM MINES BURSARY PELOPONNESIAN SOCIETY OF SA BURSARY Service contract: None Field of study Any field of study Field of study: Any field of study Closing date: 31 January Value: R40 000 available to 5 students Value: Tuition fees Further information: Tenable at: University of Transkei Duration: Annually renewable for the duration of the Financial Aid Office Eligibility. Available to five Transkeian born students course if progress is satisfactory University of the Westem Cape Closing date: Contact the University Tenable at: Any university in the RSA Private Bag Xl 7 Further information: Eligibility. Full-time undergraduate students on the BELLVILLE 7535 The Bursary Officer basis of academic achievement and financial need. At Financial Aid Bureau least one parent should be of Greek origin PHILIP NEL MEMORIAL FUND BURSARY University of Transkei Service contract: None Field of study. Any field of study Private Bag X1 Closing date: 15 January Value: Maximum of R300 p.a. UNITRA 5117 Further information: Duration: Renewable annually for a maximum of 4 The Secretary years PORT ELIZABETH TECHNIKON ADMINISTERED Peloponnesian Society of SA Tenable at: An Afrikaans university or other advanced BURSARIES AND STUDY LOANS PO Box 28926 training institution Field of study Any field of study SANDRINGHAM 2131 Eligibility Children of Volkskas officials, pensioners or Value: Amount varies deceased Volkskas officials whose services at Tenable at: Port Elizabeth Technikon PERCY FOX FOUNDATION BURSARIES Volkskas were terminated through death Eligibility. Awarded on the basis of academic Field of study Any field of study Service contract: None achievement to students of sound moral character. Value: Amount vanes Closing date: 15 January Participation in social activities and leadership Duration: 1 year Further information: characteristics may also be taken into consideration. Tenable at: Rhodes University TheManager Applicants for sports grants should excel in the sport Eligibility Awarded to students for their second and Absa Trust Ltd of their choice and also comply with the academic third years of degree study with great emphasis Trust Division requirements placed on financial need PO Box 1033 Service contract: None Service contract: None SANLAMHOF 7532 Closing date: 1st semester: 15 August; 2nd semester: Closing date: 1 December 15 April Further information: PIET NEETHLING EDUCATIONAL TRUST BUR- Further information: The Financial Aid Officer SARY/LOAN The Registrar Rhodes University Field of study Any field of study Attention: Bursaries Officer PO Box 94 Value: Amount varies Port Elizabeth Technikon GRAHAMSTOWN 6140 Duration: Duration of the course Private Bag X6011 Information not confirmed Tenable at: University of Stellenbosch, Cape Tech- PORT ELIZABETH 6000 nikon PETRUSA VAN ZUL BURSARY Eligibility. Awarded on the basis of financial need as PREMIER FOOD INDUSTRIES LTD BURSARY Field of study. Any field of study well as academic and sports achievement Field of study Any field of study Value: Amount varies Closing date: Contact the institution concerned Value: Tuition and book fees Duration: 1 year Further information: Duration: 1 year, renewable if progress is satisfactory Tenable at: University of Stellenbosch The bursary office of the institution concerned Tenable at: Any university or technikon in SA Eligibility: Needy decendants of the six sisters of the Eligibility. Undergraduate students donor, the late Mrs. Petrusa Groenewald (née van ZijI) PIETER AND FLORRIE DU PREEZ BURSARY Service contract: None Closing date: 15 January Field of study: Any field of study Closing date: 30 September Further information: Value: Amount varies Further information: The Registrar (Bursaries and Loans) Duration: 1 year The Bursary Manager University of Stellenbosch Tenable at: University of the OFS Premier Food Industries Ltd PO Box X1 PO Box 87268 17G Bursaries 161 HOUGHTON 2041 PU for CHE Eligibility Undergraduate and diploma students on Private Bag X6001 the basis of financial need PRINSLOO-WOLMARANS STUDY FUND (LOAN) POTCHLI-s i ROOM 2520 Service contract None Field of study: Any field of study Closing date: 15 October Value: Determined according to merit PU FOR CHE CULTURAL PERFORMANCE Further information: Duration: Awarded annually, renewable if progress is BURSARIES The Director (Financial Bureau) satisfactory Field of study. Any field of study PU for CHE Tenable at Any South African university or technikon Value: Amount varies P/Bag X6001 Eligibility. Needy students. Preference to students Duration: 1 year POTCHEFSTROOM 2520 related to the Prinsloo and Wolmarans families Tenable at Potchefstroom University for CHE Service contract: None Eligibility. Awarded on the basis of participation, PU FOR CHE STUDY LOAN FUNDS Closing date: 31 January performance and leadership in cultural activities to Field of study Any field of study Further information: undergraduate students as well as National winner Value: Determined annually The Administrator and runner-up of National competitions Duration: 1 year Prinsloo-Wolmarans Study Fund Service contract: None Tenable at Potchefstroom University for CHE PO Box 2368 Further information: Eligibility Undergraduate students. More information PRETORIA 0001 The Director (Financial Bureau) can be obtained from Standard or ABSA Bank PU for CHE Closing date: 15 October PRIVATE SECTOR BURSARY FUND OF THE Private Bag X6001 Further information: PREMIER OF THE MPUMALANGA PROVINCE POTCHEFSTROOM 2520 The Director (Financial Bureau) Field of study. Any field of study PU for CHT Value: Amount varies PU FOR CHE FAMILY BURSARY Private Bag X6001 Duration: 1 year, renewable on reapplication Field of study. Any field of study POTCHEFSTROOM 2520 Tenable at: Technikon Pretoria Value: R1 000R2 000 Eligibility. Awarded on the basis of outstanding Duration: 1 year PU FOR CHE TRAVEL BURSARIES academic performance and financial need to regis- Tenable at Potchefstroom University for CHE Field of study Any field of study tered full-time students Eligibility. When two or more dependent members Value: R100 R500 p.a Closing date: 30 September (year) and 30 April from the same family are registered simultaneously Duration: Duration of the course (semester courses in the same year) and full-time for a degree course at this University, Tenable at Potchefstroom University for CHE Further information: where married couples are studying simultaneously Eligibility. Awarded to full-time students who's The Chairman: Bursary Committee at this University; and where a parent is studying residences are more than 150 km from the University Technikon Pretoria simultaneously with dependants at this University Service contract None Private Bag X680 Service contract None Closing date: 15 October PRETORIA 0001 Closing date: 15 October Further information: Further information: The Director (Finacial Bureau) PROF J.H. NEETHLING BURSARY The Director (Financial Bureau) PU for CHE Field of study. Any field of study PU for CHE Private Bag X6001 Value: Descendants: tuition fees; other students: R2 Private Bag X6001 POTCHEFSTROOM 2520 500 p.a. POTCHEFSTROOM 2520 Duration: Maximum of 3 years PU FOR CHE UNDERGRADUATE SCHOLARSHIPS Tenable at University of Stellenbosch PU FOR CHE SCHOLARSHIPS FOR BEGINNERS (ACADEMIC) Eligibility. Needy and promising students as from the (ACADEMIC) Field of study. Any field of study second year of study. Preference to direct descen- Field of study Any field of study Value: R500R5 000 p.a., depending on the average dants of the late Prof J.H. Neethling's father Hendrik Value: R600 - R6 000 p.a., depending on the number percentage obtained during the previous year Johannes Neethling of A symbols and the average percentage obtained in Duration: 1 year Service contract: None the matric examination Tenable at: Potchefstroom University for CHE Closing date: 15 January Duration: 1 year Eligibility Senior undergraduate students who Further information: Tenable at Potchefstroom University for CHE obtained an average of at least 65% during the The Registrar (Bursaries and Loans) Eligibility. First-year students who enroll at the previous year and who passed all the prescribed University of Stellenbosch University for the first time courses for the year Private Bag X1 Service contract None Service contract None MAT1ELAND 7602 Closing date: 15 October Closing date: 15 October Further information: Further information: PU FOR CHE BURSARIES FOR HANDICAPPED Die Director (Bursaries & Loans) The Director (Financial Bureau) STUDENTS PU vir CHE PU vir CHE Field of study. Any field of study Private Bag X6001 Private Bag X6001 Value: R1 000 p.a. POTCHEFSTROOM 2520 POTCHEFSTROOM 2520 Duration: 1 year Tenable at Potchefstroom University for CHE PU FOR CHE SPORTS BURSARIES PUK ONDERSTEUNINGSKEMA Eligibility. Undergraduate students who's physical Field of study. Any field of study Field of study Any field of study disability is hampering their studies Value: Amount varies Value: Amount varies Closing date: 15 October Duration: 1 year Duration: 1 year Further information: Tenable at Potchefstroom University for CHE Tenable at Potchefstroom University for CHE The Director (Bursaries and Loans) Eligibility. Students with a satisfactory academic Eligibility. Awarded on the basis of financial need and PU for CHE performance and who are outstanding in sport academic performance. Candidate will be subject to a Private Bag X6001 Service contract: None means test POTCHEFSTROOM 2520 Further information: Closing date: 15 October The Sport Bureau Further information: PU FOR CHE BURSARIES FOR NEEDY STUDENTS PU for CHE The Director (Financial Bureau) Field of study Any field of study P/Bag X6001 PU for CHE Value: Amount varies POTCHEFSTROOM 2520 P/Bag X1006 Tenable at Potchefstroom University for CHE POTCHEFSTROOM 2520 Eligibility Awarded on the basis of financial need to PU FOR CHE STUDENT LOAN SCHEME deserving students and to students who are orphans Field of study. Any field of study QUEEN ELIZABETH II CORONATION UNIVERSITY Closing date: 15 October Value: Maximum of R6 000 pa. SCHOLARSHIP Further information: Duration: 1 year Field of study. Any field of study The Director (Bursaries and Loans) Tenable at Potchefstroom University for CHE Value: R225 177 162 Bursaries Duration: Minimum duration of the course AUCKLAND PARK 2006 Rand Afrikaans University Tenable at University of Cape Town, University of the PO Box 524 Western Cape RANDFONTEIN TOWN COUNCIL BURSARY AUCKLAND PARK 2006 Eligibility. White and coloured first-year students LOANS whose parents have resided in the Cape Town Field of study Any field of study RAU MERIT BURSARIES (UNDERGRADUATE) municipal area for at least five years prior to the Value: R2 000 p.a. Field of study. Any field of study award and continue to do so for the duration of the Duration: 1 year Value: R2 340R8 640 scholarship Tenable at: Any university, technikon or college in Duration: 1 year Service contract: None South Africa Tenable at: Rand Afrikaans University Closing date: January Eligibility Full-time students who's parents are bona Eligibility Students who achieved six A symbols on Further information: fide residents of Randfontein HG in the matriculation examination, students with The Town Clerk's Department Service contract: The bursary loan must be paid back academic merit and students achieving satisfactory Scholarship Executor Committee within 5 years of completion of the studies academic results and who, at the same time, perform PO Box 298 Closing date: 31 October extremely well in culture or sport CAPE TOWN 8000 Further information: Closing date: 15 November Information not confirmed The Town Clerk Further information: Randfontein Municipality The Registrar (Finance) QUEENSBURGH MUNICIPAL BURSARY PO Box 218 Rand Afrikaans University Field of study. Any field of study RANDFONTEIN 1760 PO Box 524 Value: Variableamount determined by Council AUCKLAND PARK 2006 Duration: 1 year RAPPORTRYERSKORPS EIKESTAD- Tenable at: Any tertiary institution MERIETEBEURS RAU STUDY LOAN FUND Eligibility Student must be a SA citizen and a resident Field of study Any field of study Field of study. Any field of study of Queensburgh for at least 5 years Value: R300 Value: Maximum of R6 160 pa. Service contract. None Duration: 3 years Duration: 1 year Closing date: 31 December Tenable at: University of Stellenbosch Tenable at: Rand Afrikaans University Further information: Eligibility. Awarded to a needy first-year student from Eligibility Awarded on the basis of financial need and The Town Clerk the Stellenbosch vicinity academic merit to full-time students PO Box 39016 Service contract. None Service contract: None QUEENSBURGH 4070 Closing date: 15 January Closing date: 15 November Information not confirmed Further information: Further information: The Registrar (Bursaries and Loans) The Registrar (Finance) R.B. HAGART TRUST University of Stellenbosch Rand Afrikaans University Field of study Any field of study Private Bag X1 PO Box 524 Value: Determined annually MATIELAND 7602 AUCKLAND PARK 2006 Duration: 1 year Tenable at: Rand Afrikaans University RAU ALUMNI ASSOCIATION BURSARY RAY SPILKIN MEMORIAL SCHOLARSHIP Eligibility. Awarded on the basis of academic merit to Field of study. Any field of study Field of study Any field of study full-time, needy students Value: Determined annually Value: At the discretion of the University Service contract: None Duration: 1 year Duration: 1 year, renewable for 3 years subject to Closing date: 15 November Tenable at: Rand Afrikaans University satisfactory progress and good conduct Further information: Eligibility. Full-time and part-time deserving students. Tenable at: University of the Witwatersrand The Registrar (Finance) Preference to the children of an active Alumni parent Eligibility. Students as from their second year of study Rand Afrikaans University Service contract: None on the basis of financial need and satisfactory PO Box 524 Closing date: 15 November academic performance AUCKLAND PARK 2006 Further information: Service contract: None The Registrar (Finance) Closing date: 30 September RAG BURSARIES (RAU) Rand Afrikaans University Further information: Field of study Any field of study PO Box 524 The Senior Assistant Registrar Value: R4 000 AUCKLAND PARK 2006 Financial Aid & Scholarships Office Duration: 1 year University of the Witwatersrand Tenable at Rand Afrikaans University RAU BURSARY LOAN FUND Private Bag 3 Eligibility. Awarded on the basis of financial need and Field of study. Any field of study WITS 2050 academic merit to full-time hostel students from their Value: Maximum of R6 160 pa. second year of study who participate in organised Duration: 1 year RECTOR'S BURSARY FOR OUTSTANDING student activities Tenable at: Rand Afrikaans University PERFORMANCE (TECHNIKON PRETORIA) Service contract: None Eligibility. Needy students who do not qualify for Field of study: Any field of study Closing date: 15 November merit bursaries but who are however, able to Value: Amount varies Further information: complete university studies successfully. In case of Duration: 1 year, renewable on reapplication The Registrar (Finance) success 25% of the loan will revert to a bursary Tenable at: Technikon Pretoria Rand Afrikaans University Service contract: None Eligibility. Awarded on the basis of outstanding PO Box 524 Closing date: 15 November academic performance and financial need to regis- AUCKLAND PARK 2006 Further information: tered full-time students The Registrar (Finance) Closing date: 30 September (year) and 30 April RANDBURG SOUTH DUTCH REFORMED COM- Rand Afrikaans University (semester courses in the same year) MUNITY PO Box 524 Further information: Field of study. Any field of study AUCKLAND PARK 2006 The Chairman: Bursary Committee Value: R860 to R4 680 p.a. Technikon Pretoria Duration: 1 year RAU LADIES CIRCLE BURSARY Private Bag X680 Tenable at: Rand Afrikaans University Field of study Any field of study PRETORIA 0001 Eligibility. Full-time undergraduate students who are Value: Determined annually REIGER PARK BURSARY LOAN FUND members of the Dutch Reformed Church Duration: 1 year Closing date: 15 November Tenable at: Rand Afrikaans University Field of study: Any field of study Further information: Eligibility. Full-time needy students Value: Variable The Registrar (Finance) Closing date: 15 November Tenable at: Any university or teacher's training college Rand Afrikaans University Further information: IEligibility Full-time undergraduate students resident PO Box 524 The Registrar (Finance) I in Reigerpark 178 Bursaries 163 Service contract: None Closing date: 15 October The Senior Assistant Registrar Closing date: 1 November Further information: Financial Aid & Scholarships Office Further information: The Financial Aid Officer University of the Witwatersrand The Secretary Rhodes University Private Bag 3 Reiger Park Bursary Loan PO Box 94 WETS 2050 PO Box 14178 GRAHAMSTOWN 6140 REIGER PARK 1466 Information not confirmed ROTARY CLUB OF BELLVILLE BURSARY Information not confirmed Field of study: Any field of study RHODES UNIVERSITY SPORTS BURSARIES AND Value: 3 000 p.a. REMBRANDT BURSARY FUND SCHOLARSHIPS Duration: 1 year Field of study Any field of study Field of study: Any field of study Tenable at Any university, any technikon or any other Value: R7 500 Value: Amount varies college Tenable at: University of Transkei Duration: 1 year Eligibility: Candidates showing financial need, who Eligibility: Trankeian bom students Tenable at Rhodes University have completed at least one year of study in their Closing date: Contact the University Eligibility. Merit scholarships awarded on the basis of chosen field and whose normal place of residence Further information: sports prowess to undergraduate and prospective falls within the 13e1MIle area The Bursary Officer students. Old Rhodian Sports Scholarship awarded on Service contract None Financial Aid Bureau the basis of sports prowess to a first-time entering Closing date: 1 March University of Transkei student. Development Bursaries awarded on the basis Further information: Private Bag X1 of sports potential with consideration to be given to The President UNRRA 5117 financial need Bellville Rotary Club Closing date: 31 October PO Box 125 RENIER VAN ROOYEN BURSARY FUND Further information: BELLVILLE 7535 Field of study: Any field of study Financial Aid Officer Value: Amount varies Rhodes University ROTARY CLUB OF KYALAMI BURSARY Duration: 1 year PO Box 94 Field of study: Any field of study Tenable at: Any tertiary institution GRAHAMSTOWN 6140 Value: Tuition fees Eligibility: Students who matriculated in Upington Information not confirmed Tenable at Technikon Witwatersrand Service contract: None Eligibility: Awarded on merit Closing date: 28 February and 31 July RHODES UNIVERSITY STUDENT STUDY LOANS Service contract The donor considers any application Further information: Field of study: Any field of study which improves the skills of individuals involved in The Trustees Value: Approximately R3 000 p.a. teaching pupils on a variety of subjects, i.e. the PO Box 199 Duration: Duration of the course improvement of teaching skills in mathematics for UPINGTON 8800 Tenable at Rhodes University students who are deaf, etc. Eligibility: Awarded on the basis of academic Closing date: None REYERSBACH BURSARY achievement and good conduct to needy students as Further information: Field of study: Any field of study from their second year of study who cannot complete The President Value: RI 000 p.a. their studies without the loan Rotary Club of Kyalami Duration: 1 year, renewable for 3 years Service contract: On leaving the University without PO Box 274 Tenable at. University of the Witwatersrand completion of the course, the full amount of the loan HALFWAY HOUSE 1685 Eligibility: Awarded on the basis of financial need and is payable at once satisfactory academic performance to a white Closing date: 15 December RUDOLPH GINSBERG MEMORIAL BURSARIES matriculant or undergraduate who is born in SA Further information: Field of study: Any field of study Service contract: None The Bursaries Officer Value: Amount varies Closing date: 30 September Rhodes University Duration: 1 year, renewable Further information: PO Box 94 Tenable at Rhodes University The Senior Assistant Registrar GRAHAMSTOWN 6140 Eligibility: The most deserving new first-year student Financial Aid & Scholarships Office Information not confirmed who has completed his/her schooling in King University of the Witwatersrand William's Town Private Bag 3 ROSA DE MUNNIK-ELOFF STUDY LOAN FUND Closing date: 1 December WITS 2050 Field of study: Any field of study Further information: Value: Amount varies The Financial Aid Officer RHODES UNIVERSITY ENTRANCE SCHOLAR- Duration: 1 year Rhodes University SHIPS Tenable at University of the OFS PO Box 94 Field of study Any field of study Eligibility. Awarded on the basis of academic GRAHAMSTOWN 6140 Value: Amount vanes achievement and financial need to full-time students. Information not confirmed Duration: 1 year Preference to theological students in case of similar Tenable at: Rhodes University circumstances SA BLIND WORKERS ORGANISATION BURSARY Eligibility: Awarded on the basis of academic ability to Service contract: None Field of study: Any field of study new first-year students who obtained above-average Closing date: 15 October Value: RI 500 matriculation results Further information: Duration: Duration of the course Closing date: 1 December The Director (Financial Assistance) Tenable at Any university or technikon Further information: University of the OFS Eligibility Students who are blind, partially sighted or The Financial Aid Officer PO Box 339 who are sighted children of visually disabled parents Rhodes University BLOEMFONTEIN 9300 Service contract None PO Box 94 Closing date: 15 November GRAHAMSTOWN 6140 ROSS BRESLER SCHOLARSHIP Further information: Information not confirmed Field of study: Any field of study The Secretary Value: At the discretion of the University SA Blind Workers Organisation RHODES UNIVERSITY RESIDENCE BURSARIES Duration: 1 year, renewable subject to satisfactory Private Bag X9005 Field of study: Any field of study progress and conduct CROWN MINES 2025 Value: Amount vanes Tenable at: University of the Witwatersrand SA FOOTPLATE PERSONNEL ASSOCIATION Duration: 1 year Eligibility: Awarded on the basis of financial need and Tenable at Rhodes University satisfactory academic performance BURSARY Eligibility: Accomodation in university residence to Service contract: None Field of study: Any field of study students as from the second year of study Closing date: 30 September Value: R2 000 Service contract: None Further information: Duration: 1 year, renewable if studies are successful P 164 Bursaries Tenable at Universities of Pretoria, OFS, Stellenbosch, P/Bag Xl Sales House Club Rand Afrikaans University and University of Port MAT1ELAND 7602 PO Box 42982 Elizabeth FORDSBURG 2033 Eligibility Full-time undergraduate, needy students SA WOMEN'S CULTURAL ORGANISATION whose parents are members of the SA Footplate BURSARY SANDERS AND HAVENGA BURSARIES Personnel Association Field of study. Any field of study Field of study Any field of study Closing date: Contact the university concerned Duration: 1 year Value: RI 000 each Further information: Tenable at: University of the Western Cape Duration: 1 year The Registrar of the university concerned Eligibility. Full-time female students residing in the Tenable at: University of the OFS greater Western Cape area Eligibility. Deserving pupils who matriculated at the SA JEWISH BOARD OF DEPUTIES BURSARY CO- Service contract: None Koffiefontein or Fauresmith high schools and intend ORDINATING COMMITTEE BURSARY Closing date: First-year students 1 March; seniors 31 to study at the University of the OFS Field of study. Any field of study October of the previous year Service contract: None Value: Amount varies Further information: Closing date: 15 December Duration: 1 year, renewable Financial Aid Office Further information: Tenable at: Any tertiary institution in the Western University of the Western Cape The Director (Financial Assistance) Cape Private Bag X17 University of the OFS Eligibility Awarded on the basis of academic merit BELLVILLE 7535 PO Box 339 and financial need to SA Jewish citizens BLOEMFONTElN 9300 Service contract: None SAAMBOU BURSARY FUND Closing date: 31 December Field of study. Any field of study SAUL ALBOW SCHOLARSHIP Further information: Value: Amount varies Field of study: Any field of study The Executive Director Duration: 1 year, renewable Value: R750 PO Box 2009 Tenable at Any university, technikon or technical Duration: 1 year, renewable at city council's discretion CAPE TOWN 8000 college Tenable at University of Cape Town, Peninsula Eligibility Only children of officials or retired officials Technikon SA LEGION AND WOMEN'S AUXILIARY of Saambou for undergraduate study Eligibility. First-year coloured or white students (GRAHAMSTOWN BRANCH) BURSARY Service contract: None whose parents reside in Ward 7 (Maitland) Field of study. Any field of study Closing date: 31 March Service contract: None Value: Amount varies Further information: Closing date: Advertised annually in January when Duration: 1 year, renewable The Secretary available Tenable at: Rhodes University Saambou Bursary Fund Further information: Eligibility Awarded to serving and former members of PO Box 20161 Town Clerk's Dept the SA Defence Force or their descendants to obtain a ALKANTRANT 0005 Scholarship Executor Committee degree or diploma at Rhodes University. National PO Box 298 Service is, in itself, a qualification for this bursary SACTWU BURSARY FUND CAPE TOWN 8000 Information not confirmed Service contract: None Field of study Any field of study Closing date: 15 April Value: Amount varies SAWAS MEMORIAL SCHOLARSHIP Further information: Duration: 1 year, renewable The Financial Aid Officer Tenable at All tertiary institutions Field of study: Any field of study Rhodes University Eligibility Full-time students whose parents are Value: Amount varies PO Box 94 members of the SA Clothing and Textile Workers Duration: 1 year, renewable GRAHAMSTOWN 6140 Union ( SACTWU) Tenable at: Rhodes University Information not confirmed Service contract: Members must be registered with Eligibility Serving and former members of the South the Union from July the previous year African and British Forces and their descendants with SA NATIONAL COUNCIL FOR THE BLIND Closing date: February the following year preference to the South African Naval Forces BURSARY FUND Further information: Service contract: None Field of study. Any field of study The Finance Department Closing date: 15 April Value: Amount varies; maximum R6 500 SACTWU Further information: Duration: 1 year PO Box 18359 The Financial Aid Officer Tenable at Any tertiary institution DALBRIDGE 4014 Rhodes University Eligibility. Deserving blind or partially sighted PO Box 94 students of all population groups for secondary and SAKMET BURSARY GRAHAMSTOWN 6140 Information not confirmed tertiary education Field of study. Any field of study Service contract: None Value: Amount varies Closing date: 31 September Duration: 1 year SEA PLANT WELFARE TRUST BURSARY Further information: Tenable at: University of the Western Cape Field of study Any field of study The Student Counsellor Eligibility: Full-time students with merit Value: Tuition fees up to R5 000 SA National Council for the Blind Service contract: None Duration: 1 year, renewable PO Box 11149 Closing date: First-year students 1 March; seniors 31 Tenable at: Any university, technikon or college in BROOKLYN 0011 October of the previous year South Africa Further information: Eligibility Available to students residing in Hawston, SA PERMANENT BUILDING SOCIETY BURSARY Financial Aid Office Hermanus or Gansbaai and whose parents/guardians Field of study: Any field of study University of the Western Cape are involved in the fishing industry Value: R500 Private Bag Xl 7 Service contract: None Duration: 1 year BELLVILLE 7535 Closing date: October Tenable at: University of Stellenbosch Further information: Eligibility: A matriculant from Stellenbosch. The SALES HOUSE CLUB BURSARY Sea Plant Products Ltd rotation for the different schools is as follows: 1997 Field of study: Any field of study PO Box 265 HERMANUS 7200 Hoerskool Cloetesville, 1998 Bloemhof; 1999 Paul Value: R3 500 Roos Gimnasium; 2000 Rhemish; 2001 Hoerskool Duration: 3 years SENEKAL (ROOIKRANS) EDUCATION FUND Luckhoff Tenable at: Technikon Witwatersrand Service contract: None Eligibility. Awarded to members or to applicants Field of study: Any field of study Closing date: 15 January whose parents are members of the Sales House Club Value: Not more than R5 000 per student Further information: Closing date: 31 August Duration: 1 year, renewable The Registrar (Bursaries and Loans) Further information: Tenable at: Universities of Stellenbosch, Orange Free University of Stellenbosch Bursary Controller State, Potchefstroom and Pretoria ISO Bursaries 165 Eligibility. Needy, meritorious, first-year students SOLOMON RABINOWITZ OF PAARL SCHOLAR- SPORTS DEVELOPMENT BURSARIES Service contract None SHIP Field of study. Any field of study Closing date: Contact the university concerned Field of study Any field of study Value: Amount varies Further information: Value: Approximately R800 p.a. Duration: 1 year The Registrar of the university concerned Duration: 1 year, renewable for 3 years subject to Tenable at University of the Witwatersrand satisfactory progress Eligibility. Candidates with adequate academic SIMON BEKKER MEMORIAL FUND (LOANS) Tenable at University of the Witwatersrand performance who can prove financial need and Field of study. Any field of study Eligibility. Second-year students on the basis of previous inaccessibility to sporting facilities and Value: R2 000 p.a. financial need and satisfactory academic performance privileges. Must be registered with the Wits Sports Duration: Renewable annually if progress is satisfac- Service contract None Council tory Closing date: 30 September Service contract: None Tenable at A university or institution situated in the Further information: Closing date: 10 January and 15 June historical Transvaal The Senior Assistant Registrar Further information: Eligibility. Full-time students whose parents have Financial Aid & Scholarships Office The Registrar been resided in the Transvaal for at least one year University of the Witwatersrand Financial Aid & Scholarships Service contract: None Private Bag 3 University of the Witwatersrand Closing date: 15 January WITS 2050 Private Bag 3 Further information: WITS 2050 The Secretary SOLOMON REUBEN AND ANN WINER BURSARY Simon Bekker Memorial Fund Field of study. Any field of study SPRINGS CITY COUNCIL BURSARY LOANS PO Box 35296 Value: Amount varies Field of study. Any field of study MENLO PARK 0102 Duration: 1 year, renewable Value: Maximum of R5 000 p.a. Tenable at Rhodes University, University of the Duration: Duration of the course (maximum 4 years) SIMON KUPER MEMORIAL BURSARIES Witwatersrand Tenable at Any tertiary institution Field of study. Any field of study Eligibility. Awarded on the basis of financial need and Eligibility. Applicants must have attended a local high Value: RI 000 p.a. satisfactory academic performance. Preference given school for at least two years prior to date of applica- Duration: 1 year, renewable for 3 years to senior students tion OR the parents or lawful guardians of the Tenable at University of the Witwatersrand Closing date: Contact the university concerned applicants must have resided within the municipal Eligibility. Second-year students on the basis of Further information: area of Springs for at least 2 years prior to the date of financial need and satisfactory academic performance The Registrar or the university concerned application OR they must own property within the Service contract None municipal area of Springs on which assessment rates Closing date: 30 September SONIA SCHWAB SCHOLARSHIP are paid to the Council Further information: Field of study. Any field of study Service contract None The Senior Assistant Registrar Value: Amount varies Closing date: 30 September Financial Aid & Scholarships Office Duration: 1 year Further information: University of the Witwatersrand Tenable at University of the Witwatersrand The Head: Personnel Services Private Bag 3 Eligibility Awarded on the basis of academic merit to City Council of Springs WITS 2050 matriculants or students PO Box 45 Service contract None SPRINGS 1560 SKYE RUGBY BURSARIES Closing date: 10 January Field of study. Any field of study Further Information: ST LEGER SCHOLARSHIP TRUST Value: Amount varies Bursaries & Scholarship Office Field of study Any field of study Duration: 1 year University of the Witwatersrand Value: Amount varies Tenable at University of the Witwatersrand P/Bag 3 Duration: 1 year, renewable if progress is satisfactory Eligibility. Registered full-time undergraduate and WITS 2050 Tenable at Any South African university postgraduate students. The award is based on the Eligibility. A South African citizen, under 25 years of ability to play rugby, a proven record and satisfactory SOUTH AFRICAN POLICE ACADEMY BURSARY age, who has graduated or matriculated in the Cape academic performance. Personal circumstances will Field of study. Any field of study Province, is unmarried, of the Christian faith and also be taken into account. The candidate must be an Value: Determined annually bilingual or intending to become bilingual. The award open section player at the Wits Rugby Club Duration: 1 year, renewable will be based on literary and scholastic attainments, Closing date: 10January Tenable at University of South Africa moral force of character, leadership qualities, good Further information: Eligibility. Approved applicants who study full-time at citizenship induding personality, intellect and Senior Assistant Registrar the South African Police Academy financial need. Preference to candidates who give Financial Aid & Scholarships Closing date: 31 March evidence of merit in the Classics or Literature University of the Witwatersrand Further information: Service contract: None P/Bag 3 The Chairman Closing date: 15 September WETS 2050 Bursary Committee Further information: South African Police Academy The Trustees SOCCER ASSOCIATION OF SA EDUCATION GRAAFF-REINET 6280 St Leger Scholarship Trust TRUST (SASA) Information not confirmed PO Box 206 Field of study. Any field of study CAPE TOWN 8000 Value: Amount varies SPIRO PLOMARITIS BURSARY STANDARD BANK LOAN Tenable at Any university in the RSA Field of study. Any field of study Eligibility. All students with good academic records Value: R860 to R8 030 pa. Field of study. Any field of study who are involved in soccer or the administration of Duration: 1 year, renewable Value: Full-time: R5 000 R7 000 pa.; part-time: R2 soccer. After completion of the studies, the candidate Tenable at Rand Afrikaans University 500R3 500 p.a.; full-time technikon and agricul- must volunteer services to develop soccer Eligibility. Full-time undergraduate and postgraduate tural college students: R5 000 p.a. Closing date: February students Duration: 1 year, renewable Further information: Closing date: 15 November Tenable at Any university, technikon or agricultural The Executive Director Further information: college Soccer Association of SA Educ Trust The Registrar (Finance) Eligibility Full-time and part-time students from the PO Box 910 Rand Afrikaans University first year of study onwards JOHANNESBURG 2000 PO Box 524 Service contract: None Information not confirmed AUCKLAND PARK 2006 Closing date: None Further information: The nearest branch of the bank Information not confirmed 1-8 1 166 Bursaries University of the Witwatersrand Closing date: Contact the Technikon STANDARD BANK LOANS FOR TECHNIKON Private Bag 3 Further information: PRETORIA WITS 2050 The Student Jason Officer Financial Aid Office Field of study. Any field of study TAAIBOS MERIT BURSARY Technikon North-West Value: R7 000 maximum PO Box 911-1263 Duration: 1 year, renewable Field of study: Any field of study ROSSLYN 0200 Value: Determined annually Tenable at: Technikon Pretoria Information not confirmed Eligibility Registered students with an average mark Duration: 1 year of 60% and matriculants with full exemption Tenable at: University of Pretoria TECHNIKON NORTH WEST PRESTIGE BURSARY Service contract: Acceptance of sureties by the bank Eligibility Undergraduate students from their first Closing date: 30 September (year and 1st semester); year of study who are already or will become Field of study Any field of study 30 April (semester students registering for the 1st residents of Taaibos Value: Amount varies time in July) Service contract: None Duration: 1 semester Further information: Closing date: 15 October Tenable at: Technikon North West The Chairman Bursary Committee Further information: Eligibility: Full-time needy students with an aggregate Technikon Pretoria The Head (Study Finance) of 50% and outstanding achievement in non- Private Bag X680 University of Pretoria academic activities such as culture, sport and PRETORIA 0001 PRETORIA 0002 leadership Closing date: Contact the technikon STANDARD BANK SCHOLARSHIP TAFELRONDE 47, POTCHEFSTROOM Further information: Student Liason Officer Field of study: Any field of study Field of study Any field of study Financial Aid Office Value: R500 p.a. Value: R6 000 Technikon North West Tenable at: University of Transkei Duration: 1 year PO Box 911-1263 Eligibility: First-year full-time Transkeian born Tenable at: Potchefstroom University for CHE ROSSLYN 0200 Eligibility. Full-time studentspreferably first-years, students Information not confirmed Closing date: Contact the University whose parents are permanent residents of Potchef- stroom Further information: TECHNIKON SA BURSARIES AND LOANS The Bursary Officer Service contract: None Financial Aid Bureau Closing date: 15 October Field of study Any field of study University of Transkei Further information: Value: Amount varies Private Bag X1 The Director (Financial Bureau) Duration: 1 year, renewable UNITRA 5117 PU for CHE Tenable at: Technikon SA Private Bag X6001 Eligibility Awarded on the basis of academic per- STANLEY J.O. NOOME BURSARY POTCHEFSTROOM 2520 formance and availability of funds to current or prospective students who are SA citizens Field of study: Any field of study TECHNIKON NATAL BURSARIES / SCHOLAR- Service contract: None Value: R1 260 each SHIPS Closing date: 15 November for bursaries and 15 Duration: 1 year, renewable March for loans Tenable at: University of South Africa and University Field of study: Any field of study Further information: Value: Determined annually of the North Financial Aid Officer Eligibility: Only blacks and coloureds from Pretoria or Tenable at: Technikon Natal Technikon SA Pietersburg or both districts. At the time of first Eligibility. Contact the technikon for more information Private Bag X6 application applicants should preferably be under 26 Closing date: Contact the technikon FLORIDA 1710 years of age Further information: Vice-Rector: Administration Closing date: 15 January TECHNIKON WITWATERSRAND ADMINISTERED Student Administration: Bursaries Further information: BURSARIES AND SCHOLARSHIPS The Registrar (Academic) Technikon Natal UNISA PO Box 953 Field of study Any field of study PO Box 392 DURBAN 4000 Value: Amount varies PRETORIA 0003 Duration: 1 year or 1 semester TECHNIKON NORTH WEST ACADEMIC Tenable at Technikon Witwatersrand STELLENBOSCH FARMERS' WINERY BURSARY ACHIEVEMENT FUND (PROSPECTIVE STUDENTS) Eligibility. Awarded on the basis of academic per- formance and financial need Field of study: Any field of study Field of study: Any field of study Service contract: None Value: Amount varies according to the aggregate Value: Variable Closing date: Contact the technikon obtained at Std 10 level Duration: 1 year Further information: Tenable at: University of the Western Cape Duration: 1 semester Financial Aid Bureau Eligibility Full-time students on the basis of academic Tenable at: Technikon North West Technikon Witwatersrand achievement and financial need Eligibility. Prospective students with an aggregate of PO Box 17011 60% during previous applicable examinations Closing date: First-year students: 1 March: current DOORNFONTEIN 2029 students: 31 October Closing date: Contact the Technikon Further information: Further information: TECHNIKON WITWATERSRAND ADMINISTERED The Student Liason Officer The Registrar SPORTS BURSARIES University of the Western Cape Financial Aid Office Private Bag X117 Technikon North-West Field of study Any field of study BELLVILLE 7535 PO Box 911-1263 Value: Amount varies ROSSLYN 0200 Duration: 1 year or 1 semester STUDENT GOVERNMENT BURSARIES Information not confirmed Tenable at: Technikon Witwatersrand Eligibility: Awarded on the basis of merit and the Field of study: Any field of study TECHNIKON NORTH WEST ACADEMIC fulfilment of technikon admission requirements Value: Amount varies ACHIEVEMENT FUND (SENIOR STUDENTS) Closing date: 15 November for 1st semester and 15 Duration: I year April for 2nd semester Field of study Any field of study Tenable at: University of the Witwatersrand Further information: Value: Amount varies Eligibility: The student must be involved in the affairs The Manager of student government to the extent that he/she will Duration: 1 semester Sports Bureau Tenable at: Technikon North West be unable to continue with part-time work Technikon Witwatersrand Eligibility: An applicant with an aggregate of 60% who Closing date: 30 September PO Box 1701 1 registered for at least 3 qualifying instructional Further information: DOORNFONTEIN 2028 The Senior Assistant Registrar offerings and who passed all the offerings in one Financial Aid & Scholarships sitting (first attempt) 182 Rursaries 167 TED AND MABEL EVERITT BURSARY Eligibility Needy students as from the second year of WITS 2050 Field of study. Any field of study study Value: Amount varies Service contract None TRUST BANK STUDENT LOANS Closing date: 15 January Duration: 1 year, renewable if progress is satisfactory Field of study. Any field of study Further information: Tenable at: Any educational institution Value: Amounts and interest rates depend on field of Eligibility Awarded on the basis of financial need to The Registrar (Bursaries and Loans) study and academic year South Africans either resident in or being educated in University of Stellenbosch Duration: Duration of the course, provided the the magisterial district of East London Private Bag XI student passes Service contract: None MATIELAND 7602 Tenable at Any university, technikon or teacher's Closing date: 15 October training college in South Africa Further information: TRANSVAAL HELPMEKAAR STUDY FUND (LOAN Eligibility. First year university at least a C symbol in The Secretary FOR TECHNIKON AND UNIVERSITY STUDY) matric; first year technikon: at least a D symbol in Ted and Mabel Everitt Bursary Fund Field of study Any field of study matric; senior students: at least a D symbol during PO Box 1172 Value: R5 000 p.a. the previous year EAST LONDON 5200 Duration: Duration of the course Service contract: None Tenable at Any technikon or university in SA Closing date: None TERTIARY EDUCATION FUND OF SA (TEFSA) Eligibility. Full-time undergraduate and first-diploma Further information: LOAN SCHEME students whose parents are residents of Transvaal Any branch of Trust Bank Field of study. Any field of study Service contract: None Information not confirmed Value: Approximately R7 500 p.a. Closing date: 31 October Duration: 1 year, renewable Further information: TRUST FOR CHRISTIAN OUTREACH AND Tenable at: Any tertiary institution in South Africa The Secretary EDUCATION (ZINGISA BURSARY) Eligibility. Needy, undergraduate, registered students Transvaal Helpmekaar Study Fund Field of study. Any field of study from a disadvantaged community who are SA PO Box 91050 Value: R500 - R2 000 citizens. The applicant must have the potential to AUCKLAND PARK 2006 Duration: Renewable if progress is satisfactory succeed in the course and may not receive other Tenable at: University of Port Elizabeth financial assistance for tuition and accommodation. TRANSVAAL PROVINCIAL ADMINISTRATION Eligibility. Awarded on the basis of financial need to 40% of the loan may be converted into a bursary, (TPA) BURSARIES black undergraduate students from the Eastern Cape depending on academic success Field of study. Any field of study Service contract None Service contract: None Value: R7 200 p.a. Closing date: 30 September Closing date: Contact the institution concerned Duration: 1 year Further information: Further information: Tenable at: Potchefstroom University for CHE The Director The Registrar of the institution concerned Eligibility. Full-time students, according to need. For Trust for Christian Outreach & Education some courses only from the second year of study Zingisa Educational Projects THE COMPUTER SCHOOL BURSARIES Service contract: One year service for each year for PO Box 658 Field of study. Any field of study which the bursary was received KING WILLIAMS TOWN 5600 Value: Amount varies Closing date: Varies from 31 July to 29 November, Information not confirmed Duration: 1 year depending on the course which is followed Tenable at: Any university or technikon in SA Further information: TSHEZI EDUCATION TRUST BURSARY Eligibility All matriculants with a knowledge of The Director-General Field of study Any field of study computers can qualify for the bursary according to TPA Bursary Division Value: Maximum of R2 000 p.a. the results of the ComparYs bursary examination Private Bag X64 Duration: 1 year Closing date: 15 July. Candidates can start applying PRETORIA 0001 Tenable at Any university for information as from 1 May Information not confirmed Eligibility. Awarded on the basis of financial need to Further information: undergraduate students from the second or third The Computer School TRANSVAALSE ONDERWYSERSVERENIGING (SA year of study. Preference to black students from a 1st Floor ONTWIKKELINGSTIGTING BEURS- EN LEN- disadvantaged background Rink Street INGSFONDS) Closing date: 31 October PORT ELIZABETH 6001 Field of study. Any field of study Further information: Information not confirmed Value: R1 200 - RI 400 p.a. The Administrative Trustee Duration: 1 year, renewable if progress is satisfactory Tshezi Trust THOMAS ROBERTSON BURSARY Tenable at: Any tertiary institution PO Box 433 Field of study. Any field of study Eligibility Full-time students who are children of ATHLONE 7760 Value: RI 000 p.a. parents who are TO members for at least 10 years Information not confirmed Duration: 3 years, if academic performance and Service contract: None conduct are satisfactory Closing date: 1 February UCT BURSARIES Tenable at: University of the OFS Further information: Field of study Any field of study Eligibility. Matriculants born in the OFS or who lived in The Director Value: Amount varies the OFS for 12 months before 1 December. Must Transvaal Teachers' Association Duration: 1 year, renewable if progress is satisfactory write the OFS Senior Certificate or equivalent exami- PO Box 90120 Tenable at. University of Cape Town nation in December of the year in which they apply GARSFONTEIN 0042 Eligibility Awarded on the basis of academic for the bursary achievement and financial need Service contract: None TREVOR SALES MEMORIAL BURSARY Closing date: 31 October Closing date: 31 December Field of study. Any field of study Further information: Further information: Value: Amount varies The Financial Aid Office The Director Duration: 1 year University of Cape Town OFS Education Department Tenable at University of the Witwatersrand Green Level PO Box 521 Eligibility. Registered full-time undergraduate Students' Union Building BLOEMFONTEIN 9300 students with the ability to play rugby and satisfactory Private Bag Information not confirmed academic performance. Personal circumstances will RONDEBOSCH 7700 also be taken into account TRA,NSNET BURSARY LOAN SCHEME Service contract: None UCT SPORTS BURSARIES Fielcl of study. Any field of study Closing date: 10 January Field of study Any field of study Value: RI 000 to R5 000 p.a., depending on need Further information: Value: Amount varies Duration: 1 year, renewable Financial Aid & Scholarships Duration: 1 year, renewable Tenable at: University of Stellenbosch University of the Witwatersrand Tenable at: University of Cape Town Private Bag 3 168 183 Bursaries Eligibility: Awarded on the basis of satisfactory UNIVERSITY OF PRETORIA SPORTS BURSARY UNIVERSITY OF THE NORTH WEST LOANS academic results with excellence in at least one sports Field of study. Any field of study discipline. The ability to coach and administer the Value: Determined annually Field of study Any field of study sport is an additional recommendation Duration: 1 year i Duration: 1 semester, renewable Closing date: 30 September Tenable at: University of Pretoria Tenable at: University of the North West Further information: Eligibility: Awarded to students who aquired provin- Eligibility: Awarded on the basis of financial need, The Head cial colours in sport academic performance and conduct. Applicants must Sports Administration Closing date: 15 October provide acceptable sureties and must be South Sports Centre Further information: African citizens University of Cape Town The Head (Study Finance) Service contract: None RONDEBOSCH 7700 University of Pretoria Further information: PRETORIA 0002 The Financial Aid Office UCT STUDENT LOAN FUND University of the North West Field of study. Any field of study UNIVERSITY OF PRETORIA WINNERS AND Private Bag X2046 Value: Amount varies RUNNERS-UP OF SUBJECT OLYMPIADS BUR- MMABATHO 8681 Duration: 1 year SARY Information not confirmed Tenable at: University of Cape Town Field of study: Any field of study UNIVERSITY OF THE WESTERN CAPE MERIT Eligibility. Awarded on the basis of financial need and Value: Overall winners: R3 500: runners-up: R1 000 AWARDS academic merit Duration: One-off bursary Closing date: 31 October Tenable at: University of Pretoria Field of study: Any field of study Further information: Eligibility: First-year students Value: Matriculants with A average: Full rebate on Financial Aid Office Closing date: 15 October tuition fee; matriculants with B average: R1 000; University of Cape Town Further information: undergraduate students with A symbol (final mark) in Green Level The Head (Study Finance) prescribed courses, maximum of R600 p.a. Students' Union Building University of Pretoria Duration: 1 year Private Bag PRETORIA 0002 Tenable at: University of the Western Cape RONDEBOSCH 7700 Eligibility: Awarded on the basis of financial need and UNIVERSITY OF STELLENBOSCH BURSARY LOAN academic achievement to full-time undergraduate UNITED BANK STUDENT LOANS SCHEME students Service contract: None Field of study: Any field of study Field of study: Any field of study Closing date: First-year students: 1 March; senior Value: Amounts and interest rates depend on field of Value: Varies between R1 000 and R5 000 p.a. students: 31 October of the previous year study and academic year Duration: 1 year Further information: Duration: Duration of the course, provided the Tenable at: University of Stellenbosch Financial Aid Office student passes Eligibility Awarded on the basis of financial need and University of the Western Cape Tenable at: Any university, technikon or teacher's merit to full-time undergraduate students Private Bag X17 training college in South Africa Service contract: None BELLVILLE 7535 Eligibility First year university: at least a C symbol in Closing date: 15 January matric; first year technikon: at least a D symbol in Further information: UNIVERSITY OF TRANSKEI LOANS matric; senior students: at least a D symbol in the The Registrar (Bursaries and Loans) previous year University of Stellenbosch Field of study: Any field of study Service contract: None Private Bag X1 Value: Determined by the family income Closing date: None MAT1ELAND 7602 Duration: I year Further information: Tenable at: University of Transkei Any branch of United Bank UNIVERSITY OF STELLENBOSCH MERIT BUR- Eligibility: Funds are limited and loans are only Information not confirmed SARIES FOR FIRST YEAR STUDENTS available to unemployed students who are unable to raise sufficient money from other sources to cover Field of study: Any field of study UNIVERSITY COUNCIL SPORTS SCHOLARSHIPS their study costs. Only students with a family income Value: RI 300R6 700 (determined according to less than R60 000 p.a. will be considered Field of study: Any field of study achievement). R1 000 extra for six or more A Closing date: Contact the University Value: R3 000 p.a. symbols Further information: Duration: 1 year Duration: 1 year The Bursary Officer Tenable at: University of the Witwatersrand Tenable at: University of Stellenbosch Eligibility: Awarded to registered undergraduate and Eligibility First-year students who obtained 80% or Financial Aid Bureau University of Transkei postgraduate, full-time and part-time students, on more in the matriculation examination Private Bag X1 the basis of outstanding academic achievement in Service contract: None UNITRA 5117 matric or at university and of outstanding achieve- Closing date: 7 February ment in sports Further information: UNIVERSITY OF VENDA ADMINISTERED BUR- Service contract: None The Registrar (Bursaries and Loans) SARIES Closing date: 10 January University of Stellenbosch Further information: Private Bag X1 Field of study: Any field of study The Financial Aid Office MAT1ELAND 7602 Tenable at: University of Venda University of the Witwatersrand Eligibility: South African citizens only Private Bag 3 UNIVERSITY OF STELLENBOSCH SPECIAL Closing date: 31 October WITS 2050 BURSARIES Further information: The Director Financial Aid Field of study Any field of study UNIVERSITY OF PRETORIA LOANS University of Venda Value: Amount varies Private Bag X5050 Field of study: Any field of study Duration: 1 year THOHOYANDOU 0950 Value: R7 000 maximum p.a. Tenable at: University of Stellenbosch Duration: 1 year Eligibility: Awarded on the basis of achievement in UNIVERSITY OF VENDA VICE CHANCELLOR'S Tenable at: University of Pretoria sports (provincial and national colours) during the MERIT BURSARY Eligibility Full-time students previous year Closing date: 15 October Service contract: None Field of study: Any field of study Further information: Closing date: 15 January Value: According to availability of funds, number of The Head (Study Financing) Further information: applications and merit points University of Pretoria The Director (Sport) Duration: 1 year PRETORIA 0002 University of Stellenbosch Tenable at: University of Venda P/Bag X1 Eligibility: Awarded on the basis of academic merit MATIELAND 7602 and financial need 184 Bursaries 169 Closing date: 31 October Tenable at University of Port Elizabeth Eligibility. Awarded on the basis of merit and available Further information: Eligibility. Prospective UPE students in financial need funds to prospective students who obtained an The Director Financial Aid Service contract None average of 6296or higher in their final Std 9 (Grade University of Venda Closing date: 10 February 11) examinations Private Bag X5050 Further information: Service contract: None THOHOYANDOU 0950 Alumni Affairs Closing date: 31 May UPE Further information: UOFS SCHOLARSHIP FOR CULTURE AND PO Box 1600 Financial Support Office LEADERSHIP (SENIOR STUDENTS) PORT ELIZABETH 6000 UPE PO Box 1600 Field of study Any field of study PORT ELIZABETH 6000 Value: Amount varies UPE BONUSES BURSARY Duration: 1 year Field of study Any field of study UPE SPORT BURSARY Tenable at: University of the OFS Value: Amount varies Eligibility. Awarded on the basis of cultural and Duration: 1 year Field of study. Any field of study leadership activities to senior students Tenable at: University of Port Elizabeth Value: Amount varies Service contract: None Eligibility. Only students who receive bursaries from Duration: 1 year Closing date: 31 January private sources (no statutory) to support their study Tenable at: University of Port Elizabeth Further information: programme. Proof must be produced Eligibility. Candidates with good examination results The Director Service contract None as well as outstanding achievements in sport Bureau for Student Development Closing date: 30 June Service contract: None University of the OFS Further information: Closing date: 30 September PO Box 339 Financial Support Office Further information: BLOEMFONTEIN 9300 UPE The Director (Sport Bureau) PO Box 1600 UPE UOFS SCHOLARSHIPS FOR CULTURE AND PORT ELJZABETH 6000 PO Box 1600 LEADERSHIP PORT ELIZABETH 6000 Field of study Any field of study UPE CONVERTIBLE LOAN/BURSARY VEREENIGING KOPANONG CITY COUNCIL Value: Amount varies Field of study Any field of study STUDY LOAN SCHEME Duration: 1 year Value: RI 200 maximum (R400 per subject) Tenable at. University of the OFS Duration: 1 year Field of study. Any field of study Eligibility. Awarded to full-time first-year students, Tenable at University of Port Elizabeth Value: Maximum of RI 500 p.a. including headboys and headgiris, who have Eligibility. Financially needy, part-time, first-year Duration: Duration of the course performed well in the areas of culture and leadership students only Tenable at Any university, teacher's college or and who obtained a C symbol average in the Matric Service contract None technikon examination Closing date: 15 January Eligibility. Full-time students whose parents are Service contract: None Further information: ratepayers at the time of application and who have Closing date: 31 January Financial Support Office resided within the municipal area of Vereeniging for Further information: UPE at least two years The Director (Financial Assistance) PO Box 1600 Service contract None University of the OFS PORT ELIZABETH 6000 Closing date: 31 December PO bOX 339 Further information: BLOEMFONTEIN 9300 UPE FINANCIAL ASSISTANCE The City Secretary Field of study. Any field of study PO Box 35 UOFS SPECIAL SCHOLARSHIPS FOR SPORTS Value: Amount varies VEREENIGING 1930 Information not confirmed Field of study. Any field of study Tenable at University of Port Elizabeth Duration: 1 year Eligibility. Prospective and current full-time students VERULAM HIGH EX-STUDENTS' BURSARY Tenable at University of the OFS in financial need TRUST Eligibility. First-year students who have excelled in Service contract None sport Closing date: Current students: 31 August; new Field of study. Any field of study Service contract None students: 30 October Value: Amount varies Closing date: Before 30 November Further information: Tenable at University of Natal Further information: Financial Support Office Eligibility. Awarded on the basis of financial need and The Director (Financial Assistance) UPE academic merit to undergraduate students University of the OFS PO Box 1600 Service contract None PO Box 339 PORT ELIZABETH 6000 Closing date: 1 February BLOEMFONTEIN 9300 Further information: UPE LOANS The Secretary Verulam High Trust UOFS UNIVERSITY LOANS Field of study. Any field of study PO Box 122 Field of study. Any field of study Value: Amount varies VERULAM 4340 Value: Amount varies Duration: 1 year Information not confirmed Duration: 1 year Tenable at: University of Port Elizabeth Tenable at University of the OFS Eligibility. A limited number of loans will be available VETERANS BURSARY FUND Eligibility Full-time undergraduate and postgraduate to students who are not able to obtain a loan from a students financial institution. Proof must be submitted Field of study. Any field of study Service contract: None Closing date: 30 June Value: Assistance towards tuition and residence fees Closing date: 15 October Further information: and miscellaneous expenses for particular fields of Further information: Financial Support Office study Director UPE Duration: 1 year, renewable Financial Assistance PO Box 1600 Tenable at Any university, teacher's training college, University of the OFS PORT ELIZABETH 6000 technikon or technical college in South Africa PO Box 339 BLOEMFONTEIN 9300 UPE SCHOLAR MERIT AWARD Field of study. Any field of study UPE ALUMNI AND FANIE DU PREEZ BURSARIES Value: RI 500 - R4 500 pa. Field-of study. Any field of study Duration: 1 year Value: Amount varies Tenable at University of Port Elizabeth Duration: 1 year 185 170 Bursaries Eligibility: (a) Matriculants. undergraduate and VORSTER VAN DER MERWE EDUCATION FUND Service contract: None postgraduate students who are children or depend- (LOANS) Closing date: 18 February Further information: ants of members of the SADF, irrespective of race, Field of study: Any field of study The Secretary rank, sex, assignment or Arm of the Service, who as a Value: Decided on merit Lodge of father result of military operations or operational training Duration: Duration of the course: must apply annually died or are officially declared disabled. (b) Certain Tenable at: Any university, teacher's college or WILF ROSENBERG RUGBY BURSARY members and ex-members of the SADF who business college themselves are officially declared disabled as a result Eligibility: Full-time students who matriculated at a Field of study: Any field of study of military operations and who wish to gain additional high school in Rustenburg Value: Amount varies qualifications to improve their employment prospects Service contract: None Duration: One year Service contract: None Closing date: 31 January Tenable at: University of the Witwatersrand Closing date: 30 October Further information: Eligibility: Awarded to a registered full-time student Further information: The Treasurer on the basis of ability in rugby with a proven record The Secretary Vorster Van der Merwe Education Fund as well as an aptitude for academic work. Personal Veterans Bursary Fund Municipal Offices circumstances will be taken into account Private Bag X686 PO Box 550 Closing date: 10 January PRETORIA 0001 RUSTENBURG 0300 Further information: Information not confirmed Senior Assistant Registrar VINUCHI TIES BURSARIES Financial Aid & Scholarships Field of study: Any field of study W.D. HENDRICKS MEMORIAL BURSARY FUND University of the Witwatersrand Private Bag 3 Value: Amount varies Field of study: Any field of study WITS 2050 Duration: 1 year, renewable subject to satisfactory Value: R300 p.a. academic and sporting performance Duration: 1 year, renewable WILFRED METJE BURSARY Tenable at: University of the Witwatersrand Tenable at: University of the Western Cape, Peninsula Eligibility: Awarded on the basis of sporting excel- Technikon Field of study: Any field of study lence in rowing or gymnastics and satisfactory Eligibility: Deserving first-year students Value: R2 000 p.a. academic performance. Financial need is taken into Service contract: None Duration: 1 year account if two students are of equal ability. Candidate Closing date: 15 November Tenable at: University of Stellenbosch must be a registered undergraduate or postgraduate, Further information: Eligibility: Awarded on the basis of financial need and full-time or part-time student The Secretary academic merit to students born in Namibia and Service contract: None Bursary Committee attended school there Closing date: 10 January Cape Town Terminating Bldg Society Service contract: None Further information: 110 Bree Street Closing date: 15 January Senior Assistant Registrar CAPE TOWN 8001 Further information: Financial Aid & Scholarships The Registrar (Bursaries and Loans) University of the Witwatersrand W.M. RICHARDSON BURSARY University of Stellenbosch P/Bag 3 Private Bag XI Field of study: Any field of study WITS 2050 MATIELAND 7602 Value: At the discretion of the University Duration: 1 year, renewable VISSER-NESER BURSARY FUND WILFRED ORR BURSARY FUND Tenable at: University of the Witwatersrand Field of study: Any field of study Eligibility: Awarded on the basis of financial need and Field of study Any field of study Value: Amount varies satisfactory academic performance Value: Amount varies Duration: 1 year Closing date: 30 September Duration: 1 year Tenable at: University of the OFS or any university in Further information: Tenable at: Universities of the Western Cape, any country outside the Republic of South Africa The Senior Assistant Registrar Stellenbosch, Rhodes and the Witwatersrand Eligibility: Undergraduate and postgraduate students. Financial Aid & Scholarships Eligibility: Awarded on the basis of financial need and Some facts will be taken into consideration with the University of the Witwatersrand satisfactory academic performance to students or granting of the bursaries, such as relation to the Private Bag 3 prospective students who matriculated at a school in donor, financial position, full-time or part-time WITS 2050 Kimberley studies and the attendance of certain schools in the Closing date: Contact the university concerned OFS WAR MEMORIAL SCHOLARSHIP Further information: Service contract: None The Registrar of the university concerned Field of study: Any field of study Closing date: 15 December Value: 8350 each Further information: WILLIAM PESCOD ELLEN CARTER FUND Duration: Minimum duration of the course The Director (Financial Assistance) Tenable at: Peninsula Technikon Field of study: Any field of study University of the OFS Eligibility: White and coloured undergraduate and Value: Amount vanes PO Box 339 diploma students whose parents resided in the Cape Duration: 1 year BLOEMFONTEIN 9300 Town municipal area prior to the award Tenable at: Any tertiary institution Service contract: None Eligibility: Full-time students from Kimberley who VOLKSKAS STUDENT LOANS Closing date: Advertised annually in January/February have passed their first year of study Field of study: Any field of study when available Service contract: None Value: Amounts and interest rates depend on field of Further information: Closing date: 31 December study and academic year The Town Clerk Further information: Duration: Duration of the course, provided the Scholarship Executor Committee The Secretary student passes PO Box 298 5 Sapphire Street Tenable at: Any university, technikon or teacher's CAPE TOWN 8000 Gemdene training college in South Africa Information not confirmed KIMBERLEY 8301 Eligibility. First year university: at least a C symbol in Information not confirmed matric; first year technikon: at least a D symbol in WESLEY FRANCIS MEMORIAL MASONIC EDU- matric; senior students: at least a D symbol during CATION FUND (SCHOLARSHIP) WILLIE DU TOIT (QUAGGASFONTEIN) EDUCA- previous year TIONAL FUND Field of study: Any field of study Service contract: None Value: No maximum Field of study: Any field of study Closing date: None Duration: 1 year, renewable each year for duration of Value: Approximately tuition fees Further information: the course Tenable at: University of Stellenbosch Any branch of Volkskas Tenable at: Any tertiary institution Eligibility: Students from Loxton or Victoria West. If Information not confirmed Eligibility: Children of Freemasons who resided in the funds permit, applicants from elsewhere may also be Masonic District of Natal for at least five years considered, with preference to the Cape Province 186 Bursaries 171 Service contract None University of the Witwatersrand WITS 2050 Closing date: 15 September Private Bag 3 Further information: WITS 2050 WITS UNIVERSITY COUNCIL LOANS The Trustees Field of study Any field of study Willie du Toit (Quaggasfontein) WITS SPORTS COUNCIL BURSARIES Value: Amount varies Educational Fund Field of study Any field of study Duration: 1 year PO Box 24 Value: Amount varies Tenable at: University of the Witwatersrand VICTORIA WEST 7070 Duration: 1 year, renewable subject to satisfactory Eligibility Needy students in any year of study Information not confirmed academic and sporting performances Closing date: 30 September Tenable at: University of the Witwatersrand Further information: WILLIE SCHEEPERS BURSARY Eligibility. Awarded to full-time or part-time, Financial Aid & Scholarships Field of study. Any field of study postgraduate or undergraduate registered students University of the Witwatersrand Value: Amount varies with sporting excellence and satisfactory academic Private Bag 3 Duration: 1 year, renewable performance. Based also on financial need if the WITS 2050 Tenable at: University of the OFS circumstances of two candidates are equal Eligibility Direct descendants of the late W.T.D. Service contract: None WITS WOMEN'S CLUB BURSARIES Scheepers and his wife the late M.E. Scheepers. Closing date: 10 January Field of study. Any field of study Preference to residents of Bethlehemdorp and district Further information: Value: At the discretion of the University Closing date: 15 December Senior Assistant Registrar Duration: 1 year, renewable Further information: Financial Aid & Scholarships Tenable at: University of the Witwatersrand The Director (Financial Assistance) University of the Witwatersrand Eligibility Awarded on the basis of financial need and University of the OFS PO Box 3 satisfactory academic performance PO Box 339 WITS 2050 Closing date: 30 September BLOEMFONTEIN 9300 Further information: WITS SQUASH CLUB BURSARY The Senior Assistant Registrar WITS CRICKET CLUB BURSARY Field of study. Any field of study Financial Aid & Scholarships Field of study. Any field of study Value: Amount varies University of the Witwatersrand Value: Amount varies Duration: 1 year, renewable subject to satisfactory Private Bag 3 Duration: 1 year, renewable subject to satisfactory academic and sporting achievement WITS 2050 academic and sporting achievement Tenable at: University of the Witwatersrand Tenable at University of the Witwatersrand Eligibility Awarded on the basis of outstanding ability WITWATERSRAND WOMEN'S AGRICULTURAL Eligibility. Awarded on the basis of outstanding ability in squash and acceptable academic ability to a UNION BURSARY in cricket and satisfactory academic performance to registered student, either undergraduate or post- Field of study Any field of study undergraduate or postgraduate, full-time or part- graduate, full-time or part-time Value: R860 to R4 680 p.a. time students. Award will also be based on financial Closing date: 10 January Duration: 1 year need if the circumstances of two candidates are equal Further information: Tenable at Rand Afrikaans University Closing date: 10 January Senior Assistant Registrar Eligibility Full-time students as from their second Further information: Financial Aid & Scholarships year of study. Preference to children of members of Senior Assistant Registrar University of the Witwatersrand Women's Agricultural Union of the Witwatersrand Financial Aid & Scholarships Private Bag 3 Service contract: None University of the Witwatersrand WITS 2050 Closing date: 15 November Private Bag 3 Further information: WITS 2050 WITS TENNIS CLUB BURSARIES The Registrar (Finance) Field of study Any field of study Rand Afrikaans University WITS HOCKEY CLUB BURSARIES Value: Amount varies PO Box 524 Field of study. Any field of study Duration: 1 year, renewable subject to satisfactory AUCKLAND PARK 2006 Value: Amount varies academic and sporting performance Duration: One year, renewable subject to satisfactory Tenable at: University of the Witwatersrand WOMEN'S AND MOTHER'S MOVEMENT academic and sporting performance Eligibility Awarded on the basis of outstanding ability (BENONI) BURSARY Tenable at University of the Witwatersrand in tennis and satisfactory academic performance to Field of study. Any field of study Eligibility. Candidates with satisfactory academic registered undergraduate or postgraduate, full-time Value: R860 - R4 680 p.a. performance and outstanding ability in hockey. Must or part-time students Duration: 1 year, renewable register with Wits Sports Council Service contract: None Tenable at Rand Afrikaans University Service contract: None Closing date: 10 January Eligibility Full-time needy and meritwonhy male Closing date: 10 January Further information: students returning from military service Further information: Senior Assistant Registrar Closing date: 15 November Senior Assistant Registrar Financial Aid & Scholarships Further information: Financial Aid & Scholarships University of the Witwatersrand The Registrar (Finance) University of the Witwatersrand Private Bag 3 Rand Afrikaans University Private Bag 3 WITS 2050 PO Box 524 WITS 2050 AUCKLAND PARK 2006 WITS UNIVERSITY COUNCIL BURSARIES WITS RUGBY CLUB BURSARIES Field of study Any field of study YVONNE PARFITT BURSARIES TRUST Field of study Any field of study Value: At the discretion of the University Field of study Any field of study Value: Amount varies Duration: 1 year, renewable subject to satisfactory Value: Amount varies Duration: 1 year, renewable subject to satisfactory academic progress Duration: Duration of the course if progress is academic and rugby performance Tenable at: University of the Witwatersrand satisfactory Tenable at: University of the Witwatersrand Eligibility Matriculants and students in any year of Tenable at: Any university or technikon Eligibility. Awarded on the basis of the ability to play study on the basis of financial need and satisfactory Eligibility Awarded on the basis of financial need to rugby as well as satisfactory academic performance academic performance matriculants from Western Cape schools to undergraduate or postgraduate, full-time or part- Service contract: None Service contract: None time students Closing date: 30 September Closing date: Contact the school concemed Service contract: None Further information: Further information: Closing date: 10 January The Senior Assistant Registrar The principal of the student's high school Further information: Financial Aid & Scholarships Office Senior Assistant Registrar University of the Witwatersrand Financial Aid & Scholarships Private Bag 3 172 187 Bursaries ZERILDA STEYN LOAN FUND Zerilda Steyn Bursary/Loan Fund Eligibility: Undergraduate male students born in South Communicare Africa whose parents are Afrikaans. Preference will be Field of study. Any field of study PO Box 259 given to persons born in the Transvaal Value: R6 000 p.a. CAPE TOWN 8000 Service contract: None Duration: 1 year, renewable Closing date: 31 October Tenable at: Any university, technikon, college or adult ZIERVOGEL LOAN Further information: education centre in the Western Cape The Secretary Eligibility: SA citizens, preference to Western Cape Field of study: Any field of study Ziervogel Fonds Value: RI 000 to R3 000 residents PO Box 35296 Service contract: At the discretion of the company Duration: Duration of studies for which the loan is MENLO PARK 0102 Closing date: 31 August awarded Further information: Tenable at: Any university in South Africa The Administrator 188 Bursaries 173 1820 SETTLERS' ASSOCIATION BURSARY The Bursary Officer Duration: 1 year, renewable subject to satisfactory Financial Aid Bureau progress for the duration of the course Field of study. Any tertiary field of study University of Transkei Tenable at University of the Witwatersrand Value: R5 000 p.a. Eligibility. Awarded on the basis of academic merit to Duration: 1 year, renewable for a period of 3 years if Private Bag Xl undergraduate students progress is satisfactory UNITRA 5117 Service contract: None Tenable at: Any university, technikon or tertiary Closing date: 10 January college of education A.J.M. STEPHANSEN BURSARY LOAN SCHEME Further information: Eligibility. Applicants or their parents/guardians must Field of study. Medicine, Natural Sciences and Senior Assistant Registrar have been members of the 1820 Settlers' Association Theology Financial Aid and Scholarships for at least two years Value: RI 000R5 000 p.a. University of the Witwatersrand Service contract: None Duration: Duration of the course Private Bag 3 Closing date: 15 October Tenable at University of Stellenbosch WITS 2050 Further information: Eligibility. Awarded on the basis of financial need and The General Manager merit to undergraduate, white students ACCOUNTING TECHNICIANS BURSARY PRO- 1820 Settlers' Association of SA Service contract: None GRAMME PO Box 31584 Closing date: 15 January BRAAMFONTEIN 2017 Further information: Field of study. National Diploma in Accounting or The Registrar (Bursaries and Loans) Diploma in Cost and Management Accounting 3M SA BURSARY University of Stellenbosch Value: Academic fees and a book allowance Duration: Renewable annually for the duration of the Field of study. Dentistry Private Bag Xl course Value: Amount varies MATIELAND 7602 Tenable at Any technikon in South Africa Duration: 1 year Eligibility. Awarded for full-time study to black SA Tenable at: University of the Westem Cape A.P. LUBBE BURSARY matriculants who have a good pass mark in Ac- Eligibility. Awarded on the basis of financial need and Field of study. Social Work counting or Mathematics and English academic achievement to full-time undergraduate Value: Amount varies Service contract: None students Duration: 1 year, renewable on reapplication Closing date: 30 September Service contract: None Tenable at: University of Stellenbosch Further information: Closing date: New first-year students: 1 March. Eligibility. Awarded on the basis of financial need and Association for the Advancement Current (Senior) students: 31 October of the previous merit of Black Accountants of SA year Service contract: None PO Box 5282 Further information: Closing date: 15 January JOHANNESBURG 2000 The Registrar Further information: Information not confirmed University of the Western Cape The Registrar (Bursaries and Loans) Private Bag X17 University of Stellenbosch ACTUARIAL SCIENCE BURSARIES BELLV1LLE 7535 Private Bag X1 MATIELAND 7602 Field of study. Actuarial Science A. TREVOR WILLIAMS SCHOLARSHIP Value: Tuition, book and residence fees or an amount not exceeding the amount of university residence Field of study. Electrical Engineering or Physics A.W. SCHUMANN BURSARY fees and one economy airfare home per year for out- Value: At the discretion of the University Field of study. Preferably Physics and Mathematics Duration: 1 year Value: Amount varies of-town students Duration: B.Bus.Sci.4 years, reviewed annually Tenable at: University of the Witwatersrand Duration: 3 years Tenable at: Any university in South Africa Eligibility A student of high academic ability regis- Tenable at: University of Stellenbosch Eligibility Awarded on the basis of academic tered for a B.Sc. (Engineering) or B.Sc. (Physics III) Eligibility. Undergraduate students. All other matters achievement degree being equal, descendants get preference Service contract Is required at company descretion Service contract: None Service contract: None Closing date: 31 July Closing date: 10 January Closing date: 15 January Further information: Further information: Further information: Bursary Administrator The Financial Aid & Scholarship Office The Registrar (Bursaries and Loans) Southern Life Association Ltd University of the Witwatersrand University of Stellenbosch Actuarial Manpower Development Private Bag 3 Private Bag X1 Great Westerford WITS 2050 MAT1ELAND 7602 Main Road RONDEBOSCH 7700 A.C. TINGLE MEMORIAL BURSARY ABRAHAM AND OLGA LIPMAN FUND BUR- SARIES Field of study. B.Sc. Forestry and Wood Science ADAM BARNARD AGRICULTURAL STUDY FUND Value: R7 000 p.a. Field of study. Music Field of study Agriculture Duration: 4 years, if progress is satisfactory Value: Amount varies Value: Amount varies Tenable at: University of Stellenbosch Duration: 1 year, renewable if progress is satisfactory Duration: 1 year, renewable Eligibility. Prospective first-year students who are SA for the duration of the course Tenable at: Agricultural school, agricultural college or citizens Tenable at University of the Witwatersrand university Service contract Must enter the service of the Lion Eligibility. Awarded on the basis of academic Eligibility. Needy students Match Company for at least two years achievement and financial need to undergraduate, Service contract None Closing date: 15 January postgraduate, diploma and licentiate students Closing date: 15 December Further information: Service contract: None Further information: The Dean: Faculty of Forestry Closing date: 30 September The Manager University of Stellenbosch Further information: Adam Barnard Agric Study Fund Private Bag X1 The Financial Aid & C/o ABSA Trust Ltd MATIELAND 7602 Scholarships Office University of the Witwatersrand Trust Division PO Box 1033 A.H. HESSEL BURSARY FUND Private Bag 3 SANLAMHOF 7532 Field of study. Religious and biblical studies WITS 2050 Value: Amount varies ABRAHAM AND OLGA LIPMAN FUND SCHOL- ADAMS AND ADAMS BURSARY Tenable at University of Transkei Field of study. Law Eligibility Transkeian born students who intend to do ARSHIPS Duration: Duration of the course if progress is religious and biblical studies Field of study: Music satisfactory CloSing date: Contact the University Value: R1 500 Tenable at: University of Pretoria Further information: 189 174 Bursaries Eligibility: Awarded on the basis of achievement and year of study financial need to full-time students from the second Service contract: None Closing date: 15 October AECI LTD BURSARY AFRIKAANSE MUSIEKKLUB BEURS VIR KOM- POSISIE Further information: Field of study: Chemical, Mechanical, Electrical, The Head: Study Financing Industrial and Electro-mechanical Engineering Field of study: Music University of Pretoria Value: All tuition, residence and other academic fees Value: Determined annually PRETORIA 0002 and a personal/book allowance Duration: 1 year Duration: 1 year, renewable for 4 years Tenable at: University of Pretoria ADAMS AND ADAMS BURSARY Tenable at: Any recognised university in SA Eligibility: Available to the B.Mus. student with the Field of study: Law Eligibility Prospective and current undergraduate highest achievement in Composition IV. Awarded on Value: Amount varies students who are SA citizens the recommendation of the Head of the Department Duration: 1 year Service contract: One year service for every two years of Music Tenable at: University of the Western Cape (or part thereof) for which the bursary was received, Service contract: None Eligibility Awarded on the basis of financial need and as well as vacation training Closing date: 15 October academic achievement to full-time undergraduate Closing date: 30 June Further information: students Further information: The Head: Study Financing Service contract: None The Scholarship Officer University of Pretoria Closing date: New first-year students: 1 March. AECI Limited PRETORIA 0002 Current (Senior) students: 31 October of the previous Private Bag X2 year MODDERFONTEIN 1645 AGRICOR BURSARY Further information: Field of study: Agriculture, Social Work, Public Health. The Registrar AFRICAN EDUCATIONAL TRUST Animal Health, Veterinary Science University of the Western Cape Field of study: Any field of study (except Arts) Value: Tuition and residence fees plus a book Private Bag X17 Value: Approximately R3 500 allowance BELLVILLE 7535 Duration: 1 year, renewable for the duration of the Duration: 1 year, renewable for the duration of the course subject to satisfactory academic performance course if academic progress is satisfactory ADAMS AND ADAMS BURSARY FUND and continued financial need Tenable at: Any tertiary institution Field of study: Law (B.Proc. or LL.B.) Tenable at: University of the Witwatersrand Eligibility: Undergraduate students who are SA Value: R2 200 Eligibility: Awarded on the basis of financial need and citizens Duration: 1 year, renewable for the duration of the academic performance to black and coloured Service contract: One year service for each year for course subject to satisfactory progress students as from the second year of study which the bursary was received Tenable at: University of the Witwatersrand Service contract: None Closing date: 30 September Eligibility: Awarded on the basis of financial need and Closing date: 30 September Further information: academic performance to students from the second Further information: The Human Resources Manager year of study The Senior Assistant Registrar Organisational Development Service contract: None Financial Aid and Scholarships Agricor Closing date: 30 September University of the Witwatersrand Private Bag X2137 Further information: Private Bag 3 MMABATHO The Senior Assistant Registrar WITS 2050 Information not confirmed Financial Aid and Scholarships University of the Witwatersrand AFRICON BURSARY AGRICULTURAL RESEARCH COUNCIL (ARC) Private Bag 3 Field of study: Civil and Electrical Engineering, as well ORDINARY BURSARIES WITS 2050 as Computer Science Field of study: Agricultural Sciences, Natural Sciences Value: R14 000 p.a. Value: R15 000 p.a. ADIE FUHRMANN BURSARY Duration: Duration of the course if progress is Duration: 1 year, renewable Field of study: History of Art satisfactory (maximum 4 years) Tenable at: Any recognised university or technikon Value: R860R8 030 p.a. Tenable at: Any South African university approved by Eligibility: Candidates who comply with the minimum Duration: 1 year, renewable the Company requirements of the technikon or university in respect Tenable at: Rand Afrikaans University Eligibility Prospective and current students of the field of study as mentioned Eligibility Full-time undergraduate and postgraduate Service contract: One year service for each year for Closing date: 31 July students which the bursary was received Further information: Service contract: None Closing date: 30 September The Director Closing date: 15 November Further information: Human Resources & Admin Further information: The Training Co-ordinator PO Box 8783 The Registrar (Finance) Africon PRETORIA 0001 Rand Afrikaans University PO Box 905 PO Box 524 PRETORIA 0001 AGRICULTURAL RESEARCH COUNCIL (ARC) AUCKLAND PARK 2006 PRESTIGE BURSARIES AFRICON ENGINEERING INTERNATIONAL Field of study: Agricultural Sciences, Natural Sciences ADRIAAN ELFERINK BURSARY BURSARIES (TECHNIKON) Value: R20 000 p.a. Field of study. Classical Languages or Roman Field of study: Civil and Electrical Engineering (mainly Duration: 1 year, renewable Languages (French) Civil Engineering) Tenable at: Any recognised university or technikon Value: R600 to R8 030 p.a. Value: R12 000 p.a. Eligibility: Matriculants with A or B symbols in Duration: 1 year, renewable Duration: Duration of the course if progress is Mathematics, Physical Science and Biology Tenable at: Rand Afrikaans University satisfactory Closing date: 31 July Eligibility: Full-time undergraduate and postgraduate Tenable at: Any technikon approved by the company Further information: students Eligibility: Diploma students, on the basis of academic The Director Service contract: None achievement Human Resources & Admin Closing date: 15 November Service contract: Six months service for every PO Box 8783 Further information: semester at the technikon PRETORIA 0001 The Registrar (Finance) Closing date: Contact the company Rand Afrikaans University Further information: AGRIHOLD BURSARIES PO Box 524 The Training Co-ordinator Field of study: B.Sc. (Agric.) with Plant Pathology, AUCKLAND PARK 2006 Africon Engineering International Entomology or Weed Science as major subjects PO Box 905 Value: R3 000R7 500 PRETORIA 0001 Duration: 1 year, renewable Tenable at: Any university in South Africa 1I J0 arcpriac 175 Eligibility: Undergraduate students as from the Eligibility. Awarded on the basis of financial need and Private Bag 3 second year of study academic performance to a black student in any year WITS 2050 Service contract None of study Closing date: 31 October Service contract: None ALBERT HOSSACK SCHOLARSHIP Further information: Closing date: 30 September Field of study: Electrical Engineering Mrs E Olivier Further information: Value: At the discretion of the University Agiihold The Senior Assistant Registrar Duration: 1 year, renewable PO Box 912055 Financial Aid and Scholarships Tenable at: University of the Witwatersrand SILVERTON 0127 University of the Witwatersrand Eligibility Awarded on the basis of financial need and Information not confirmed Private Bag 3 academic performance WITS 2050 Service contract: None AHI POTCHEFSTROOM BEURS Closing date: 30 September ALAN STARKE COMMEMORATION FUND Field of study: Economic Sciences Further information: Value: Amount varies (LOAN) The Senior Assistant Registrar Tenable at: Potchefstroom University for CHE Field of study Horticulture Financial Aid and Scholarships Eligibility: Undergraduate students. Preference will be Value: Amount varies University of the Witwatersrand given to children of members or personnel of the AHI Duration: 1 year, renewable Private Bag 3 Potchefstroom, other members of the Afrikaanse Tenable at: University of Natal WITS 2050 Sakekamer and children of members of the AHI Eligibility Undergraduate students Service contract: Bursary is to be paid back immedi- Service contract: None ALEC BROOK BURSARY ately at the current rate of interest if studies are Closing date: None Field of study: Medicine or a degree or diploma discontinued or if progress is unsatisfactory Further information: course in Engineering (all branches) Closing date: 30 November The Secretary Value: Amount varies Further information: SA Nurseryman's Association Duration: 1 year, renewable The Chairman PO Box 3555 Tenable at: Any university or technikon Potchefstroomse Afrikaanse Sakekamer HALFWAY HOUSE 1685 Eligibility Applicants must be SA citizens, resident in PO Box 824 Information not confirmed SA for at least five years, unmarried, under 25 years POTCHEFSTROOM 2520 of age and their parents must be residents in the ALAN WIGODER MEMORIAL FUND district of Port Elizabeth AIR SURVEY COMPANY OF AFRICA LOAN Field of study B.Sc. (Ufe Sciences) Service contract None Field of study: B.Sc. (Land Surveying) Value: Approximately R1 500 p.a. Closing date: 30 September Value: Tuition fees Duration: 1 year, renewable for the duration of the Further information: Duration: 1 year, renewable course subject to continued financial need and Alec Brook Bursary Fund Tenable at: University of Natal satisfactory academic performance c/o Syfrets Trust Limited Eligibility. Awarded on the basis of financial need and Tenable at University of the Witwatersrand PO Box 466 academic qualifications to students from the second Eligibility: Awarded on the basis of financial need and PORT ELIZABETH 6000 year onwards. Degrees other than Land Surveying academic performance Information not confirmed cannot be considered Service contract: None Service contract: None Closing date: 30 September ALETTA VORSTER BURSARY Closing date: 31 October Further information: Field of study. B.Theology Further information: The Senior Assistant Registrar Value: Approximately R500 Air Survey Company of Africa Ltd Financial Aid and Scholarships Duration: Duration of the course PO Box 2836 University of the Witwatersrand Tenable at: University of Stellenbosch DURBAN 4000 Private Bag 3 Eligibility. Awarded on the basis of financial need and WITS 2050 merit to undergraduate students AKTOL UNDERGRADUATE BURSARY Service contract: None ALBERT ELLMER BURSARY Field of study: Chemical Engineering, Chemistry or Closing date: 15 January Education Field of study Civil Engineering (preference to Soil Further information: Value: R5 000 and Water Conservation) The Registrar: Bursaries and Loans Duration: 1 year, renewable annually, dependent Value: Determined annually University of Stellenbosch upon satisfactory academic progress, continuing Duration: 1 year Private Bag X1 financial need and good conduct Tenable at Rand Afrikaans University MATIELAND 7602 Tenable at: University of the Witwatersrand Eligibility Undergraduate and postgraduate students Eligibility Awarded on the basis of financial need and Service contract: None ALVISE PISANO SCHOLARSHIPS academic performance to candidates who have Closing date: 15 November Field of study BA (Italian Studies) successfully completed the university entrance Further information: Value: R500R1 000 examinations or their first year of study. Preference The Registrar (Finance) Duration: 1 year, renewable will be given to canditates from underprivileged RAU Tenable at: University of Cape Town backgrounds PO Box 542 Eligibility. Awarded on the basis of academic Service contract: None AUCKLAND PARK 2006 achievement Closing date: 30 September Service contract: None Further information: ALBERT GEYSER BURSARY FUND Closing date: 1 March The Senior Assistant Registrar Field of study Biblical and Religious Studies Further information: Financial Aid and Scholarships Value: At the discretion of the University Undergraduate Financial Aid Office University of the Witwatersrand Duration: I year, renewable Students Union Private Bag 3 Tenable at University of the Witwatersrand UCT WITS 2050 Eligibility Awarded on the basis of academic merit Private Bag and financial need to students who have successfully RONDEBOSCH 7700 ALAN B. CLEMONS BURSARY completed the course Biblical and Religious Studies I Field of study. Diploma in Speech and Hearing and who have registered for the course Biblical and ALWYN ZOUTENDYK BURSARIES Therapy Religious Studies11,111or Honours Field of study: Medicine Value: At the discretion of the University Service contract: None Value: According to need Duration: 1 year, renewable on reapplication and Closing date: 30 September Duration: 1 year, renewable for the duration of the continued financial need and satisfactory academic Further information: course performance The Senior Assistant Registrar Tenable at: University of the Witwatersrand Tenable at: University of the Witwatersrand Financial Aid and Scholarships Eligibility. Awarded on the basis of financial need and University of the Witwatersrand 1 academic performance i91 17A Bursaries Service contract: None Information not confirmed ANGLOVAAL MINERALS TECHNIKON BURSARY Closing date: 30 September SCHEME Further information: ANGLO AMERICAN CORPORATION GROUP Field of study. Engineering: Mechanical, Electrical The Senior Assistant Registrar VOCATIONAL SCHOLARSHIPS (Heavy Current), Metallurgical Engineering, Analytical Financial Aid and Scholarships Field of study: Chemical, Electrical (preferably Heavy Chemistry and Extraction Metallurgy University of the Witwatersrand Current), Mechanical, Metallurgical and Mining Value: Tuition, residence and registration fees, Private Bag 3 Engineering; Geology personal allowance and a book allowance WITS 2050 Value: Tuition and residence fees plus an allowance of Duration: 1 year, renewable R4 700 p.a. Tenable at: Any technikon in South Africa where AMEU (ASSOCIATION OF MUNICIPAL ELEC- Duration: Renewable annually for the duration of the required courses are offered TRICITY UNDERTAKINGS OF SA) STUDENT course up to honours level if progress is satisfactory Eligibility: Students who are SA citizens, under 25 ASSISTANCE SCHEME Tenable at: Any university in SA years of age, with a Senior Certificate with university Field of study: Electrical Engineering Eligibility: Young people who are interested in the admission. A valid Certificate of Fitness is essential Value: AMEU offers to pay the interest on selected mining industry. Candidates who are interested in Service contract: Six months service for each semester bank loans Chemical or Metallurgical Engineering should be for which bursary was awarded Duration: 1 year, renewable prepared to do courses in Extraction Metallurgy and Closing date: 31 May Tenable at: Any university Mineral Processing. Candidates should do Geology Further information: Eligibility: SA citizens together with Chemistry and/or Physics and/or The Bursary Unit Service contract: None Mathematics or another subject approved by the AVMIN LTD Closing date: Any time Corporation PO Box 62379 Further information: Service contract: Employment with the Corporation on MARSHALLTOWN 2107 AMEU Secretariat a year for year service basis PO Box 868 Closing date: 30 June ANNA JULIANA THERON BURSARY FERNDALE 2160 Further information: Field of study: Preferably Agricultural Sciences The Scholarship & Bursary Unit Value: Amount varies AMPLATS BURSARY SCHEME Anglo American Corp of SA Ltd Tenable at: University of Stellenbosch PO Box 61587 Eligibility: Awarded on the basis of financial need and Field of study: Electrical, Chemical, Mechanical, MARSHALLTOWN 2107 Mining and Metallurgical Engineering; Mine Surveying; merit to Afrikaans-speaking students, with prefer- Mining Geology; Accounting; Analytical Chemistry ence to the donor's family ANGLO AMERICAN CORPORATION OF SA Value: Tuition, registration and residence fees. Book, Service contract: None LIMITED BRIDGING PROGRAMME BURSARY computer and personal allowance plus medical cover Closing date: 15 January Tenable at: Company approved tertiary institutions Field of study: A bridging programme with study in Further information: Eligibility: Awarded on the basis of merit the following courses in mind: Electrical and Me- The Registrar: Bursaries and Loans Service contract: 6 months for every 6 months of the chanical Engineering, Chemical Engineering (with University of Stellenbosch award Minerals Processing), Metallurgical or Mining Private Bag XI Closing date: 15 May Engineering, Geology and Accounting MAT1ELAND 7602 Further information: Value: Tuition and residence fees, plus a cash Bursary Department allowance ANNA PRETORIUS BURSARY Amplats Human Resource Duration: 1 year Field of study: Music and Drama Development Unit Tenable at: Universities of Natal, Cape Town and Value: Amount varies PO Box 450 Witwatersrand Tenable at: University of Stellenbosch KROONSTAD 0350 Eligibility: Citizens of South Africa who have an Eligibility: Awarded on the basis of financial need and educational disadvantage, to benefit from the merit to undergraduate students ANDREW DICKSON SCHOLARSHIP bridging programme before enrolling for first-year Service contract: None study Field of study. Commerce Closing date: 15 January Service contract: None Value: RI 250 p.a. Further information: Closing date: 30 June Duration: 1 year, renewable for a further 2 years The Registrar: Bursaries and Loans Further information: provided that the scholarship standard has been University of Stellenbosch Scholarship & Bursary Unit Private Bag XI maintained Anglo American Corp of SA Ltd Tenable at: University of the Witwatersrand MAT1ELAND 7602 PO Box 61587 Eligibility: Awarded on the basis of outstanding academic performance to full-time or part-time MARSHALLTOWN 2107 ANNEMARIE BASSON BURSARY undergraduate students Field of study Human Sciencespreference is given ANGLOVAAL MINERALS BURSARY SCHEME Service contract: None to students with Philosophy as a major Closing date: 10 January Field of study: B.Sc. (Geology) including Honours; B.Sc. Value: R400 to R5 000 annually Further information: (Mining Geology) including Honours: Engineering: Duration: 1 year The Financial Aid Mining, Mechanical, Chemical, Electrical (Heavy Tenable at: Rand Afrikaans University & Scholarships Office Current) and Metallurgical Eligibility: Awarded on the basis of financial need to University of the Witwatersrand Value: Tuition, residence and registration fees. full-time undergraduate students PO Box 3 personal allowance and a book allowance Service contract: None WITS 2050 Duration: I year, renewable Closing date: 15 November Tenable at: Any university in SA Further information: ANGLO AMERICAN ASSURANCE BURSARY Eligibility: Students under 25 years of age who are The Registrar (Finance) citizens of SA Field of study: Commerce, Law and Natural Sciences Rand Afrikaans University Service contract: One year service for each year for Value: RI 000 maximum PO Box 524 which the bursary was received. Compulsory vacation Duration: 1 year, renewable if progress is satisfactory AUCKLAND PARK 2006 work is required during December each year Tenable at: University of the Western Cape, Peninsula Closing date: 31 May ANTON HARTMAN BURSARY Technikon Further information: Eligibility: Full-time, undergraduate and diploma Field of study: Music The Bursary Unit students Value: R2 000 AVMIN LTD Service contract: None Duration: 1 year PO Box 62379 Closing date: 15 January same year Tenable at: University of Stellenbosch MARSHALLTOWN 2107 Further information: Eligibility: Awarded to undergraduate or postgraduate The Manager students Anglo American Assurance Service contract: None PO Box 1114 Closing date: 30 September JOHANNESBURG 2000 Further information: 192 irqaries 177 The Chairman The Director. Personnel ATKV STUDY LOAN FOR PART-TIME STUDY Dept of Music Armscor Field of study Any approved qualification after mark University of Stellenbosch Private Bag X337 with a duration of 12 months or more Private Bag X1 PRETORIA 0001 Value: R4 000 p.a. MAT1ELAND 7602 Information not confirmed Duration: 1 year, renewable on merit Tenable at Any approved tertiary institution ANTON HARTMAN TRUST BURSARIES ARMSCOR BURSARY FOR TECHNIKON STUDY Eligibility. ATKV members and their dependent Reid of study. Music Field of study. Mechanical, Civil and Electrical children for part-time study Value: R3 000 for tuition fees and, if there is a Engineering; Explosives Technology; Metallurgy Service contract: None balance, books Value: Tuition and residence fees plus a cash amount Closing date: 15 October Duration: 1 year which is reviewed from time to time Further information: Tenable at University of the Witwatersrand Duration: 1 year The Managing Director Eligibility. Awarded on the basis of financial need and Tenable at: Any technikon ATKV academic performance to students registered for Eligibility. Diploma students PO Box 4586 undergraduate or postgraduate degrees, diplomas or Service contract: None RANDBURG 2125 licentiates in the School of Music Closing date: Mid June Service contract None Further information: ATOMIC ENERGY CORPORATION BURSARIES Closing date: 30 September The Director FOR UNIVERSITY STUDIES Further information: Armscor Field of study Chemical, Electrical, Electronic, The Senior Assistant Registrar Private Bag X337 Industrial, Mechanical and Metallurgical Engineering; Financial Aid and Scholarships PRETORIA 0001 Chemistry; Physics; Material Science University of the Witwatersrand Information not confirmed Value: Tuition, residence and meal fees, a book Private Bag 3 allowance and financial assistance to obtain a WITS 2050 ARTHUR E. HILL BURSARY personal computer Feld of study Civil or Mechanical Engineering Duration: Minimum duration of the course ANTON RUPERT BURSARY Value: Up to a maximum of the tuition fees payable Tenable at: Any university Field of study B.Sc. Duration: 1 year, renewable for the duration of the Eligibility. Scholars and students who are SA citizens Value: Amount varies course subject to satisfactory academic performance Service contract One year service for each year for Duration: 1 year and continued financial need which the bursary was received Tenable at. University of the Western Cape Tenable at University of the Witwatersrand Closing date: 15 June Eligibility. Awarded on the basis of financial need and Eligibility. Awarded on the basis of financial need and Further information: academic achievement to full-time undergraduate academic performance University Bursary Admin students Service contract None AEC Service contract: None Closing date: 30 September PO Box 582 Closing date: New first-year students: 1 March. Further information: PRETORIA 0001 Current (Senior) students: 31 October of the previous The Senior Assistant Registrar year Financial Aid and Scholarships ATZO NICOLAI MEMORIAL SCIENCE BURSARIES Further information: University of the Witwatersrand Field of study Science The Registrar Private Bag 3 Value: At the discretion of the University University of the Western Cape WITS 2050 Duration: 1 year, renewable for the duration of the Private Bag X17 course BELLVILLE 7535 ASSOCIATION OF MUNICIPAL ELECTRICITY Tenable at University of the Witwatersrand UNDERTAKINGS (SA) BURSARY Eligibility. Awarded on the basis of financial need and ARGUS CENTENERY BURSARY Feld of study Electrical Engineering (Heavy Current) academic performance to second-year students. Field of study. English Value: A maximum loan of R12 900 from NEDBANK Preference to students of British or Dutch (Hollands) Value: Amount varies interest to be serviced by the AMEU descent Duration: 1 year Duration: 1 year, renewable annually for the duration Service contract None Tenable at: University of the Western Cape of the course Closing date: 30 September Eligibility. Awarded on the basis of financial need and Tenable at: Any university or technikon Further information: academic achievement to full-time undergraduate Eligibility. Undergraduate students who have The Senior Assistant Registrar students successfully completed their first year of study and Financial Aid and Scholarships Service contract: None who are SA citizens University of the Witwatersrand Closing date: New first-year students: 1 March. Service contract. None Private Bag 3 Current (Senior) students: 31 October of the previous Closing date: During year WITS 2050 Year Further information: Further information: The Secretary AUBREY FALKSON BURSARY The Registrar AMEU Field of study B.Com., B.Sc., BA (with legal subjects) University of the Western Cape PO Box 868 or LLB. Private Bag X17 FERNDALE 2160 Value: Amount varies BELLV1LLE 7535 Duration: 1 year ASSOCIATION OF SA QUANTITY SURVEYORS Tenable at Rhodes University ARMSCOR BURSARY STUDENT LOAN SCHEME Eligibility Awarded for second or subsequent years of Field of study. Aeronautical, Chemical, Elec- Reid of study. Quantity Surveying study on the basis of financial need and academic tronic/Electrical, Mechanical or Metallurgical Engi- Value: Determined according to merit ability neering; B.Sc. Natural Sciences; Physics; Chemistry; Duration: 1 year, renewable if progress is satisfactory Service contract: None Mathematics; Applied Mathematics; Mathematical Tenable at Universities of Carr Town, Natal, Orange Closing date: 1 December Statistics or Computer Science Free State, Port Elizabeth, Pretoria and the Witwa- Further information: Value: Tuition fees plus a cash amount as well as a tersrand The Financial Aid Officer merit award as from the second year of study Eligibility. Students as from their second year of study Rhodes University Duration: 1 year, renewable if progress is satisfactory Service contract. None PO Box 94 with a maximum of 4 years Closing date: 15 January GRAHAMSTOWN 6140 Tenable at Any university Further information: Information not confirmed Igigibility. Undergraduate students The Director Service contract One year service for each year for The Association of SA Quantity Surveyors AUBREY SIMPSON BURSARY which the bursary was received PO Box 3527 Field of study. Land Surveying Closing date: 31 May HALFWAY HOUSE 1685 Value: Tuition fees Further information: Duration: 1 year, renewable to 4 years maximum 193 178 Bursaries Tenable at: Universities of Cape Town, Natal and Eligibility White male Protestants as from their second Sanlam Trust Pretoria year of study to qualify for the civil service in the RSA PO Box 1260 Eligibility: SA citizens or as pharmaceutical chemists. Bursary conditions as SANLAMHOF 7532 Service contract: Must register with the council for stipulated in the will Land Surveyors within 4 years of completion of the Service contract: None BABS BEYLEVELD BURSARY course Closing date: 15 December Field of study: B.A. with Theological subjects Closing date: 31 December Further information: Value: R1 000 pa. Further information: The Trust Officer Duration: 1 year The Registrar BG Heydenrych Bursaries Tenable at: University of Stellenbosch Aubrey Simpson Bursary The Board of Executors Eligibility: Awarded on the basis of merit and financial SA Council for Professional PO Box 86 need to undergraduate students and Technical Surveyors CAPETOWN 8000 Service contract: None PO Box 62041 Closing date: 15 January MARSHALLTOWN 2107 B.L. STEYN Further information: Information not confirmed Field of study: Sociology The Registrar: Bursaries and Loans Value: Amount varies University of Stellenbosch AVBOB MUTUAL INSURANCE SOCIETY BURSARY Duration: 1 year Private Bag X1 Field of study: Social Work Tenable at: Rand Afrikaans University MAT1ELAND 7602 Value: R1 500 p.a. Eligibility: Awarded to the top student in Sociology III Duration: 4 years who intends to continue with Honours studies in BANK OF LISBON BURSARY Tenable at: University of Stellenbosch Sociology Field of study: Economic and Management Sciences Eligibility: Awarded on the basis of financial need to Service contract: None Value: R1 000 p.a. two prospective first-year students Closing date: 15 November Duration: 1 year, renewable Service contract: None Further information: Tenable at: Rand Afrikaans University Closing date: 15 January The Registrar (Finance) Eligibility: Awarded on the basis of financial need and Further information: Rand Afrikaans University academic achievement to a full-time second- or The Registrar: Bursaries and Loans PO Box 524 third-year student of Portuguese origin University of Stellenbosch AUCKLAND PARK 2006 Service contract: None Private Bag X1 Closing date: 15 November MAT1ELAND 7602 B.S. PRYCE MEMORIAL BURSARY Further information: Field of study. Architecture, Civil Engineering The Registrar (Finance) AVBOB STUDY LOAN FUND Value: R5 000 Rand Afrikaans University Field of study. Any field of study. Preference will be Duration: 1 year PO Box 524 given to fields of study which may be beneficial to Tenable at: University of the Witwatersrand AUCKLAND PARK 2006 AVBOB and its affiliates Eligibility. Awarded on the basis of financial need and Value: Maximum of R6 160 p.a. academic performance to all race groups BARCOM ELECTRONICS (PTY) LIMITED BUR- Duration: 1 year, renewable Service contract: None SARY Tenable at: Rand Afrikaans University Closing date: 30 September Field of study: B.Sc. (Electronics) Eligibility: Awarded on the basis of financial need and Further information: Value: Tuition fees plus a book and subsistence academic merit to full-time postgraduate and The Senior Assistant Registrar allowance undergraduate students who already completed their Financial Aid and Scholarships Duration: Duration of the course first year of study successfully University or the Witwatersrand Tenable at: University of Durban-Westville, University Service contract: None Private Bag 3 of Natal Closing date: 15 November WITS 2050 Eligibility: Undergraduate students Further information: Service contract: One year service in New Germany for The Registrar (Finance) B.SC. CIVIL ENGINEERING BURSARIES each year for which the bursary was awarded Rand Afrikaans University Field of study: Civil Engineering Closing date: 31 October PO Box 524 Value: Tuition fees plus a book allowance that varies Further information: AUCKLAND PARK 2006 according to year of study The Personnel Manager Duration: Academic performance related Barcom Electronics (Pty) Ltd B'NAI B'RITH JOHANNESBURG LODGE AND Tenable at: Any university in South Africa PO Box 118 CHAPTER LILLIENFIELD BURSARY Eligibility. SA matriculants and undergraduate NEW GERMANY 3610 Field of study. Hebrew or Social Work students with Mathematics HG (C symbol) and Information not confirmed Value: R1 700 Physical Science HG (C symbol) BARKLY WEST/ KLIPDAM FARMERS' ASSOCIA- Duration: 1 year Service contract: Varies with year of study Tenable at: University of the Witwatersrand Closing date: 31 August TION BURSARY Eligibility. Awarded on the basis of financial need and Further information: Field of study: Agriculture academic performance to a student in any year of Bursary Co-ordinator Value: R3 000 pa. study SA Institute of Steel Tenable at: University of the OFS Service contract: None Construction Eligibility: Students who reside in the Barkly-West Closing date: 30 September PO Box 1338 farming area only and have successfully completed Further information: JOHANNESBURG 2000 their first year of study The Senior Assistant Registrar Information not confirmed Service contract: None Financial Aid and Scholarships Closing date: 31 October University of the Witwatersrand BABETTE TAUTE BURSARIES Further information: Private Bag 3 Field of study: English Language and Literature The Secretary WITS 2050 Value: Amount varies PO Box 240 Duration: 1 year BARKLY WEST 8375 B.G. HEYDENRYCH BURSARY Tenable at: Any university Field of study: Any field of study acceptable for Eligibility. Awarded on merit to FULL -LIME UNDER- BARNEY BLIEDEN BURSARIES govemment service, as well as Pharmacy GRADUATE FINAL YEAR STUDENTS and Honours Field of study: Biochemistry, Medical Biochemistry, Value: R3 000 pa. students Nuclear Medicine Duration: 1 year, renewable with a maximum of 3 Service contract: None Value: Amount varies years Closing date: 15 September Duration: 1 year, renewable Tenable at: Any university or technikon Further information: Tenable at: University of the Witwatersrand The Trustees Babette Taute Trust Rtirs2ries 194 179 Eligibility: Awarded on the basis of financial need and BEREND KOLK BURSARY BRAAMFONTEIN 2017 satisfactory academic performance to students as Field of study: Science from their second year of study BLUE CIRCLE BURSARY i Value: Approximately R500 Service contract: None Tenable at University of the Witwatersrand Field of study. Electrical Engineering, Civil Engineer- Closing date: 30 September Eligibility. Awarded on the basis of financial need and ing, Mechanical Engineering, Accounting, Cost and Further information: academic performance to a black student registered Management Accounting, Marketing The Financial Aid & Scholarship Office for the degree of B.Sc. Value: Tuition and registration plus a book allowance, University of the Witwatersrand Service contract: None in some cases also residence fees Private Bag 3 Closing date: 30 September Tenable at Technikon Witwatersrand WITS 2050 Further information: Eligibility: Awarded on the basis of academic merit, The Senior Assistant Registrar financial need and future manpower requirements to BARROW CONSTRUCTION BURSARY Financial Aid and Scholarships students who are SA citizens Field of study: Building Science University of the Witwatersrand Service contract: Half the curriculum period for which Value: R500 Private Bag 3 the bursary has been granted Duration: 1 year WITS 2050 Closing date: 30 August Tenable at: University of the Witwatersrand Further information: Eligibility. Awarded on the basis of financial need and BERNARD THOMAS BOURKE BURSARY JM Hewtson academic performance Field of study. B.Sc. (Geology) Bursaries Commitee Service contract: None Value: At the discretion of the University Blue Circle Ltd Closing date: 30 September Duration: 1 year, renewable PO Box 1320 Further information: Tenable at: University of the Witwatersrand PARKLANDS 2121 The Senior Assistant Registrar Eligibility Awarded on the basis of financial need and Financial Aid and Scholarships academic performance BOART LONGYEAR BURSARY (BRIDGING University of the Witwatersrand Service contract: None SCHEME) Private Bag 3 Closing date: 30 September Field of study Mechanical and Metallurgical Engi- WITS 2050 Further information: neering The Senior Assistant Registrar Value: Tuition and residence fees plus R1 600 p.a. BASIL LE MAY BURSARY Financial Aid and Scholarships Duration: 1 year Field of study. English or Performing Arts University of the Witwatersrand Tenable at University of the Witwatersrand Value: R2 000 p.a. Private Bag 3 Eligibility Standard 10 pupils Duration: 3 years WITS 2050 Service contract: Is required Tenable at: Any university, technikon, or college in Closing date: 1 October South Africa BEURSFONDS TEOLOGIESE STUDIE VAN DIE NG Further information: Eligibility. Awarded on the basis of academic merit to KERK VAN DIE OVS The Regional HR Manager second-year students under 21 years on the 1st of Field of study. Theology Boart Longyear November in the year in which tenure of an award Duration: 1 year PO Box 784149 would begin. Applicants or parents of applicants Tenable at: University of the OFS SANDTON 2146 must be members of the 1820 Settlers' Foundation Eligibility. Undergraduate and postgraduate students Information not confirmed Service contract: None of the Free State Closing date: 31 October Service contract: Service in the Dutch Reformed BOB BLUNDELL MEMORIAL BURSARY Further information: Church is required Field of study B.Sc. (Forestry) or B.Sc. (Agric.) (Nature The Executive Director Closing date: 31 August Conservation) Grahamstown Foundation Further information: Value: R3 000 PO Box 304 Director: Administration & Finance Duration: Duration of the course if progress is GRAHAMSTOWN 6140 NG Ken( OVS satisfactory PO Box 399 Tenable at: University of Stellenbosch BATEMAN SCHOLARSHIP FUND BLOEMFONTEIN 9300 Eligibility: Awarded to undergraduate students on the Field of study Commerce, Engineering, Science basis of merit and financial need Value: At the discretion of the University BIA BURSARY Closing date: 31 December Duration: 1 year, renewable subject to satisfactory Field of study: B.Sc. (Building Management) Further information: academic performance Value: R3 500 pa. Prof RC Bigalke Tenable at: University of the Witwatersrand, Rhodes Duration: 1 year Dept of Nature Conservation University Tenable at University of Pretoria Faculty of Forestry Eligibility: Awarded on the basis of financial need and Eligibility. Awarded on the basis of financial need to University of Stellenbosch above average academic performance to second-year undergraduate students MAT1ELAND 7602 students Closing date: 31 October Service contract: None Further information: BOB BLUNDELL MEMORIAL SCHOLARSHIP Closing date: Contact the university concerned The Director Field of study. Zoology or allied field with the accent Further information: Building Industry Association (N Tvl) on Nature Conservation The bursary officer of the university concerned PO Box 40009 Value: R4 000 ARCADIA 0007 Duration: 1 year, renewable BENADE/WOMAN'S ASSOCIATION BURSARY Information not confirmed Tenable at University of Pretoria, University of Cape Field of study Social Work Town, University of Stellenbosch, Rhodes University Value: R1 000 BKS BURSARY Eligibility: Awarded on the basis of academic per- Duration: 1 year Field of study. Civil Engineering formance to deserving undergraduate or postgradu- Tenable at: University of Stellenbosch Value: Tuition and residence fees plus a cash ate students Eligibility. Awarded on the basis of financial need and allowance Service contract None merit to a woman student Duration: 1 year, renewable Closing date: 31 December Service contract: None Tenable at Any university in South Africa Further information: Closing date: 15 January Eligibility: Awarded on the basis of outstanding C J Geekie Further information: academic achievement to full-time undergraduate PO Box 158 The Registrar: Bursaries and Loans students PRETORIA 0001 University of Stellenbosch Service contract: Yes Information not confirmed Private Bag X1 Closing date: 30 June MATlaAND 7602 Further information: BKS (Pty) Ltd i PO Box 31805 180 195 Bursaries Further information: BOB BLUNDELL TRUST (SIR ARNOLD THEILER Tenable at: University of Transkei The Director Student Admin MEMORIAL BURSARY) Eligibility. Transkeian born students Closing date: Contact the University University of the OFS Field of study. Veterinary Science (specialising in wild Further information: PO Box 339 life) The Bursary Officer BLOEMFONTEIN 9300 Value: R4 000 p.a. Financial Aid Bureau Duration: 1 year, renewable University of Transkei BREYTENBACH BURSARY Tenable at: University of Pretoria Private Bag X1 Field of study: Dramatic Art Eligibility: Awarded on the basis of academic UNITRA 5117 Value: At the discretion of the University achievement and financial need to full-time under- Duration: 1 year, renewable on reapplication and graduate students BOPHUTHATSWANA MPUDULOLE BURSARY AID continued financial need and satisfactory academic Service contract: None FUND performance Closing date: 31 December Tenable at: University of the Witwatersrand Further information: Field of study: Agriculture, Commerce, Natural Eligibility: Awarded on the basis of financial need and Bob Blundell Trust Sciences and technical courses (other fields of study academic performance to black or coloured students (Sir Arnold Theiler Bursary) may also be considered and dealt with at the Service contract: None Mr C.J. Geekie discretion of the board) Closing date: 30 September PO Box 158 Value: Full tuition, accommodation and meal fees and Further information: PRETORIA 0001 a book allowance Duration: Duration of the course subject to satisfac- The Senior Assistant Registrar Financial Aid and Scholarships BOB BUTTON ACCOUNTING BURSARY tory performance Tenable at: University of the North West University of the Witwatersrand Field of study: Accounting Eligibility: Awarded on the basis of financial need and Private Bag 3 Value: Tuition fees and books academic merit to undergraduate and postgraduate WITS 2050 Duration: 1 year, renewable students who are citizens of Bophuthatswana Tenable at: University of Natal Service contract: Bursars should sign a contract to BRITISH AWARD SCHEME Eligibility: Full-time students studying towards the serve the Bophuthatswana government for the period Field of study: Commerce, Education with at least one B.Com. and Dip.Accounting with the ultimate for which the bursary was offered major in English, Mathematics, Science or Economics objective of qualifying as chartered accountants Closing date: 30 November or B.A. in Primary Education; Engineering/Building Service contract: Students have to serve training Further information: Science; Medicine: Science contract with Deloitte & Touche, Durban, on comple- The Secretary Value: Tuition and residence fees plus an allowance tion of their studies Bophuthatswana Mpudulole for books, travelling and subsistence Closing date: 30 August Bursary Aid Fund Duration: 1 year, renewable for the duration of the Further information: Private Bag X2065 course subject to continued financial need and The Staff Partner MMABATHO 8681 satisfactory academic performance PO Box 243 Information not confirmed Tenable at: University of the Witwatersrand DURBAN 4000 Eligibility: Awarded on the basis of financial need and Information not confirmed BOPHUTHATSWANA TRANSPORT HOLDINGS academic performance to black South Africans (BTH) BURSARY Service contract: None BODO KOCH BOOK BURSARY Field of study: B.Com. (Transport Economics) Closing date: 30 September Field of study: Medicine Value: RS 000 Further information: Value: R700 p.a. Duration: 1 year The Senior Assistant Registrar Duration: 1 year, renewable for a further 2 years Tenable at: Rand Afrikaans University Financial Aid and Scholarships subject to continued financial need and satisfactory Eligibility: Undergraduate students. Preference will be University of the Witwatersrand academic performance given to Tswana students Private Bag 3 Tenable at: University of the Witwatersrand Service contract: None WITS 2050 Eligibility: Awarded on the basis of financial need and Closing date: 15 November academic performance Further information: BRONWEN WALKER BURSARY Service contract: None The Secretary Field of study: Dramatic Art Closing date: 30 September Dept Transport Economics Value: R400 Further information: RAU Duration: 1 year, renewable The Senior Assistant Registrar PO Box 524 Tenable at: University of the Witwatersrand Financial Aid and Scholarships AUCKLANDPARK 2006 Eligibility: Awarded on the basis of financial need and University of the Witwatersrand academic performance to second-year students Private Bag 3 BORDER COUNCIL BURSARY SCHEME Service contract: None WITS 2050 Field of study: Contact the Technikon Closing date: 30 September Further information: BOKOMO BURSARY Value: Tuition and residence fees Duration: 1 year The Senior Assistant Registrar Field of study Home Economics Tenable at: Border Technikon Financial Aid and Scholarships Value: R1 500 Eligibility. Awarded on the basis of merit to under- University of the Witwatersrand Duration: 1 year graduate full-time and unemployed part-time Private Bag 3 Tenable at: University of Stellenbosch students WITS 2050 Eligibility. A final-year student who attained above- Service contract: None average results in all the Food and Nutrition courses Closing date: Contact the Technikon BRUNEL BURSARY Service contract: None Further information: Field of study: Pharmacy Closing date: 15 January The Bursary Officer Value: R2 000 Further information: Border Technikon Duration: 1 year The Head Private Bag 1421 Tenable at: Potchefstroom University for CHE Dept of Home Economics EAST LONDON 5200 Eligibility: Awarded to a B.Pharm-student in the third University of Stellenbosch year on the basis of financial need and academic Private Bag X1 BPP (BEPERKTE PRIVAATPRAKTYK) STUDIE- achievement MATIELAND 7602 BEURS Service contract: None Closing date: 15 October BONA MAGAZINE BURSARY Field of study: Medicine Value: Amount varies Further information: Field of study: B.Sc. majoring in Mathematics and any Duration: 1 year The Director: Student Finance other Science subject Tenable at: University of the OFS Potchefstroom University for CHE Value: R2 000 each p.a. Eligibility: Students in the Faculty of Medicine POTCHEFSTROOM 2520 Duration: I year, renewable for a maximum of 3 Closing date: 30 September years if progress is satisfactory Rs orcnriPS 181 BURSARY FUND FOR THEOLOGICAL STUDENTS Duration: 1 year, renewable Private Bag 3 Field of study: Diploma in Theology, B.Th., B.Th. Tenable at University of the OFS WITS 2050 (Hons.), B.D., M.Th., D.Th.. If funds are sufficient, Eligibility. Awarded to male students bursaries may also be allocated for theological Closing date: 30 November CALTEX CORPORATE BURSARY Further information: subjects taken as part of a BA. degree Field of study. Chemical, Mechanical & Civil Engi- Deputy Director Value: Amount varies neering, Commerce & Accounting, Computer Science, Student Financial Assistance Duration: 1 year, renewable on success and availabil- Business, Economics & Commerce UOFS ity of funds Value: University. R18 000; technikon: R10 000 (plus PO Box 339 Tenable at: University of South Africa performance bonus for engineering students) Eligibility. Theological students who earn below a BLOEMFONTEIN 9300 Duration: 1 year certain income, are not older than 50 years of age Tenable at Any tertiary institution in South Africa C.P. DE LEEUW BURSARY and who have obtained an aggregate of 55% in the Eligibility. Undergraduate or diploma students. previous examination Field of study. Quantity Surveying Preference given to second-year students Service contract None Value: R2 500 p.a. for the first three years of study Service contract Is required Closing date: None and RI 500 p.a. for the fourth and fifth years of study Closing date: Contact the institution concerned Further information: Duration: 5 years Further information: The Registrar (Academic) Tenable at: University of Pretoria Contact the bursary office of the institution concerned UNISA Eligibility Full-time undergraduate students from the Information not confirmed PO Box 392 first year of study PRETORIA 0003 Service contract: Must work with the sponsors for the CALTEX OIL (SA) BURSARY third to fifth years of study and on completion of Field of study Banking, Cost and Management BURSARY SCHEME FOR PERSONS WITH DIS- studies six months' service for each RI 500 received Accounting, Financial Information Systems, Informa- ABILITIES Closing date: 30 November tion Technology, Internal Auditing, Chemical Further information: Field of study. The course chosen must be career- Engineering, Civil Engineering, Mechanical Engineer- C.P. de Leeuw and Partners (Pta) orientated ing, Retail Business Management, Commercial PO Box 12286 Value: Adapted to meet the needs of the student Education HATFIELD 0028 Duration: Duration of the course Value: R5 000 Tenable at Any university, technikon or college Information not confirmed Tenable at Any Technikon Eligibility. An applicant who wishes to be considered Eligibility. Awarded on the basis of financial need and CALLIE HUMAN GYMNASTIC BURSARIES for a bursary must be a person with a disability for academic performance to second- and third-year whom training could solve the problem of finding Field of study. Human Movement Science students suitable employment and who has insufficient funds Value:.R2 000 for one or more bursaries Service contract One year service for each year for for studying; be older than 16 years; not qualify for Duration: 1 year which the bursary was redeved extraordinary education as defined in the Educational Tenable at: University of the OFS Closing date: 31 July for completed forms Services Act of 1967; reside in SA when applying for Eligibility. Awarded on the basis of financial need to Further information: the bursary and be a SA citizen undergraduate students who are active members of Bursaries Office Service contract None the Callie Human Gymnastics Club Caltex Oil (SA) Closing date: 30 June Service contract None PO Box 714 Further information: Closing date: 15 December CAPE TOWN 8000 The Director-General Further information: Information not confirmed Careers Services Deputy Director Department of Labour Student Financial Assistance CAPE CHAMBER OF COMMERCE Private Bag X117 PO Box 339 Field of study. Commerce PRETORIA 0001 BLOEMFONTEIN 9300 Value: Amount varies Duration: 1 year BUTTERWORTHS BURSARY CALTEX BURSARY Tenable at University of the Western Cape Field of study. Economic and Management Sciences Field of study. Commerce Eligibility. Awarded on the basis of financial need and Value: R3 000 Value: Amount varies academic achievement to second- and third-year Duration: 1 year, renewable Duration: 1 year students Tenable at University of Stellenbosch Tenable at University of the Western Cape Service contract None Eligibility. Awarded on the basis of financial need and Eligibility. Awarded on the basis of financial need and Closing date: 31 October of the previous year merit to students as from the second year of study academic achievement to full-time undergraduate Further information: Closing date: 28 February students The Registrar Further information: Service contract: None University of the Western Cape The Registrar (Bursaries and Loans) Closing date: New first-year students: 1 March. Private Bag X17 University of Stellenbosch Current (Senior) students: 31 October of the previous BELLVILLE 7535 Private Bag X1 year MATIELAND 7602 Further information: CAPE OF GOOD HOPE BANK BURSARY The Registrar Field of study. B.Com. or B.Econ. with Economics as C.H.E. BURSARY University of the Western Cape subject Field of study. Theology Private Bag X17 Value: Amount varies Value: Amount varies BELLVILLE 7535 Duration: 1 year Duration: 1 year Tenable at University of Stellenbosch Tenable at: Potchefstroom University for CHE CALTEX BURSARY FUND Eligibility Awarded on the basis of financial need and Eligibility. Theology students from the Reformed Field of study. Commerce, Computer Science, academic achievement to full-time undergraduate Church Engineering, Mathematics, Science students who are SA citizens Service contract: None Value: R5 000 Service contract None Closing date: 15 October Duration: 1 year Closing date: 15 January Further information: Tenable at: University of the Witwatersrand Further information: The Registrar Eligibility Awarded on the basis of financial need and The Registrar (Bursaries and Loans) School for Theology academic performance to full-time students University of Stellenbosch PU for CHE Service contract None Private Bag X1 POTCHU-S i ROOM 2520 Closing date: 30 September MATIE1AND 7602 Further information: C.J. LATEGAN AND PARTNERS LOAN FUND The Senior Assistant Registrar CAPE OF GOOD HOPE BANK BURSARY Field of study Medical Financial Aid and Scholarships Field of study. Commerce Value: R3 000 p.a. University of the Witwatersrand Value: Amount varies 182 197 Bursaries Eligibility: Students living or studying in the archdio- Duration: 1 year Information not confirmed cese of Cape Town and the diocese of Port Elizabeth Tenable at: University of the Western Cape only Eligibility: Awarded on the basis of financial need and CAR MAGAZINE BURSARY Service contract: None academic achievement to full-time undergraduate Field of study: Journalism Closing date: Last Friday in November. Application students Value: Up to RS 000 forms available from the office from mid-August. No Service contract: None Duration: 1 year local forms are posted Closing date: New first-year students: 1 March. Tenable at: University of Stellenbosch Further information: Current (Senior) students: 31 October of the previous Eligibility. Awarded on the basis of academic The Director year achievement and a personal interview to a student Catholic Educational Aid Programme Further information: who has already been accepted by the Dept of 23 Birdwood Street The Registrar Journalism ATFILONE 7764 University of the Western Cape Service contract: None Private Bag X17 Closing date: 31 December CECIL-LYONS TRUST SCHOLARSHIP BELLVILLE 7535 Further information: Ramsay Son & Parker (Pty) Ltd Field of study: Jewish communal service or research in CAPE TOWN CITY BURSARY LOAN SCHEME PO Box 180 the history and sociology of the South African Jewish Field of study: B.Bibl. (4-year course in Library and HOWARD PLACE 7450 community Value: Amount varies Information Science); B.Sc. (Engineering): Civil Information not confirmed (Transportation Engineering emphasis), Electrical Duration: 1 year, renewable Tenable at: Any university in South Africa (Heavy Current): B.Sc. (Computer Science); B.Sc. CARLETONVILLE TOWN COUNCIL STUDY LOAN Eligibility: Persons who wish to qualify for careers in (Quantity Surveying) (from 2nd year); Town and Field of study: Any field of study applicable to Local the Jewish communial service or undertake research Regional Planning; Land Surveying; Commerce; Government into the Jewish history and faith problems in SA Economics; Architecture; Postgraduate Diploma in Value: Approximately R3 000 p.a. Service contract: None Traffic Engineering or Postgraduate Diploma in Duration: Duration of the course Closing date: 15 January Library Science Tenable at: Any tertiary institution Further information: Value: Registration and tuition fees plus an annual Eligibility. Residents and pupils of Carletonville The Secretary allowance of R3 800 for additional expenses, books, Service contract: Is required (Not an employent Cecil-Lyons Trust instruments, travel and accommodation contract) PO Box 87557 Duration: Duration of the course if progress is Closing date: Last Friday in October each year HOUGHTON 2041 satisfactory Further information: Tenable at: Any South African university or technikon The Chief Executive/Town Clerk CENTRAL COUNCIL OF LAND SURVEYORS Eligibility: Current matrics who are about to com- Transitional Local Council of Carletonville BURSARY (CCLS) mence full-time study at a university or technikon or PO Box 3 full-time postgraduate students CARLETONVILLE 2499 Field of study: Land Surveying Service contract: One year service for each year for Value: Tuition fees + R500 which the bursary was awarded CARTER ACCOUNTING BURSARY Duration: 1 year, renewable up to 4 years maximum Closing date: 28 August Tenable at: Any university or technikon offering a Field of study: Chartered Accounting Further information: course in surveying Value: R2 000 Director of Human Resources Eligibility: SA undergraduate students and diploma Duration: 1 year students in any year of study City of Cape Town Tenable at Any university in the Western Cape Service contract: None PC) Box 298 Eligibility. Awarded on the basis of academic ability Closing date: 31 December CAPE TOWN 8000 and proven financial need to students from the Information not confirmed Further information: second year onwards, studying for a degree leading The Registrar to CA (SA) CAPE TOWN HEBREW CONGREGATION BUR- PLATO Service contract: None SARY P 0 Box 62041 Closing date: 30 November MARSHALLTOWN 2107 Field of study. Jewish Studies, Teaching Further information: Information not confirmed Value: Amount varies The Staff Partner Duration: 1 year Ernst & Young CENTURION TOWN COUNCIL BURSARY Tenable at University of Cape Town PO Box 656 Eligibility: Undergraduate SA Jewish students CAPE TOWN 8000 Field of study. Any local government field of study Service contract: None Information not confirmed Value: Tuition fees Closing date: 15 January Duration: Duration of the course Further information: CAS' EDEN TRUST BURSARY Tenable at: Any tertiary institution Eligibility: Study loans and bursaries are ONLY The Secretary Field of study: B.Com. (Accounting) and B.Com. Cape Town Hebrew Congregation granted to Council Employees (Hons.) (Accounting) 84 Hatfield Street Service contract: Is required Value: Amount varies CAPE TOWN 8001 Closing date: 30 September Duration: 1 year, renewable Information not confirmed Further information: Tenable at: Selected universities in South Africa The Head Eligibility: Undergraduate and postgraduate students CAPITAL RADIO/RHODES MUSIC RADIO Managerial Services who are potential chartered accountants only Town Council of Centurion BURSARY Service contract: Is required PO Box 14013 Field of study. Journalism Closing date: 30 June CENTURION 0140 Value: Amount varies Further information: Information not confirmed Duration: 1 year, renewable The Executive Director Tenable at: Rhodes University CAs' Eden Trust CHAPPIE BLACK TRUST BURSARY Eligibility: Awarded on the basis of academic PO Box 59875 achievement and financial need to third or fourth- KENGRAY 2100 Field of study. Dentistry year students only Value: Amount varies Service contract: Two weeks of in-house training with CATHOLIC EDUCATIONAL AID PROGRAMME Duration: 1 year, renewable on satisfactory results Capital Radio BURSARY Tenable at: Any university in South Africa Eligibility: Undergraduate students whose parents Closing date: 1 December Field of study. Any field of study with a focus on reside in the Port Elizabeth district only Further information: Natural Science and Technical studies The Bursaries Officer Service contract: None Value: Amount varies Closing date: 30 November Rhodes University Duration: 1 year Further information: PO Box 94 Tenable at: Tertiary institutions GRAHAMSTOVVN 6140 The Trustees 198 Bursaries 183 The Chappie Black Trust Tenable at Universities of Cape Town, Durban- PO Box 206 Westville, Orange Free State, Port Elizabeth, Natal, CIBA BURSARY CAPE TOWN 8000 Pretoria, Rhodes, Western Cape, Witwatersrand, Field of study. Botany with one of the following Stellenbosch, Potchefstroom University, University of subjects: Agronomy, Entomology, Horticulture, Plant CHARL ERASMUS BURSARY South Africa and the Rand Afrikaans University Pathology Field of study Theology Eligibility. The award is based on academic merit, Value: Amount vanes Value: Determined annually cultural, sports and leadership achievement Duration: 1 year, renewable Duration: 1 year Service contract: Must serve articles of clerkship with Tenable at University of Stellenbosch Tenable at: Potchefstroom University for CHE the firm for three years Eligibility Awarded to students from historically Eligibility. Undergraduate and postgraduate theology Closing date: 31 August disadvantaged communities as from the second year students of the Reformed Church Further information: of study Service contract: None The Human Resources Manager Closing date: 28 February Closing date: 15 October Coopers & Lybrand Further information: Further information: PO Box 2536 The Registrar (Bursaries and Loans) The Director (Bursaries and Loans) JOHANNESBURG 2000 University of Stellenbosch PU for CHE Private Bag Xl Private Bag X6001 CHILDREN'S FOUNDATION BURSARY MATELAND 7602 POTCHEFSTROOM 2520 Field of study. Social Work Value: R860 R4 680 p.a. CIBA BURSARY CHARLES HURWITZ BURSARY Duration: 1 year, renewable Field of study Agronomy Field of study: Medicine Tenable at: Rand Afrikaans University Value: R4 000 Value: At the discretion of the University Eligibility: Awarded to full-time students intending to Duration: 1 year, renewable Duration: 1 year, renewable do Social Work among children Tenable at: University of Stellenbosch Tenable at University of the Witwatersrand Service contract. None Eligibility. Undergraduate students Eligibility. Awarded on the basis of financial need and Closing date: 15 November Service contract None academic performance to black SA citizens Further information: Closing date: I 5January Service contract: None The Registrar (Finance) Further information: Closing date: 30 September Rand Afrikaans The Head Further information: University Dept Agronomy & Pasture Science The Senior Assistant Registrar PO Box 524 University of Stellenbosch Financial Aid and Scholarships AUCKLAND PARK 2006 Private Bag X1 University of the Witwatersrand MAT1ELAND 7602 Private Bag 3 CHRIS SNUMAN LOAN WITS 2050 Field of study Dentistry CLIFFORD-GLOSSOP BURSARY Value: Amount varies Field of study. Forestry CHARLES PELTERET EDUCATIONAL TRUST Duration: 1 year, renewable Value: Approximately R750 Field of study. Mathematics, Physics, Medicine and Tenable at: University of Pretoria Duration: 3 years related subjects Eligibility. Awarded on the basis of achievement and Tenable at University of Stellenbosch Value: Amount varies financial need to full-time undergraduate students Eligibility A Natal matriculant who is in his second Duration: 1 year, renewable on reapplication from their second year of study onwards year of study Tenable at: University of Stellenbosch Service contract None Service contract: None Eligibility. Awarded on the basis of merit Closing date: 15 October Closing date: 15 January (30 November for matricu- Service contract. None Further information: lants) Closing date: 15 January The Head: Study Financing Further information: Further information: University of Pretoria The Dean: Faculty of Forestry The Registrar: Bursaries and Loans PRETORIA 0002 University of Stellenbosch University of Stellenbosch Private Bag Xl Private Bag Xl CHRISTMAS STUDY BURSARY MAT1ELAND 7602 MAT1ELAND 7602 Field of study Music Value: Determined annually CLOVER BURSARY CHARTERED ACCOUNTANTS BURSARIES Duration: 1 year Field of study. Commerce Field of study. B.Com. (Accounting), B.Accounting., Tenable at University of Pretoria Value: R800 B.Compt., B.Compt. (Hons.), B.Business Science Eligibility. Awarded to full -time undergraduate Duration: 1 year towards a CA qualification, Certificate in the Theory of students commanding musical inspiration and Tenable at: Potchefstroom University for CHE Accounting or equivalent technical skill. The candidate must also submit three Eligibility. Award on the basis of financial need and Value: Tuition fees and/or residence fees and/or certified compositions, one of which must be a academic achievement book allowance Christmas Carol Service contract. None Duration: Duration of the course Service contract None Closing date: 15 October Tenable at: Universities within South Africa Closing date: 15 October Further information: Eligibility. Prospective first-year students and Further information: The Director. Financial Assistance postgraduate students The Head: Study Finance Potchefstroom University for CHE Service contract Candidate to sign a training contract University of Pretoria POTCHEFSTROOM 2520 with bursar's practice office after completion of full- PRETORIA 0002 time studies CLOVER SA BURSARY SCHEME CIBA BURSARY Closing date: 31 September Field of study. Universities: B.Com. (Accounting, Further information: Field of study Medicine Marketing and Computer Science), BSc. (Food The HR Manager Value: Tuition fees Technology or Microbiology), B.Sc. (Mechanical, Deloitte and Touche Duration: 1 year Industrial or Chemical Engineering), B.Com. Private Bag X6 Tenable at University of Stellenbosch (Transport Economics). Technikons: National Diploma GALLO MANOR 2052 Eligibility. Awarded to students in any year of study in Food Technology, Marketing, Mechanical or Closing date: 31 January Industrial Engineering CHARTERED ACCOUNTANTS' BURSARY Further information: Value: Universities RI 8 000 and technikons R13 500 Field of study. Commerce, Accounting The Bursary Officer Duration: Duration of the course if progress is Value: Amount varies Ciba (Pty) Ltd satisfactory Duration: Renewable annually if progress and PO Box 92 Tenable at Any university or technikon with applica- conduct are satisfactory ISANDO 1600 ble subjects Information not confirmed 199 184 Bursaries Eligibility: Awarded on the basis of merit to under- Further information: Eligibility: Awarded on the basis of above average graduate students The Computer Society of SA academic merit to SA students in any year of study, Service contract: One year service for each year for Natal Chapter including students studying for an Honours degree which the bursary was awarded. Bursary holders are PO Box 74 Service contract: Six months service contract for every required to work at Clover SA for at least one month a DURBAN 4000 year for which the bursary was received year during vacations Closing date: 31 August Closing date: 30 June CONCOR CONSTRUCTION BURSARY Further information: Manager Further information: Field of study: Civil Engineering, Building Science, Human Resources The Manager Quantity Surveying Private Bag X3015 Human Resources Planning Value: Approximate tuition and book fees RANDBURG 2125 Clover SA Duration: From second year up to graduation Information not confirmed PO Box 750 Tenable at: Any university in South Africa HEILBRON 9650 Eligibility: First-year students COUNCIL UNIVERSITY BURSARY Service contract: Is required COLIN GOHL SCHOLARSHIP FUND Closing date: 30 September Field of study: Land Surveying Field of study: Horticulture, Parks and Recreation Further information: Value: Normally tuition fees Management, Nature Conservation or Forestry The Human Resources Manager Duration: 1 year Value: University of Stellenbosch: RI 400 p.a.: Concor Construction Tenable at: University of Natal or Cape Town technikons: RI 300 p.a. PO Box 8259 Eligibility: First-year students who are members or Duration: 1 year, renewable JOHANNESBURG 2000 sons of armed forces of Zimbabwe or SA or sons of Tenable at: Cape Technikon, Peninsula Technikon Land Surveyors and the University of Stellenbosch CONSANI BURSARY Service contract: Must register with the Council within four years of completion of studies Eligibility: SA citizens Field of study: Engineering Closing date: 30 December Service contract: None Value: R1 000 p.a. Further information: Closing date: 31 December Duration: Duration of the course The Registrar Further information: Tenable at: University of Stellenbosch SA Council for Land Surveyors The Honorary Secretary Eligibility: Undergraduate students and Technical Surveyors Colin Gohl Fund Service contract: None PO Box 62041 c/o Rachel Swart-fonds Closing date: 15 January MARSHALLTOWN 2107 71 Klipfontein Road Further information: Information not confirmed RONDEBOSCH 7700 The Registrar: Bursaries and Loans University of Stellenbosch CRADOCK'S AFRIKAANS LANGUAGE FESTIVAL COLUMBUS STAINLESS STEEL BURSARY Private Bag XI BURSARY Field of study: Metallurgical, Mechanical, Electrical, MATIELAND 7602 Industrial and Chemical Engineering Field of study: Afrikaans Value: Full Bursary Registration, tuition, accommoda- COOPERS AND LYBRAND BURSARY Value: Determined annually Duration: 1 year tion and meal fees plus a cash allowance. Partial Field of study: Prescribed studies for Chartered Tenable at: Any university Bursary: Registration and tuition fees Accountant Eligibility: A student who matriculated at a high Duration: 1 year, renewable if progress is satisfactory Value: Determined annually school in Cradock and who is taking a third-year Tenable at: Any university Duration: Duration of the course degree course in Afrikaans Eligibility: Awarded on the basis of academic merit Tenable at: Any acknowledged university Service contract: None Service contract: One year service for each year for Eligibility: Full-time students Closing date: 28 February which the bursary was received Service contract: Must complete training contract at Further information: Closing date: End of May each year the Pretoria office The Principal Further information: Closing date: 31 August Cradock High School Ms S Harley Further information: PO Box 253 PO Box 133 The Human Resources Partner CRADOCK 5880 MIDDELBURG 1050 PO Box 1093 PRETORIA 0001 COMMITTEE OF UNIVERSITY PRINCIPALS CSIR BURSARY Field of study: Pre-graduate course in Law (excluding CORNELIUS AND LEA GROBLER THEOLOGICAL Field of study. Information Technology; Food Technology; Metallurgy; Analytical Chemistry; LLB.) FUND Electrical, Chemical, Mechanical, and Civil Engineering Value: R800 Field of study: Theology Value: Tuition and residence fees plus a book Duration: 1 year Value: Determined by donor allowance Tenable at: Any university in South Africa Duration: Duration of the course Duration: Duration of studies subject to satisfactory Eligibility: Awarded on the basis of financial need and Tenable at: University of Pretoria progress academic merit to students registered for a pre- Eligibility: Coloured Theological students of the Tenable at: Any technikon graduate course in Law Nederduitsch Hervormde Kerk van Afrika Eligibility: Matriculants and students who are SA Service contract: None Service contract: Determined by donor citizens and who obtain above average marks for Closing date: 31 January Closing date: None Mathematics and Physical Science Further information: Further information: Service contract: One year service for each year for The Chief Director Die Skriba which the bursary was granted CUP Kuratorium vir Teologiese Opleiding Closing date: 31 July P 0 Box 27392 PO Box 2368 Further information: SUNNYSIDE 0132 PRETORIA 0001 Technikon Bursaries Information not confirmed COMPUTER SOCIETY OF SA BURSARY CSIR PO Box 395 COUNCIL FOR MINERAL TECHNOLOGY UN- Field of study: Computer Data Processing, Computer PRETORIA 0001 Science, Business Information Systems DERGRADUATE BURSARY Value: RI 000 to R3 000 Field of study: Engineering: Chemical, Electrical (Light CSIR BURSARY (UNIVERSITY STUDY) Duration: 1 year Current) and Materials; Natural Science: Chemistry, Field of study: Engineering: Chemical, Civil, Electrical, Tenable at: Technikon Natal, University of Natal, Geology and Physics Electronic, Industrial, Mechanical, Mining or Metallur- University of Durban-Westville and M.L. Sultan Value: Tuition and residence fees plus a book gical: Natural Science: Applied Mathematics, Botany, Technikon allowance Chemistry, Computer Science, Mathematics, Physics, Eligibility: Matriculants and students Duration: 1 year, renewable up to 4 years maximum Geology, Forestry Service contract: None Tenable at: University of Cape Town, Peninsula Closing date: 31 December Technikon 2p Bursaries 185 Value: Tuition and residence fees, an allowance for MOWBRAY 7700 Further information: books (revised annually), member of CSIR medical The Financial Aid Office and pension fund and salary paid for vacation work D.N.G. KOTZE BURSARY FOR THEOLOGY Rhodes University Duration: Duration of studies subject to satisfactory Field of study. Theology PO Box 94 progress Value: Amount varies GRAHAMSTOWN 6140 Tenable at Any university in South Africa Duration: 1 year Information not confirmed Eligibility Awarded on the basis of a panel interview Tenable at: Potchefstroom University for CHE or selection test to matriculants and undergraduate Eligibility Undergraduate students who are members DAAN MARAIS BURSARY students who are SA citizens resident in the RSA for 3 of the Reformed Church Field of study. TheologyDivision B (Dutch Reformed years and who achieve above average marks Service contract: None Church) Service contract Service contract for a minimum Closing date: 15 October Value: RI 000 p.a. period equal to that for which the bursary was Further information: Duration: Duration of the course if progress is received The Director (Bursaries and Loans) satisfactory Closing date: 31 July PU for CHE Tenable at: University of Pretoria Further information: Private Bag X6001 Eligibility. Full-time Theology students of the Dutch CSIR Bursary POTCHEFSTROOM 2520 Reformed Church PO Box 395 Closing date: 31 October PRETORIA 0001 D.P. PONGRACZ SCHOLARSHIP TRUST Further information: The Church Administrator CYANAMID BURSARY SCHEME Field of study. Viticulture and Oenology Value: Amount varies NG Gemeente Kameeldrift Field of study. Chemical Engineering, Mechanical Duration: 1 year, renewable PO Box 15185 Engineering, Metallurgy Tenable at University of Stellenbosch LYNN EAST 0039 Value: R1 000 Eligibility. Awarded on the basis of academic Duration: 1 year achievement to undergraduate and postgraduate DANIE SWANEPOEL BURSARY Tenable at. University of the Witwatersrand students Field of study Forestry, Economic and Management Eligibility: Awarded on the basis of financial need and Closing date: 15 January Sciences, Agricultural Sciences academic performance to first year black, coloured or Further information: Value: R600 Indian students, preferably residing in the Transvaal The Registrar (Bursaries and Loans) Duration: 1 year, renewable Service contract None University of Stellenbosch Tenable at University of Stellenbosch Closing date: 30 September Private Bag X1 Eligibility. Awarded on the basis of financial need to Further information: MAT1ELAND 7602 an undergraduate student with strong character and The Senior Assistant Registrar leadership qualities Financial Aid and Scholarships D.R. MCINTOSH TRUST Service contract None University of the Witwatersrand Closing date: 15 January Private Bag 3 Field of study. Medicine Further information: WITS 2050 Value: Amount varies Duration: 1 year, renewable for the duration of the The Registrar. Bursaries and Loans University of Stellenbosch D.G. MURRAY TRUST BURSARY FUND (EASTERN course Private Bag X1 CAPE) Tenable at Any medical university in South Africa Eligibility Awarded to undergraduate student of MAT1ELAND 7602 Field of study. Must major in Mathematics/Physics; British descent. Preference given to physically Engineering; Technical Field disabled males DAVID KIBBEY TAYLOR MEMORIAL BURSARY Value: Amount varies. Usually half of the tuition fees Service contract None Field of study. Natural Sciences Duration: 1 year, renewable on application for Closing date: 15 December Value: Amount varies duration of the course Further information: Duration: 1 year, renewal considered on reapplication Tenable at Any university, technikon, teacher's The Trustees Tenable at Rhodes University training or technical college in the Eastern Cape DR McIntosh Trust Eligibility. Awarded on the basis of financial need and Eligibility Awarded on the basis of financial need to PO Box 206 academic ability to students who intend to major in residents of the Eastem Cape. Must attend an CAPE TOWN 8000 physics, with or without electronics Academic Support Programme during the first year of Service contract: None study if available. Must major in Mathematics or D.R. MEIRING MEMORIAL BURSARY Closing date: 15 November Science. Students desiring to study at a technikon or Further information: university must have obtained a minimum D Field of study. Medicine The Head aggregate Value: Amount varies Department of Physics & Electronics Service contract None Duration: 1 year, renewable. Rhodes University Closing date: 31 October Tenable at: University of Stellenbosch PO Box 94 Further information: Eligibility. Awarded on the basis of financial need to GRAHAMSTOWN 6140 The Bursaries Administrator students as from their third year of study Information not confirmed D G Murray Trust Bursary Fund Service contract None PO Box 126 Closing date: 15 January DAVID MORRISON BURSARY GRAHAMSTOWN 6140 Further information: The Registrar. Bursaries and Loans Field of study. Dentistry D.G. MURRAY TRUST BURSARY FUND University of Stellenbosch Value: Approximately R350 (WESTERN CAPE) Private Bag X1 Duration: 1 year only MAT1ELAND 7602 Tenable at: University of the Witwatersrand Field of study. Science: Mathematics/Physics Eligibility. Awarded on the basis of financial need and (Teaching); Engineering DAAD UNDERGRADUATE BURSARIES (GERMAN academic performance to students entering the Value: Variable ACADEMIC EXCHANGE SERVICE) fourth year of study Duration: 1 year, renewable on application for Service contract None duration of the course Field of study German Closing date: 30 September Tenable at Any university or technikon in South Africa Value: Amount varies Further information: Eligibility. SA residents of the Western Cape only who Duration: 4 years, renewable upon satisfactory The Senior Assistant Registrar are entering a tertiary institution for the first time progress Financial Aid and Scholarships Service contract None Tenable at: Rhodes University University of the Witwatersrand Closing date: 31 October Eligibility. Awarded to educationally disadvantaged SA Private Bag 3 Further information: first-year students who wish to major in German as a WITS 2050 The Secretary foreign language. No previous knowledge of German SAIRR is required 5 Long Street Service contract: None Closing date: 1 December 186 2401 Bursaries DE BEERS GROUP VOCATIONAL SCHOLARSHIP POTCHEFSTROOM 2520 Eligibility: Loan is awarded on the basis of financial need to third-, fourth- or fifth-year students Field of study. Engineering: Chemical (Mineral DELOITTE AND TOUCHE BURSARY Closing date: 28 February Processing), Electrical (Heavy Current), Mechanical, Further information: Mining; Geology; Metallurgy Field of study. B.Com. (Accounting) The Dean Value: Tuition and residence fees plus approximately Value: R5 000 p.a. Faculty of Dentistry R4 000 Duration: Renewable if progress is satisfactory Private Bag X1 Duration: 1 year, renewable for duration of the course Tenable at: Any university TYGERBERG 7505 Tenable at: Any South African university Eligibility: Full-time undergraduate and postgraduate Eligibility: Citizen or permanent resident of SA students DENYS S. WAUGH BURSARY Service contract: 2 years service contract and Service contract: Serve articles of clerkship with the compulsory vacation training every December firm Field of study: Production Engineering Closing date: 30 June Closing date: 31 August Value: Tuition and residence fees up to R3 500 p.a. Further information: Further information: for a B.Sc. (Engineering) course at a university and R2 The Scholarship & Bursary Unit Human Resources Manager 500 p.a. for a diploma course at a technikon PO Box 61S87 Deloitte & Touche Duration: Duration of the course MARSHALLTOWN 2107 PO Box 11007 Tenable at: Any tertiary institution Information not confirmed HATFIELD 0028 Eligibility: Students who have passed their first year of study and who are SA citizens DE BEERS INDUSTRIAL DIAMOND DIVISION DELOITTE AND TOUCHE BURSARY Service contract: Minimum of 3 years in South Africa in an engineering capacity (or refund the bursary) (PTY) LTD BURSARY (TECHNIKONS) Field of study: B.Com., B.Business Science (for study Closing date: 31 January Field of study Mechanical and Electrical Engineering towards a CA qualification) or the Postgraduate Further information: and Extractive Metallurgy Diploma in Accounting The Chairman Value: Tuition fees, residence fees and a general Value: Amount varies Johannesburg Branch Duration: Duration of the course allowance SA Air Force Association Duration: Renewable bi-annually Tenable at: All universities PO Box 2312 Tenable at: Most technikons Eligibility: Full-time undergraduate and postgraduate JOHANNESBURG 2000 Eligibility: Awarded on the basis of merit to matricu- students who are SA citizens for study towards a CA lants with an minimum Higher Grade C symbol and qualification DEPARTMENT OF CHEMICAL ENGINEERING current students doing Ti, T2 or T3 Service contract: Must sign a training contract with BURSARY LOAN SCHEME Service contract: Year for year service obligation after donor's principal office after qualification completion of diploma Closing date: 31 August Field of study Chemical Engineering (Mineral Closing date: 15 June Further information: Processing) Further information: Human ResourcesAudit Value: Amount varies according to need Bursary Secretary Deloitte & Touche Duration: Duration of the course De Beers Industrial Private Bag X6 Tenable at: University of Stellenbosch Diamond Division GALLO MANOR 2052 Eligibility: Awarded on the basis of merit and financial PO Box I 770 need to undergraduate students SOUTHDALE 2135 DELOITTE AND TOUCHE BURSARY AND Closing date: None SCHOLARSHIP SCHEME Further information: The Chairman: Dept Chemical Engineering DE BEERS INDUSTRIAL DIAMOND DIVISION Field of study: Chartered Accounting University of Stellenbosch (PTY) LTD BURSARY (UNIVERSITIES) Value: Tuition and residence fees and book costs Private Bag X1 Field of study. Chemical, Mechanical and Electrical Duration: 1 year, renewable MAT1ELAND 7602 (Light Current) Engineering; Physics; Metallurgy Tenable at: Any university (Physical Metallurgy, Extractive Metallurgy); Chemis- Eligibility. Black SA citizens who intend studying DEPARTMENT OF CORRECTIONAL SERVICES towards a Chartered Accountancy qualification try; Computer Science PUBLIC BURSARY SCHEME Value: Tuition and residence fees plus a generous Service contract: Training contract (3 years) plus six allowance towards the cost of books, subsistence and months service for every year sponsored at university Field of study: B.A. (Social Work), B.Com. (Information travel Closing date: 31 August Systems), B.Sc. (Computer Science), B.Pharm., M.A. Duration: 1 year, renewable for undergraduate study Further information: (Clinical Psychology) Tenable at: Most universities in South Africa Deloitte and Touché Value: R10 700 p.a. Eligibility: Awarded on the basis of exceptional PO Box 243 Duration: Minimum duration of the course academic achievement and financial need to male DURBAN 4000 Tenable at: Any university in South Africa and female matriculants and undergraduate as well Eligibility: Full-time undergraduate and postgraduate as postgraduate students DENEL INFOPLAN BURSARY students who are SA citizens Service contract: One year service for each year for Service contract: Vacation employment at least once a Field of study: Degree or Diploma in Information which the bursary was awarded year and year for year obligatory service after Technology Closing date: 31 August completion of the degree Value: Tuition, residence, books (prescribed) and Further information: Closing date: 15 June meals Personal Privileges Further information: Duration: 1 year Commissioner The Bursary Secretary Tenable at: Any technikon Correctional Services De Beers Indus Diamond Div (Pry) Ltd Eligibility Awarded on the basis of academic merit Private Bag X136 PO Box 916 and financial need to students who have successfully PRETORIA 0001 JOHANNESBURG 2000 completed their first year of study Information not confirmed Closing date: October/November DEANS BURSARY Further information: DEPARTMENT OF EDUCATION BURSARY Field of study. Pharmacy The Senior Admin Officer Value: Amount varies Denel Infoplan Bursaries Field of study: Teaching Duration: 1 year PO Box 25300 Value: Full tuition, residence and registration fees Tenable at: Potchefstroom University for CHE MONUMENT PARK 0105 Duration: I year, renewable Eligibility Award on the basis of financial need and Information not confirmed Tenable at: Any appropriate tertiary institution in academic achievement to undergraduate students as South Africa from their second year of study DENTAL ASSOCIATION OF SA LOAN Eligibility. Undergraduate students Service contract: Is required Service contract: None Field of study Dentistry Closing date: 31 October Closing date: 15 October Value: Amount varies Further information: Further information: Duration: 1 year, renewable The Secretary The Director: Financial Assistance Tenable at: University of Stellenbosch Potchefstroom University for CHE Dept of Education 2o2 Bursaries 187 Private Bag X2250 Duration: Minimum duration of the course if progress Eligibility. Students who have passed their first year of SIBASA 0970 is satisfactory study and who are SA citizens Information not confirmed Tenable at Any university or technikon in South Africa Service contract Minimum of 3 years in South Africa Eligibility. Scholarships: awarded solely on the basis of in an engineeing capacity (or refund the bursary) DEPARTMENT OF HEALTH BURSARY academic merit to applicants obtaining a first class Closing date: 31 January Further information: Field of study: Social Work pass in the matric examination with a certificate of The Chairman Value: Amount vanes merit. Full-time study bursaries: based on academic Johannesburg Branch Duration: 1 year performance, financial circumstances and the SA Air Force Association Tenable at: University of the Western Cape promotion of representivity in the staff complement PO Box 2312 Eligibility. Awarded on the basis of financial need and of the Department academic achievement to second- or third-year Service contract: One year service for each year for JOHANNESBURG 2000 which the bursary was received students DORBYL LIGHT AND GENERAL ENGINEERING Service contract: Is required Closing date: 31 August Closing date: 1 March Further information: Field of study. Mechanical or Industrial Engineering Attention: Bursary Officer Further information: Value: Tuition and residence fees plus a cash amount Dept of Water Affairs & Forestry The Registrar of R2 200 for books, etc. A merit award of R750 if University of the Western Cape Private Bag X313 promoted to consecutive year of study PRETORIA 0001 Private Bag Xl 7 Duration:1year, renewable if progress is satisfactory BELLVILLE 7535 Tenable at: Any university DEPARTMENT OF WELFARE AND POPULATION Eligibility Awarded on the basis of academic DEPARTMENT OF PUBLIC WORKS AND LAND DEVELOPMENT BURSARIES achievement to undergraduate students who are SA AFFAIRS BURSARY Field of study. Environmental Health citizens Service contract: One year service for each year for Field of study Architecture, Quantity Surveying, Value: R3 000 p.a. which the bursary was received. Vacation work is Personnel Administration, Personnel Management Tenable at: Cape Technikon Eligibility. National Diploma or B.Tech students required Value: Amount varies Closing date: 31 July Duration: 1 year, renewable for duration of the course Closing date: 31 October Further information: Tenable at: University of Port Elizabeth, Potchef- Further information: The Human Resources Director stroom University for CHE, University of Cape Town, The Associate Director School of Health Sciences Dorbyl Light & General Engineering Peninsula Technikon PO Box 1351 Eligibility. Full-time diploma and undergraduate Cape Technikon BEDFORDVIEW 2008 students in any year of study who are SA citizens PO Box 652 Service contract: One year service for each year for CAPE TOWN 8000 DORBYL LIGHT AND GENERAL ENGINEERING which the bursary was awarded DIOCESE OF MARIANNHILL NATIONAL (TECHNIKON) Closing date: 15 November CATHOLIC BURSARY AND SCHOLARSHIP FUND Further information: Field of study Mechanical or Industrial Engineering The Director General Field of study Commerce, Technical Field, Natural Value: Amount varies Dept of Public Works and Land Affairs Sciences, Agriculture and Education Tenable at Any technikon Private Bag X65 Value: Determined by sponsor Eligibility. Diploma students PRETORIA 0001 Duration: 1 year, renewable if previous year was Service contract: One year service for each year for Information not confirmed passed which the bursary was received Tenable at Any university, technikon or college of Closing date: 31 July DEPARTMENT OF TRADE AND INDUSTRY education in South Africa Further information: BURSARY Eligibility Undergraduate students from the diocese The Human Resources Director of Mariannhill Dorbyl Light & General Engineering Field of study. Economics, Business Economics, PO Box 1351 Accounting, Marketing, Cost Accounting, Commerce, Service contract. None Closing date: I SJanuary BEDFORDVIEW 2008 Natural Sciences, Engineering Further information: Value: Tuition fees DORFLING BURSARY Duration: Depends on the minimum duration of the The Secretary Diocese of Mariannhill course Field of study. Social Work Tenable at: Any university PO Box 1 1001 Value: Amount varies Eligibility. Undergraduate students MARIANNHILL 3601 Tenable at Potchefstroom University for CHE Service contract One year service for each year for Information not confirmed Eligibility: Undergraduate students which the bursary was received Service contract: None Closing date: 31 August DIPPENAAR BURSARY Closing date: 15 October Further information: Field of study. Economic and Management Sciences Further information: The Director-general Value: R7 500 The Director (Bursaries and Loans) Dept Trade and Industry Duration: Duration of the course (student must apply PU for CHE Private Bag X84 every year) Private Bag X6001 PRETORIA 0001 Tenable at: University of Stellenbosch POTCHEFSTROOM 2520 Eligibility. Awarded to a first- or second-year DEPARTMENT OF WATER AFFAIRS AND FOR- undergraduate student on the basis of merit and DORINDA KOK BURSARY ESTRY BURSARY / SCHOLARSHIP financial need Field of study. Speech Therapy, Audiology Service contract None Field of study. B.Sc. Engineering/B.Engineering Value: RI 000 p.a. Closing date: 15 January (Chemistry, Civil, ElectricalHeavy and Light Current, Duration: 1 year, renewable if progress is satisfactory Mechanical); B.Sc. (Hydrology); B.Sc. with Chemistry as Further information: Tenable at: University of Stellenbosch Mr LL Dippenaar major subject; B.Sc. (Forestry); B.Sc. (Exploration Eligibility Awarded on the basis of academic merit Geophysics); B.Sc. Degree: any of the following two PO Box 784500 and financial need to a first-year student who is a SA SANDTON 2146 subjects as majors: Biochemistry, Chemisty, Botany, citizen Computer Science, Geology, Mathematical Statistics, Closing date: 15 January DON TILLEY BURSARY Mathematics, Applied Mathematics, Microbiology, Further information: Physics, Water Environment Studies, Zoology. National Field of study Production Engineering The Registrar. Bursaries and Loans Diploma: Electrical Engineering (General and Light Value: Tuition and residence fees up to R3 500 p.a. University of Stellenbosch Current), Civil Engineering, Mechanical Engineering, for a B.Sc. (Engineering) course at a university and R2 Private Bag Xl Analytical Chemistry, Cartography, Surveying, Water 500 p.a. for a diploma course at a technikon MATIELAND 7602 Care, Forestry, Geotechnology Duration: Duration of the course Value: Tuition, residence, registration and meal fees Tenable at: Any tertiary institution DOROTHY ADELINE JOOSTE FUND plus an allowance for books Field of study. Law 188 203 Bursaries Value: Amount varies DR J.P. MEYER AND W.A. JOHNSEN BURSARY Further information: Duration: 1 year LOAN The Town Clerk/ Chief Executive Tenable at: Potchefstroom University for CHE Field of study. Medicine Private Bag 2024 Eligibility: Awarded on the basis of financial need and Value: Amount varies DUNDEE 3000 merit to undergraduate students Duration: Duration of the course Service contract: None Tenable at: University of Stellenbosch DUNVEGAN AND GLENDOWER RESIDENTS AND Closing date: 15 February Eligibility: Awarded on the basis of financial need and RATEPAYERS ASSOCIATION BURSARY Further information: merit to coloured or black, full-time undergraduate The Dean students Field of study: Local Government, Engineering, Social Faculty of Law Closing date: 15 January Work PU for CHE Further information: Value: R500 Private Bag X6001 The Assistant Registrar Duration: 1 year, renewable on reapplication POTCHEFSTROOM 2520 Tygerberg Campus Tenable at: Any university or technikon in South Africa PO Box 19063 Eligibility Awarded on the basis of academic merit to DOROTHY AND MENDEL SPITZ STUDY BUR- TYGERBERG 7505 second or third year students whose parents or SARY guardians are registered taxpayers or long-term Field of study: Medicine DR P.G. JANSEN BURSARY residents in the Edenvale areas of Dunvegan, Glendower, Dowergien and extensions Value: Amount varies Field of study: Dentistry Closing date: 31 March Duration: 1 year, renewable for 6 years if progress is Value: Amount varies Further information: satisfactory Tenable at: University of Stellenbosch Dunvegan & Glendower Residents and Tenable at: Any university in South Africa Eligibility: Awarded on the basis of financial need to Ratepayers Association Eligibility: Awarded on the basis of financial need and undergraduate students Bursary Committee merit to prospective students resident in the area of Service contract: None PO Box 238 the Eastern Transvaal Branch of MASA Closing date: 15 January EDENVALE 1610 Service contract: None Further information: Information not confirmed Closing date: 30 November The Registrar: Bursaries and Loans Further information: University of Stellenbosch DURBAN CITY COUNCIL LOANS The Honorary Secretary Private Bag X1 Eastern Transvaal Branch MAT1ELAND 7602 Field of study: Varies from year to year as service unit Medical Association of SA requirements are identified. B.Sc. (Electrical Engi- PO Box 1 149 DR ZUURDEEG MEMORIAL BURSARIES neering) (Heavy Current), B.Sc. (Civil Engineering), BOKSBURG 1460 B.Sc. (Chemical Technology) and M.Sc. (Town and Field of study: Medicine Regional Planning) are degree courses commonly Value: At the discretion of the University DPS BURSARY funded in terms of service unit needs in Durban Duration: 1 year, renewable for the duration of the Value: Tuition and examination fees: R9 030 in 1996: Field of study: Law course accommodation: RI 1 150 in 1996: books and Duration: 1 year Tenable at: University of the Witwatersrand equipment: RI 210 in 1996 Tenable at: Any university Eligibility: Awarded on the basis of financial need and Duration: Up to 4 years if progress is satisfactory Eligibility: Awarded to undergraduate students who academic performance to students entering the Tenable at: Any university approved by the Executive reside in the Vaal Triangle area second year of study. Preference to students of either Director of the service unit (usually at the University of Closing date: 28 February British or Dutch (Hollands) decent Natal) Further information: Service contract: None Eligibility: Preference for affirmative action candidates Du Plessis, Pienaar & Swart Inc Closing date: 30 September in line with the city council's employment practices Private Bag X035 Further information: policy. Annual advertisements will detail specific VANDERBIJLPARK 1900 The Senior Assistant Registrar requirements Information not confirmed Financial Aid and Scholarships Service contract: One year service for each year for University of the Witwatersrand which the loan was awarded subject to availability of DR AND MRS N. SIEBERHAGEN BURSARY Private Bag 3 work WITS 2050 Field of study: B.Theology Closing date: 30 November Value: RI 000 Further information: DUNCAN HUTCHEON BURSARY Duration: Duration of the course The Director Tenable at: University of Stellenbosch Field of study: Veterinary Science Corporate Human Resources Eligibility Awarded on the basis of financial need and Value: Determined annually P 0 Box 5892 merit to a first-year student Duration: 1 year DURBAN 4000 Service contract: None Tenable at: University of Pretoria Closing date: 15 January Eligibility: Awarded to full-time final-year students on DURBAN RADIOLOGICAL SERVICES EDUCA- Further information: the basis of achievement and financial need TIONAL TRUST BURSARY The Registrar: Bursaries and Loans preference given to students from the Cape Province. Field of study: Medicine University of Stellenbosch Awarded on the recommendation of the Faculty Value: R10 000 each Private Bag X1 Council of Veterinary Science Duration: 4 years, if progress is satisfactory MAT1ELAND 7602 Service contract: None Tenable at: Any university in SA Closing date: 15 October Eligibility: Awarded on the basis of financial need to DR J.J. VAN TONDER BURSARY (HISTORY Further information: medical students as from the third year of study. Only BURSARY FUND) The Head: Study Finance SA citizens and students with an address in Natal may University of Pretoria Field of study: History apply PRETORIA 0002 Value: R860 to R8 030 p2. Service contract: None Duration: 1 year, renewable Closing date: 31 October DUNDEE MUNICIPAL BURSARY Tenable at: Rand Afrikaans University Further information: Eligibility: Full-time undergraduate and postgraduate Field of study: As determined by the council Durban Radiological Services students with History as a major Value: Not less than R750 per student Educational Trust Service contract: None Duration: Once off amount PO Box 4812 Closing date:I 5 November Tenable at: Any approved institution DURBAN 4000 Further information: Eligibility: Candidates should have attended a school Information not confirmed The Registrar (Finance) in the Council's jurisdiction area at least two years Rand Afrikaans University prior to matriculating E. GLUCKMAN WILL TRUST LOANS PO Box 524 Service contract: Is required Field of study: Any field of study (but not courses in AUCKLAND PARK 2006 Closing date: Advertised during December and Religious Studies) January of each year 204 Bursaries 189 Value: Amount varies Eligibility. Awarded on the basis of financial need and EDEN TRUST BURSARIES Duration: Provided satisfactory progress is attained, academic merit to prospective students resident in Field of study Accounting (CA) the loan may be renewed on application the area of the Eastern Transvaal Branch of the Value: RI 000 each p.a. Tenable at University of the Witwatersrand Medical Association of SA Duration: Renewable annually Eligibility: Awarded on the basis of merit, good health, Closing date: 30 November Tenable at: Any university in the RSA normal height, appearance and body to male or Further information: Eligibility. Part-time or full-time students who are female Jewish (not converted) students, domiciled in The Honorary Secretary registered articled clerks/trainee accountants the Transvaal Eastern Transvaal Branch Closing date: 31 May Service contract: None Medical Association of SA Further information: Closing date: 31 December PO Box 1149 The Bursary Officer Further information: BOKSBURG 1460 Eden Trust Bursary The Trustees PO Box 59875 E Gluckman Will Trust EAST LONDON MUNICIPAL BURSARY KENGRAY 2100 PO Box 206 Field of study First Bachelor's degree (preference to a CAPE TOWN 8000 B.Sc. degree), teacher's diploma or technical certificate EDKINS BURSARY FUND Value: Approximately R2 000 p.a. E.J. LOMBARDI BURSARIES Field of study Engineering Duration: Renewable annually on application if Value: At the discretion of the University Field of study. B.Sc. (Agric.) (Botany) progress is satisfactory Duration: 1 year, renewable for the duration of the Value: Amount varies Tenable at: Any university, college or technikon in course subject to satisfactory academic performance Duration: 1 year, renewable if progress is satisfactory South Africa and continued financial need Tenable at: University of Stellenbosch Eligibility. Parents or guardians of applicants must be Tenable at: University of the Witwatersrand Eligibility Awarded on the basis of financial need and either ratepayers or residents of East London, and in Eligibility. Awarded on the basis of financial need and academic achievement to undergraduate students. the case of residents, must have resided in the city for academic performance to students registered in the Preference will be given to students as from the the past two years. Bursaries are vailable for full-time Faculty of Engineering for a first degree second year of study study only and preference will be given to students Service contract None Service contract: None studying at local institutions Closing date: 30 September Closing date: 15 January Service contract: Is required Further information: Further information: Closing date: 30 November The Senior Assistant Registrar The Registrar (Bursaries and Loans) Further information: Financial Aid and Scholarships University of Stellenbosch The Town Clerk University of the Witwatersrand Private Bag X1 PO Box 134 Private Bag 3 MAT1ELAND 7602 EAST LONDON 5200 WITS 2050 E.J. LOMBARDI TRUST BURSARY EASTERN CAPE TECHNIKON BURSARIES EDWARD H. WAUGH MEMORIAL SCHOLARSHIP Field of study. Natural Sciences, Dentistry, B.Com. and Field of study Contact the Technikon Field of study. Architecture B.Econ. Value: Amount varies Value: At the discretion of the University Value: Amount varies Duration: 1 year Duration: 1 year Duration: 1 year Tenable at: Eastern Cape Technikon Tenable at: University of the Witwatersrand Tenable at: University of the Western Cape Eligibility Awarded on the basis of academic Eligibility Awarded on the basis of financial need and Eligibility: Awarded on the basis of financial need and achievement and financial need academic performance to a student in the second or academic achievement to full-time undergraduate Closing date: Contact the Technikon subsequent year of study who has completed the first students Further information: year of study towards the BArch or BAS degree Service contract None The Financial Aid Office Service contract: None Closing date: New first-year students: 1 March. Eastern Cape Technikon Closing date: 30 September Current (Senior) students: 31 October of the previous Private Bag X3182 Further information: year BUTTERWORTH 4960 The Senior Assistant Registrar Further information: Financial Aid and Scholarships The Registrar EASTERN METROPOLITAN SUBSTRUCTURE University of the Witwatersrand University of the Western Cape Field of study Medicine Private Bag 3 Private Bag X17 Value: Available from sponsor WITS 2050 BELLVILLE 7535 Tenable at Medical University of Southern Africa Eligibility: Undergraduate students who are perma- EDWARD WALKER BUCHANAN BURSARY E.O. BAXTER BURSARY nent residents of Alexandra- Field of study Medicine Field of study Social Work Closing date: Apply early in the year Value: Amount varies Value: Amount varies Further information: Duration: 1 year, renewable for the duration of the Duration: 1 year The Senior Bursary Clerk course subject to satisfactory academic performance Tenable at: University of the Western Cape PO Box 39101 Tenable at: University of the Witwatersrand Eligibility. Awarded on the basis of financial need and BRAMLEY 2018 Eligibility. Awarded on the basis of financial need and academic achievement to full-time undergraduate Information not confirmed academic performance to former pupils ofJeppe students Boys' High School, King Edward VII High School, Service contract: None EDDIE LEVITZ BURSARY Parktown Boys' High School, St John's College. Closing date: New first-year students: 1 March. Field of study Music Candidates must be English residents of SA Current (Senior) students: 31 October of the previous Value: Approximately R300 Service contract None Year Duration: 1 year, renewable Closing date: 30 September Further information: Tenable at: University of the Witwatersrand Further information: The Registrar Eligibility. Awarded on the basis of financial need and The Senior Assistant Registrar University of the Western Cape academic performance to students entering the Financial Aid and Scholarships Private Bag X17 University for the first time University of the Witwatersrand BELLVILLE 7535 Service contract: None Private Bag 3 Closing date: 30 September WITS 2050 E.W. TURTON STUDY LOAN Further information: Field of study. Medicine The Senior Assistant Registrar EFAMED PERFORMANCE BURSARY Value: Amount varies Financial Aid and Scholarships Field of study. Dietetics Duration: 1 year, renewable up to 6 years if progress University of the Witwatersrand Duration: 1 year is satisfactory Private Bag 3 Tenable at: University of Pretoria Tenable at: Any university in South Africa WITS 2050 Eligibility. Full-time third or fourth-year students who performed well in the previous year of study 205 190 Bursaries Service contract: None Closing date: 15 January (30 November for matricu- Closing date: 15 October lants) ERNIE WENTZEL SCHOLARSHIP Further information: Further information: Field of study: Studies leading to LLB The Head: Financial Assistance The Dean: Faculty of Forestry Value: Tuition, residence fees and an allowance University of Pretoria University of Stellenbosch Duration: 1 year, renewable PRETORIA 0002 Private Bag X5108 Tenable at: University of Port Elizabeth STELLENBOSCH 7599 Eligibility. Awarded on the basis of academic ELI LILLY (SA) (PTY) LTD BURSARY achievement and financial need to students studying EMANUEL JACOBSON BURSARY towards a LLB degree Field of study: Medicine Service contract: Students must practise at the Value: Amount varies Field of study: Mining Engineering Duration: 1 year Value: At the discretion of the University Johannesburg Bar Tenable at: Universities of Pretoria, Witwatersrand and Duration: 1 year, renewable Closing date: 30 November Further information: Stellenbosch Tenable at: University of the Witwatersrand Eligibility: Awarded on the basis of academic Eligibility Awarded on the basis of financial need and The Chairman achievement and financial need to students as from academic performance Ernie Wentzel Scholarship the second year of study Service contract: None JHB Bar Council Service contract: None Closing date: 30 September 300 Innes Chambers Closing date: Contact the university concerned Further information: Pritchard Street Further information: The Senior Assistant Registrar JOHANNESBURG 2001 The Registrar of the university concerned Financial Aid and Scholarships Information not confirmed University of the Witwatersrand ERNST AND YOUNG BURSARY ELI LILLY BURSARY AND LOAN SCHEME Private Bag 3 WITS 2050 Field of study: Pharmacy, Natural Sciences, Nursing Field of study: Accounting Value: Amount determined annually Value: R3 000 for Pharmacy EMIL K(tm)NIG BURSARY Duration: 3 years if progress is satisfactory Duration: 1 year Tenable at: Any university Tenable at: Potchefstroom University for CHE Field of study: Theology (Dutch Reformed Church) Eligibility: Students in their final year of study with Value: RI 000 p.a. Eligibility: Undergraduate students who obtained a matriculation exemption certificate with an A or B satisfactory academic performance and financial need Duration: Duration of the course if progress is symbol for Mathematics Service contract: None satisfactory Service contract: Must complete training contract with Closing date: 15 October Tenable at: University of Pretoria the firm Further information: Eligibility: Full-time students who have registered for Closing date: 31 August The Director (Bursaries and Loans) the following courses: B.D., Diploma in Theology Further information: PU for CHE Closing date: 31 October The Staff Partner Private Bag X6001 Further information: Ernst and Young POTCHEFSTROOM 2520 The Church Administrator NG Gemeente Kameeldrift PO Box 2128 PRETORIA 0001 ELI LILY BURSARY PO Box 15185 LYNN EAST 0039 Field of study: Pharmacy ESKOM TECHNIKON BURSARY Value: Amount varies. Approximately R3 200 for the ENGEN LTD BURSARY SCHEME Field of study: Instrumentation and Control, Me- University of the Witwatersrand chanical Engineering, Electrical Engineering (Heavy Duration: 1 year Field of study: Computer Science, Accounting, Tenable at: Universities of the Western Cape and Information Systems, Chemical Engineering, Electrical and Light Current) Value: Registration, tuition and residence fees plus an Witwatersrand Engineering allowance during theoretical and practical training Eligibility: Awarded on the basis of financial need and Value: Cover all study expenses Duration: Maximum of 3 years academic achievement to full-time undergraduate Duration: 1 year, renewable Tenable at: Any technikon students Tenable at: Universities of Cape Town, Durban- Eligibility: Full-time students with a Senior Certificate Service contract: None Westville, Western Cape, Natal and Witwatersrand. with Mathematics HG (D symbol) or SG (C symbol) Closing date: Contact the university concerned Cape. Peninsula. M.L Sultan and Wits Technikon and Physical Science HG (D symbol) or SG (C symbol) Further information: Eligibility: Full-time SA undergraduate students and who are SA citizens The Registrar of the university concerned Service contract: Negotiable Closing date: 31 October Service contract: Year for year work back contract Closing date: 31 July ELLEN DANIELL BURSARY Further information: SA Institute of Race Relations Further information: Field of study: Music Engen Bursaries The Student Development Manager Value: At the discretion of the University PO Box 32597 Eskom Duration: 1 year. renewable BRAAMFONTEJN 2017 PO Box 1091 Tenable at: University of the Witwatersrand JOHANNESBURG 2000 Eligibility Awarded on the basis of financial need and ERMELO TOWN COUNCIL STUDY LOAN academic performance to students of any race, creed ESKOM UNIVERSITY BURSARY or sex Field of study: A municipal field of study as deter- Field of study: B.Sc. (Engineering) (Electrical Service contract: None mined by the council year to year (Heavy/Light Current), Mechanical, Electro- Closing date: 30 September Value: Tuition, residence, registration and examina- Mechanical); Computer Science Further information: tion fees plus prescribed books Value: Registration, tuition and residence fees as well The Senior Assistant Registrar Duration: Renewable for the duration of the course if as an allowance for books and pocket money Financial Aid and Scholarships progress is satisfactory Duration: Maximum of 4 years University of the Witwatersrand Tenable at: Any university Tenable at: Any university Private Bag 3 Eligibility Students who are resident in the municipal Eligibility Full-time students with Matric Exemption WITS 2050 area of the Town Council of Ermelo Service contract: The study loan is not repayable if the with Mathematics HG (C symbol) and Physical Science HG (C symbol) and who are SA citizens ELSIE CECILIA MCDERMID BURSARY student works for the Council, after completion of his studies, for the X2 period for which the loan was Service contract: Year for year work back contract Field of study Forestry received Closing date: 31 July Value: R500 Closing date: 31 October Further information: Duration: 1 year Further information: The Student Development Manager Tenable at: University of Stellenbosch The Chief Executive Officer ESKOM Eligibility: A deserving and needy second or third- Ermelo Town Council PO Box 1091 year student PO Box 48 JOHANNESBURG 2000 Service contract: None ERMELO 2350 2 G G Bursaries 191 ESTEE LAUDER GROUP OF COMPANIES BUR- BRAAMFONTEIN 2017 PO Box 91050 SARY Information not confirmed AUCKLAND PARK 2006 Field of study. B.Com., B.Econ. Science (Marketing or Finance) F.S. AND R.E. MALAN BURSARY FAK UNIVERSITEIT VAN DIE OVS-MUSIEKBEURS Value: Tuition and residence fees plus a book and Field of study: Theology Field of study: Music personal allowance Value: R4 000 Value: R1 000 each Duration: 1 year, renewable if progress is satisfactory Duration: 1 year, renewable Duration: 1 year Tenable at: University of the Witwatersrand Tenable at: University of Stellenbosch Tenable at: University of the OFS Eligibility Awarded from the second year of study to Eligibility: A Malan student in Theology Eligibility. Music students with proven outstanding black, coloured or Asian students who are SA citizens Service contract: None music performance Service contract: One year service for each year for Closing date: 15 January Service contract: None which the bursary was received Further information: Closing date: 31 October Closing date: 30 July The Registrar. Bursaries and Loans Further information: Further information: University of Stellenbosch The Chief Executive Officer Mrs Magda Lategan Private Bag X1 FAK Estee Lauder MATIELAND 7602 PO Box 91050 PO Box 786132 AUCKLANDPARK 2006 SAN DTON 2146 FACULTY OF LAW PERSONNEL BURSARY FUND Information not confirmed Field of study Law FAK UNIVERSITEIT VAN PRETORIA-BEURSE Value: Amount varies Field of study. Music ESTER MENTZ BURSARY Duration: 1 year Value: Amount varies Field of study. Music (Singing) Tenable at Potchefstroom University for CHE Duration: 1 year Value: Amount varies Eligibility Awarded on the basis of academic Tenable at University of Pretoria Duration: 1 year, renewable achievement to full-time undergraduate students Eligibility. Full-time undergraduate students. Tenable at: University of Stellenbosch Service contract: None Performance ability and general achievement in the Eligibility. Undergraduate students Closing date: 15 February theoretical subjects will be taken into consideration Closing date: 28 February Further information: Service contract: None Further information: The Dean Closing date: 15 October The Registrar (Bursaries and Loans) Faculty of Law Further information: University of Stellenbosch PU for CHE The Head: Study Finance Private Bag X1 Private Bag X6001 University of Pretoria MAT1ELAND 7602 POTCHEFSTROOM 2520 PRETORIA 0002 ESTHER TAYLOR AWARD FAK BEURS FANNY AND SHLOMO BACKEN BURSARY Field of study. Science Field of study Music Field of study. A field of study that will qualify the Value: At the discretion of the University Value: R2 000 each applicant to render some form of social service in the Duration: 1 year, renewable Duration: 1 year SA community Tenable at: University of the Witwatersrand Tenable at: University of Stellenbosch Value: Approximately R6 000 p.a. Eligibility. Awarded on the basis of financial need and Eligibility. Undergraduate and postgraduate students Duration: 1 year, renewable on reapplication academic performance Service contract: None Tenable at Any university in South Africa Service contract: None Closing date: 31 October Eligibility Awarded to postgraduate or final year, Closing date: 30 September Further information: undergraduate, women students who are SA citizens Further information: The Chief Executive Officer Service contract: None The Senior Assistant Registrar FAK Closing date: 31 July for written applications. 31 Financial Aid and Scholarships PO Box 91050 Augustall relevant papers and marks to be in University of the Witwatersrand AUCKLAND PARK 2006 Further information: Private Bag 3 Bursary Officer WITS 2050 FAK MUSIEKBEURSE Union of Jewish Women of SA Field of study. B.Mus. or BA with music subjects PO Box 87556 ETHEL JOYCE CHARLTON BURSARY Value: R1 000 each HOUGHTON 2041 Field of study. Human Sciences, Education Duration: 1 year Value: Amount varies Tenable at University of Pretoria FAR NORTH EDUCATION AND TRAINING Duration: 1 year Eligibility Undergraduate students TRUST LOAN Tenable at University of Stellenbosch Service contract: None Field of study. Science, Medicine, Commerce, Law, Eligibility. Undergraduate students Closing date: 31 October Education Service contract: None Further information: Value: R5 000 Closing date: 15 January The Chief Executive Officer Duration: 1 year Further information: FAK Tenable at: Any university in South Africa The Registrar: Bursaries and Loans PO Box 91050 Eligibility. Students from the Northern Province University of Stellenbosch AUCKLAND PARK 2006 Service contract: None Private Bag X1 Further information: MAT1ELAND 7602 FAK MUSIEKBEURSE The Executive Director Field of study. Music Far North Education and Training Trust EVANGELICAL PRESBYTERIAN CHURCH IN SA Value: Two bursaries, equivalent to one year's tuition 55 Hans van Rensburg Street BURSARY/ LOAN fee, to the winners of undergraduate study and a Shop No 20 Kirkade Field of study: Medicine non-recurrent bursary worth RI 000 each to every PIETERSBURG 0699 Value: R500 runner-up of the undergraduate studies Tenable at Any medical institution in the RSA Duration: 1 year FEDERALE VOLKSBELEGGINGS BEURS Eligibility. Awarded on the basis of financial need, Tenable at: Potchefstroom University for CHE Field of study. Economic and Management Sciences, character and academic record of student Eligibility. Full-time undergraduate students. Engineering, Natural Sciences, Law Service contract: None Performance ability and general achievement in the Value: R1 000 p.a. Closing date: 1 February theoretical subjects will be taken into consideration Duration: Duration of the course Further information: Service contract: None Tenable at: University of Stellenbosch The ChairmanMedical Subcommittee Closing date: 30 October Eligibility. Undergraduate students c/o General Secretary Further information: Service contract: None Evangelical Presbyterian Church in SA The Chief Executive Officer Closing date: 15 January PO Box 31961 FAK Further information: 192 Bursaries The Registrar: Bursaries and Loans Value: Determined annually Eligibility: Undergraduate students from the second University of Stellenbosch Duration: 1 year year of study Private Bag X1 Tenable at: University of Pretoria Service contract: None MATIELAND 7602 Eligibility. Needy and meritworthy full-time students Closing date: 28 February in any of the major fields, viz. Fine Art, Painting, Further information: FELIX AND CHRISTINE GUT BURSARY LOAN Graphic Art and Information Design The Secretary Service contract: None SA Institute of Agricultural Engineers Field of study: Medicine, Theology Closing date: 15 October PO Box 912719 Value: Amount varies Further information: SILVERTON 0127 Duration: Duration of the course The Head: Study Finance Information not confirmed Tenable at: University of Stellenbosch University of Pretoria Eligibility: Awarded on the basis of financial need and PRETORIA 0002 FOREST OWNERS BURSARY academic achievement to full-time undergraduate students Field of study: Forestry FIRST NATIONAL BANK AGRICULTURAL Closing date: 15 January Value: R13 000 BURSARY SCHEME Further information: Duration: 1 year, renewable on reapplication The Registrar (Bursaries and Loans) Field of study: Agriculture Tenable at: University of Stellenbosch University of Stellenbosch Value: R2 000 each Eligibility: Undergraduate students Private Bag X1 Duration: 1 year Closing date: 15 January MATIELAND 7602 Tenable at: University of the OFS Further information: Eligibility: Awarded on the basis of financial need. The Dean: Faculty of Forestry FEMALE ACCOUNTANTS BURSARY SCHEME academic achievement and character to second-year University of Stellenbosch students residing in the Free State or Northern Cape Private Bag X1 Field of study: B.Accounting or Graduate Diploma in Closing date: 31 October MATIELAND 7602 Accounting Further information: Value: Tuition and residence fees plus an allowance The Director FOUNDATION FOR PHARMACEUTICAL EDUCA- for books Students Financial Assistance TION Duration: Renewable annually for the duration of the UOFS Field of study: Pharmacy course PO Box 339 Tenable at: Any university in South Africa only PAAB Value: Amount varies BLOEMFONTEIN 9300 Duration: Second to fourth year of study, if progress accredited universities Eligibility: Awarded for full-time study to black, is satisfactory FIRST NATIONAL BANK SCHOLARSHIP FOR female South Africans in possession of a B.Com. Tenable at: Any Pharmacy Training Institution INFORMATION TECHNOLOGY (Accounting) degree or those presently in their final Eligibility: Pharmacy students from the second year of study year Field of study: B.Com. (Business Information Systems) Service contract: None or B.Com. (Hons.) (Business Information Systems) and Service contract: None Closing date: 30 October B.Sc. (Computer Science) Closing date: 30 September Further information: Value: RI 0 000 Further information: Association for the advancement Duration: 1 year The Secretary of Black Accountants Tenable at: Any university in South Africa Foundation for Pharmaceutical PO Box 5282 Eligibility: Awarded on the basis of academic merit to Education JOHANNESBURG 2000 final year B.Com. or B.Com. (Hons.) students or PO Box 31360 Information not confirmed second or third year B.Sc. (Computer Science) BRAAMFONTEIN 2017 students Information not confirmed FENELLA LEVY MEMORIAL BURSARY Service contract: 1 years service in First National Bank's Information Systems division in Johannesburg FRANK CONNOCK UNIVERSITY TRUST BUR- Field of study: Sociology Closing date: 31 July SARIES Value: At the discretion of the University Further information: Duration: 1 year, renewable once for a maximum of 2 Field of study: English The ManagerRecruitment Division Value: Amount varies years Information Technology Tenable at: University of the Witwatersrand Duration: At the discretion of the universities First National Bank Eligibility: Awarded on the basis of financial need and Tenable at: Universities of Cape Town, Witwatersrand PO Box 61856 academic performance and Natal MARSHALLTOWN 2107 Eligibility: Awarded from the second year of study on Service contract: None the basis of financial need and academic merit to Closing date: 30 September FLORENCE VAN DER BIJL MUSIC BURSARY (IN undergraduate and postgraduate students of the Further information: CORPORATION WITH THE MARTHA WASHING- Christian religion intending to major in English The Senior Assistant Registrar TON CLUB) Financial Aid and Scholarships Service contract: None University of the Witwatersrand Field of study: Music Closing date: 15 January Private Bag 3 Value: R500 p.a. Further information: The Bursary Officer of the university concerned WITS 2050 Duration: I year, renewable for the duration of the course Information not confirmed FIDELITY FUND STUDENT LOAN SCHEME Tenable at: University of the Witwatersrand Eligibility: Awarded on the basis of financial need and FRANS EN RYKIE THERON BURSARY Field of study: Law academic performance to a senior student Field of study: Theology or Agriculture. Any field of Value: At the discretion of the University Service contract: None study if there are no students in the prescribed fields Duration: 1 year Closing date: 30 September Tenable at: Potchefstroom University for CHE Value: Amount varies Further information: Eligibility: Awarded on the basis of academic Duration: 1 year. renewable The Senior Assistant Registrar achievement and financial need to full-time. under- Tenable at: University of Stellenbosch Financial Aid and Scholarships Eligibility: Preference to descendants of the Theron. graduate students University of the Witwatersrand Marais or Zeeman families. Thereafter students from Service contract: None Private Bag 3 Closing date: 15 October the Tuibach district WITS 2050 Further information: Service contract: None Closing date: 15 January The Dean Faculty of Law FORD BURSARY Further information: PU for CHE The Registrar: Bursaries and Loans Private Bag X6001 Field of study: Agricultural Engineering University of Stellenbosch POTCHEFSTROOM 2520 Value: R2 000 each p.a. Duration: 1 year. renewable if progress is satisfactory Private Bag X1 MATIELAND 7602 FINE ARTS MERIT BURSARY Tenable at: University of Pretoria, University of Natal Field of study: B.A. (Fine Arts) or B.A.(Ed.) Art 203 Bursaries 193 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL University of Stellenbosch GENCOR BURSARY SCHEME SCHOLARSHIP Private Bag X1 Field of study. Chemical, Electrical, Mechanical and MAT1ELAND 7602 Field of study Nature Conservation, Zoology, Ecology Mining Engineering; Extractive/Physical Metallurgy and Management of Wild Life of Southern Africa Geology (applicants for Geology bursaries must study GARDEN CITIES BURSARY Value: R4 000 each p.a. up to honours level) with one of the following majors: Duration: 1 year, may be extended Field of study University. Building Science, Civil Chemistry, Geophysics, Physics, Earth Science, Tenable at: Universities of Cape Town, Pretoria, Engineering, Town Planning and Quantity Surveying. Mathematics or Mathematical Statistics; Chemistry Stellenbosch and Rhodes Technikon: Architecture and Building (applicants for Chemistry bursaries must study up to Eligibility. Deserving students Value: Tuition fees plus book allowance honours level) with Physics or Mathematics as major; Service contract: None Duration: Renewable annually subject to academic Purchasing Management from third year only, Closing date: 31 December progress Computer Science and B.Com. (Accounting) Further information: Tenable at: Any university in the Western Cape and Value: Tuition, registration and residence fees plus an Mr Q Geekie Cape and Peninsula Technikon annual cash allowance. (Bursars who do not stay in PO Box 158 Eligibility Full-time students under the age of 30 who residence will be entitled to receive an amount PRETORIA 0001 reside within 100 km of Cape Town equivalent to the residence fees) Service contract. None Duration: Maximum of 4 years. Bursaries are FREE STATE PROVINCIAL GOVERNMENT Closing date: 15 January renewable annually, dependent on academic BURSARY Further information: performance Field of study. Courses which can be of use to the The Personnel Officer Tenable at Any university or technikon Provincial Government Garden Cities Eligibility. All matriculants with a minimum of a C Value: Tuition, registration and residence fees and full PO Box 166 symbol (Higher Grade) in both Mathematics and meals a day (full-time bursaries) EDGEMEAD 7407 Natural Science and students who are already Duration: Minimum duration of the course Information not confirmed studying at a university or technikon. Bursaries are Tenable at: Any university or technikon available for full-time study only Eligibility. Full-time students GAUTENG PROVINCIAL GOVERNMENT BUR- Service contract Must work for Gencor or its nominee Service contract: Is required SARY for a period of six months in respect of each year for Closing date: Approximately 31 August Field of study M.B., Ch.B., Dietetics, Physiotherapy, which the bursary was received, or repay the bursary Further information: Pharmacy, Occupational Therapy, Speech Therapy costs incurred by Gencor The Director Value: R15 600 p.a. for M.B., Ch.B. and R12 900 for Closing date: 31 May Human Resources Management Directorate the other courses Further information: PO Box 517 Duration: Prescribed minimum duration or the course The Manager BLOEMFONTEIN 9300 Tenable at Any university in Gauteng Gencor Bursaries Eligibility Undergraduate students who are residing in PO Box 61820 FRENCH GOVERNMENT BURSARIES Gauteng MARSHALLTOWN 2107 Service contract: One year service for each year for Field of study: French GENREC CONSTRUCTION BURSARY SCHEME Value: Tuition costs and possibly a book allowance which the bursary was granted. Bursary obligations Duration: 1 year, renewable must be redeemed in the Gauteng Provicial Admini- Field of study. Electrical Engineering (Light and Heavy Tenable at: Any university stration Current); Mechanical Engineering; Quantity Surveying; Eligibility. Awarded on the basis of academic Closing date: 20 October Civil Engineering achievement and financial need to full-time SA Further information: Value: Amount varies students under the age of 24 The Director Tenable at Any technikon or university Service contract None Human Resources Management Eligibility. All students Closing date: Contact the university concerned Section Bursaries Service contract Is required Further information: Private Bag X221 Closing date: 30 September The Registrar of the university concerned PRETORIA 0001 Further information: Information not confirmed Genrec Construction Bursary Scheme FUNDANI TRUST PO Box 14101 GENBEL-STUDIETRUST BURSARY LOANS FOR WADEVILLE 1422 Field of study. Medical, Agriculture, Sciences, B.COM. STUDENTS Information not confirmed Technical Field of study B.Com. with subjects which include Value: Amount varies GENREF LIMITED BURSARY Duration: 3 years Accounting, Financial Management, Business Tenable at Any university or technikon Management and Taxation, preferably majoring in Field of study Chemical, Electrical or Mechanical Eligibility Undergraduate students from areas where Accounting and Business Management Engineering Fundani operates i.e. Eastern Cape, Kwazulu Natal Value: Covers most, if not all, of the study costs Value: Amount varies (Maputaland and Upper Tugela Valley), Free State Duration: Duration of the course Duration: 1 year, renewable for the duration of the (North), Northern (Lowveld) and Mpumalanga Tenable at Any university course (Lowveld) Eligibility. Matriculants with Mathematics HG (C Tenable at Any university in SA or M.L Sultan Service contract. Community service for 3 years symbol) and with an interest in the field of invest- Technikon Closing date: 30 September ment, may apply. Academic merit as well as financial Eligibility. SA citizens Further information: circumstances will be taken into account for selection Service contract Two year service contracts subject to The Bursary Administrator purposes availability of suitable vacancy on completion of Fundani Trust Service contract None degree PO Box 30896 Closing date: 31 August for completed forms Closing date: 31 May BRAAMFONTEIN 2017 Further information: Further information: Information not confirmed The National Director The Study Grant Co-ordinator Genbel-Studietrust Genref Limited G.P. CANITZ BURSARY PO Box 29192 PO Box 956 MELVILLE 2109 DURBAN 4000 Field of study. Painting Information not confirmed Value: Amount varies Duration: 1 year GEORGE BLAKE BURSARY Tenable at University of Stellenbosch Eligibility. Awarded on the basis of merit to under- Field of study. Engineering graduate and postgraduate students Value: R600 Service contract: None Duration: 1 year Closing date: 30 August Tenable at University of Stellenbosch Further information: Eligibility. An undergraduate student from the Cape The Registrar (Bursaries and Loans) Service contract None 209 194 Bursaries Closing date: 15 January GORDON LE ROUX MEMORIAL BURSARY LOAN Further information: GLAXO BURSARY Field of study: Agriculture The Registrar (Bursaries and Loans) Field of study Pharmacy Value: R800 p.a. University of Stellenbosch Value: R5 000 Duration: Duration of the course (first year amount Private Bag X1 Duration: 1 year only payable on successful completion of the first MAT1ELAND 7602 Tenable at: Potchefstroom University for CHE year) Eligibility Award on the basis of financial need and Tenable at: Any university GEORGE COATES SCHOLARSHIP academic achievement Eligibility: Awarded on the basis of financial need and Field of study: Agricultural Economics Service contract: None academic performance to undergraduate students Value: R4 000 Closing date: 15 October who originate from East Griqualand Duration: 1 year, renewable Further information: Service contract: None Tenable at: University of Natal The Director: Financial Assistance Closing date: None Eligibility. Undergraduate students. Award is based on Potchefstroom University for CHE Further information: academic merit. Preference given to persons involved POTCHEFSTROOM 2520 The Secretary in the sugar industry East Griqualand Regional Service contract: None GMSA BURSARY Development Association PO Box 188 Closing date: 30 September Field of study: B.Sc. (Building Management) KOKSTAD 4700 Further information: Value: R3 500 p.a. The Secretary Duration: 1 year GRAHAMSTOWN TRAINING COLLEGE SCHOL- SA Cane Growers Association Tenable at: Any university PO Box 1278 Eligibility. Full-time undergraduate student in Building ARSHIP DURBAN 4000 Management as from the second year of study. Field of study: Theology Financial position will be taken into consideration Value: Amount varies GEORGE HIBBERT SCHOLARSHIP IN PHYSIO- Closing date: 31 October Duration: 1 year, renewable according to the THERAPY Further information: discretion of the Dean of Divinity Field of study: Physiotherapy GMBA Bursary Executive Director Tenable at: Rhodes University Value: Approximately R700 p.a. Gauteng Master Builders Association Eligibility Awarded on the basis of academic Duration: 1 year, renewable PO Box 33271 achievement to an ordination candidate of the Church Tenable at: University of the Witwatersrand JEPPESTOWN 2043 of the Province of Southem Africa. The award is Eligibility. Awarded on the basis of financial need and normally made to candidates registered for the BA academic performance to students of any colour, GOLD FIELDS OF SA LIMITED BURSARY degree with majors in divinity subjects Service contract: None creed or gender Field of study: B.Sc. (Engineering): Mining, Mechanical, Closing date: 1 December Service contract: None Electrical, Metallurgical, Chemical and Geological. A Further information: Closing date: 30 September limited number of awards in the field of B.Com., Dean of the Faculty of Divinity Further information: B.Com. (Accounting), B.Business Science, B.Sc. Rhodes University The Senior Assistant Registrar (Computer Science/Mathematics), B.Sc. (Quantity Financial Aid and Scholarships Surveying/Building Science), Medicine (from fourth PO Box 94 GRAHAMSTOWN 6140 University of the Witwatersrand year and up) and Physiotherapy (from third year and Information not confirmed Private Bag 3 up) WETS 2050 Value: Tuition and residence fees plus a personal GREATER JOHANNESBURG TRANSITIONAL allowance of R4 500 p.a. as well as R650 for study METROPOLITAN COUNCIL (GJTMC) BURSARY GERALD WRIGHT SCHOLARSHIP equipment to new bursary holders (these amounts Field of study. English or related fields are reviewed annually) Field of study Civil, Mechanical, and Electrical Value: RI 500 p.a. Duration: Renewable annually if progress is satisfac- Engineering; Town and Regional Planning; Quantity Duration: 1 year, renewable for a maximum period of tory Surveying; Architecture; Accounting; Land Surveying: 3 years, given academic progress Tenable at: Any university in Southern Africa Public and Municipal Administration; Human Tenable at: Any South African university or teacher's Eligibility: Undergraduate or postgraduate students Resource Management; Psychology and Industrial training college Service contract: One year service for each year for Psychology; Computer Science; Public Health; Eligibility: Awarded on the basis of matric symbols or which the bursary was held. Employment with the Horticulture (fields of study vary annually) provisional matric results in Std 10, motivation and group must be accepted for at least 2 years. Eight Value: Tuition fees plus an allowance of R6 000 p.a. field of study to matriculants who will enrol for a first weeks of vacation training is required Duration: Typically duration of the course but revised degree course in the year following their application Closing date: 30 June annually and who are citizens of, and resident in. SA Further information: Tenable at: Any university or any technikon in Service contract: None Senior Personnel Officer (Sourcing) Gauteng Closing date: 1 November GFTS Trust Eligibility: Full-time undergraduate and postgraduate Further information: Private Bag X11 students The Chief Executive Officer WESTONARIA 1780 Service contract: Is required Grahamstown Foundation Closing date: 31 July PO Box 304 GOLDSMITH AND PAPENFUS BURSARY Further information: The Executive Officer GRAHAMSTOWN 6140 Field of study. Social Work Training, Development & Employee Assistance Information not confirmed Value: At the discretion of the University Human Resources Duration: 1 year, renewable annually for the duration PO Box 1049 GERT AND CATHARINA SWANEPOEL THEO- of the course subject to satisfactory academic JOHANNESBURG 2000 LOGICAL FUND performance and continued financial need Field of study: Theology Tenable at: University of the Witwatersrand GREATER POTGIETERSRUS TRANSITIONAL Value: Determined by the donor Eligibility. Awarded on the basis of financial need and LOCAL COUNCIL STUDY LOAN Duration: Duration of the course academic performance to black, coloured or Indian Tenable at: Potchefstroom University for CHE students who are SA citizens Field of study: Any field of study in an appropriate Eligibility Students who are members of the Neder- Service contract: None municipal field duitsch Hervormde Kerk van Afrika Closing date: 30 September Value: R5 000 p.a. Closing date: None Further information: Duration: 1 year, renewable subject to the availability Further information: The Senior Assistant Registrar of funds The Church Secretary Financial Aid and Scholarships Tenable at: An approved tertiary institution Curatory for Theological Training University of the Witwatersrand Eligibility: Residents of Greater Potgietersrus PO Box 2368 Private Bag 3 Service contract: None PRETORIA 0001 WITS 2050 Closing date: 30 September Information not confirmed Further information: 210 Bursaries 195 The Town Clerk Further information: PO Box 34 GROUP FIVE ROADS, SAVAGE AND LOVEMORE The Registrar: Bursaries & Loans POTGIETERSRUS 0600 (WESTERN CAPE) (PTY) LTD BURSARY University of Stellenbosch Field of study. Civil Engineering Private Bag Xl GRINAKER BURSARIES Value: Amount varies MAT1ELAND 7602 Field of study. B.Sc. (Electronics) Duration: Depend on results HAGGIE BURSARY Value: Tuition and residence fees Tenable at: Universities of Cape Town and Stellen- Duration: 1 year, renewable bosch Field of study: Engineering, Metallurgy and Business Tenable at: Any university Eligibility. Full-time students as from the second year Studies Eligibility Undergraduate students of study Value: Amount varies Service contract: Vacation employment and service Service contract: 1 year service for every year for Tenable at: Any university or technikon contract which the bursary was received Eligibility: Awarded primarily to dependants of Closing date: 31 July Closing date: 30 September employees, but will consider applications from Further information: Further information: unrelated undergraduates in cases of financial need The Group Human Resources Manager Human Resources Department and will always give preference to a student who has Grinaker Electronics Ltd Group Five Roads successfully completed the first year of study PO Box 29818 Savage & Lovemore (Western Cape) (Pty( Ltd Service contract: None SUNNYSIDE 0132 PO Box 366 Closing date: 31 December Information not confirmed SOMERSET WEST 7130 Further information: Information not confirmed Mrs YE Swart GROUP CAPTAIN 'SAILOR' MALAN MEMORIAL PA to Group MD BURSARIES GROVE, VAN DER HEEVER AND MAY SCHOL- Haggie Rand Ltd Field of study. Medicine (M.B. B.Ch.) ARSHIP PO Box 40072 Value: At the discretion of the University Field of study. Law CLEVELAND 2022 Duration: 1 year, renewable upon reapplication up to Value: R5 000 a maximum of 6 years subject to satisfactory Duration: 1 year HAMEL BURSARY progress Tenable at: Potchefstroom University for CHE Field of study. Theology Tenable at: University of the Witwatersrand Eligibility. Awarded on the basis of academic merit to Value: Amount vanes Eligibility. Awarded on the basis of financial need and B.Proc. final-year students who participate in student Duration: 1 year academic performance to students in any year of activities Tenable at University of Stellenbosch study. Students whose parents have served in the Service contract: None Eligibility Needy prospective students who are armed forces, and in the air force in particular, will be Closing date: 15 October progressing satisfactorily and intend to qualify in the given special consideration Further information: ministry of the Dutch Reformed Church with the Service contract: None The Dean: Faculty of Law courses B.D.and B.Th. Closing date: 30 September PU for CHE Service contract: None Further information: POTCHEFSTROOM 2520 Closing date: 31 January The Senior Assistant Registrar Further information: Financial Aid and Scholarships GUY SUTTON MEMORIAL BURSARY The Church Secretary University of the Witwatersrand Field of study. Commerce and Natural Science NG Kerk Stellenbosch Central Private Bag 3 Value: Aproximately R600 p.a. PO Box 6114 WITS 2050 Duration: 1 year, renewable Uniedal Tenable at Any university and M.L Sultan Technikon STELLENBOSCH 7612 GROUP FIVE ROADS SAVAGE AND LOVEMORE Eligibility. Awarded on the basis of academic merit (EASTERN CAPE) (PTY) LTD BURSARY and financial need HANS MERENSKY BURSARY Field of study. Civil Engineering Service contract: None Field of study. Forestry (all degrees in the faculty) Value: Covers tuition and residence fees and pre- Closing date: 30 September Value: R7 000 scribed books Further information: Duration: 1 year, renewable Duration: Duration of the course Personnel Officer Tenable at University of Stellenbosch Tenable at: Any South African universitypreferably Lion Match Co. Eligibility. Full-time students universities in the Cape Province PO Box 918 Service contract Bursary holders have to work at least Eligibility: Students who have successfully completed DURBAN 4000 one long holiday for the Hans Merensky Foundation their first year of study Closing date: 15 January (30 November for matricu- Service contract Minimum one year, maximum two H.A. WHITECROSS SCHOLARSHIPS lants) years Field of study. English or History Further information: Closing date: 1 September Value: At the discretion of the trustees The Dean: Faculty of Forestry Further information: Duration: 1 year only University of Stellenbosch The Director Tenable at University of the Witwatersrand Private Bag Xl Human Resources Admin Office Eligibility. Awarded on the basis of academic merit to MAT1ELAND 7602 Savage and Lovemore (East Cape) second or third year students who propose to major PO Box 7172 in English or History. Preference to candidates who HANSIE BOTHA STUDY BURSARY FUND (LOAN) PORT ELIZABETH 6055 propose to proceed to B.A. Honours in English or Field of study Theology History, or to complete a teachers training career Value: Amount varies GROUP FIVE ROADS SAVAGE AND LOVEMORE Service contract: None Duration: Varies BURSARY FOR TECHNIKON STUDY Closing date: 10 January Tenable at Any university Field of study. Civil Engineering Further information: Eligibility Awarded on the basis of financial need and Value: Amount varies The Financial Aid & Scholarships Office academic achievement ONLY to full-time under- Duration: 4 years University of the Witwatersrand graduate students of the Dutch Reformed Church Tenable at Any technikon Private Bag 3 Service contract: None Eligibility. Full-time students WITS 2050 Closing date: 31 December Service contract: 2 years' service after completion of Further information: studies H.J. BRUWER BURSARY The Cashier Closing date: Consult donor Field of study Theology NG Community, Rustenburg Further information: Value: Amount varies PO Box 286 The Personnel and Training Officer Tenable at: University of Stellenbosch RUSTENBURG 0300 Savage and Lovemore (Pty) Ltd Eligibility. Needy students with merit Information not confirmed PO Box 7172 Service contract: None PORT ELIZABETH 6055 Closing date: 15 January 196 Bursaries HAROLD AND DORIS TOTHILL FUND (BURSARY University of the Witwatersrand Eligibility Undergraduate students FOR TUITION FEES) Private Bag 3 Service contract: One year service for each year of WITS 2050 assistance Field of study Education (English), Dramatic Art Closing date: 30 April Value: Amount varies HENDRIK EN ANNATJIE VISAGE BURSARY Further information: Duration: 1 year The Head (Training) Tenable at: University of the Witwatersrand Field of study: Engineering Highveld Steel and Vanadium Corp Eligibility: Awarded on the basis of financial need and Value: Amount varies PO Box 111 academic performance to students who, in the year of Duration: 1 year WITBANK 1035 tenure of the bursary, will be registered for English II Tenable at: Potchefstroom University for CHE Information not confirmed or III, or the Higher Diploma in Education, or the Eligibility Preference to undergraduate female fourth year of the B.A. Education degree with English students who successfully completed their first year HIGHVELD STEEL AND VANADIUM CORP LTD as a major teaching methodology, or B.A. (Dramatic of study BURSARY (TECHNIKON) Art) Service contract: None Service contract: None Closing date: 15 October Field of study: Electrical, Mechanical and Metallurgical Closing date: 30 September Further information: Engineering, Analytical Chemistry, Industrial Engi- Further information: The Director (Bursaries and Loans) neering and Computer Science The Senior Assistant Registrar PU for CHE Value: Tuition and residence fees plus full salary while Financial Aid and Scholarships Private Bag X6001 performing practical training University of the Witwatersrand POTCHEFSTROOM 2520 Duration: Duration of the course Private Bag 3 Tenable at: Vaal Triangle Technikon, Technikon WITS 2050 HERMAN KRIGE BURSARY Pretoria (Witbank Campus) Eligibility: Diploma students Field of study: Psychology Service contract: One year service for each year for HELEN SUZMAN/BRITISH GOVERNMENT Value: R860 R8 030 p.a. which the bursary was received AWARDS Duration: 1 year, renewable Closing date: During the year Field of study: Social Work. Speech and Hearing Tenable at Rand Afrikaans University Further information: Therapy, Clinical Psychology, Commerce, Engineer- Eligibility: Full-time undergraduate or postgraduate The Head ing, Education, Pharmacy, Nursing, Occupational students Central Training Service contract: None Therapy, Physiotherapy, Science PO Box ill Value: Approximately R12 500 Closing date: 15 November WM3ANK 1035 Duration: 1 year Further information: Information not confirmed Tenable at: University of the Witwatersrand The Registrar (Finance) Eligibility: Awarded on the basis of financial need and Rand Afrikaans University HILDA HENDRIKZ BURSARY academic performance to black women students in PO Box 524 any year of study AUCKLAND PARK 2006 Field of study: Singing Service contract: None Value: R2 SOO Closing date: 30 September HERMAN LOUIS KARNOVSKY FUND Duration: 1 year, renewable Tenable at: University of Stellenbosch Further information: Field of study: Pharmacy Eligibility: Awarded on the basis of merit to under- The Senior Assistant Registrar Value: At the discretion of the University graduate or postgraduate students Financial Aid and Scholarships Duration: 1 year Service contract: None University of the Witwatersrand Tenable at: University of the Witwatersrand Closing date: 30 September Private Bag 3 Eligibility: Awarded on the basis of financial need and Further information: WITS 2050 academic performance The Chairman Service contract: None Dept of Music HELENA JOOSTE UNDERGRADUATE BURSARY Closing date: 30 September University of Stellenbosch Field of study: Veterinary Science Further information: Private Bag X1 Value: R2 000 p.a. The Senior Assistant Registrar MATIELAND 7602 Duration: 1 year, renewable Financial Aid and Scholarships Tenable at: University of Pretoria University of the Witwatersrand HNR COMPUTERS BURSARY FUND Eligibility: Deserving undergraduate fourth- or fifth- Private Bag 3 year students in Veterinary Science who performed WITS 2050 Field of study: Information Technology, Computer well in the subjects Pathology, Infectious Diseases, Science, Engineering Toxicology, Helminthology, Entomology and HEXAGON TRUST BURSARY Value: Amount varies Duration: Renewable Protozoology and who are interested in following a Field of study: Science, Commerce and Technical Tenable at: Any university or technikon career in research Studies Eligibility: Awarded on the basis of financial need, Service contract: One year service at the Onderste- Value: Tuition fees plus an allowance academic achievement and the course undertaken to poort Veterinary Institute for each year for which the Duration: 1 year, renewable full-time students from a disadvantaged background bursary was received Tenable at: Any university or technikon in South Africa Service contract: None Closing date: 31 October Eligibility: Awarded on the basis of financial need and Closing date: 31 January Further information: academic performance to full-time undergraduate Further information: The Director students The Human Resources Manager Onderstepoort Veterinary Institute Service contract: None HNR Computers Bursary Fund ONDERSTEPOORT 0110 Closing date: 31 October PO Box 8116 Further information: ROGGEBAAI 8012 HELMUT HUSSERL BURSARY The Bursary Officer PO Box 5401 Field of study: Medicine HOFMEYR AND DE VOS BURSARY Value: At the discretion of the University DURBAN 4000 Duration: 1 year Information not confirmed Field of study: Social Work and Theology Tenable at: University of the Witwatersrand Value: R1 000 Eligibility: Awarded on the basis of financial need and HIGHVELD STEEL AND VANADIUM CORP LTD Duration: I year, renewable academic performance to Jewish sixth-year M.B. BURSARY Tenable at: University of Stellenbosch Eligibility: Boarding bursaries are awarded on the B.Ch. students based on their results in the Psychiatry Field of study: Electrical, Mechanical and Metallurgical basis of financial need of students examination in the fifth year Engineering Service contract: None Service contract: None Value: Tuition and residence fees plus R2 000 for Closing date: 15 January Closing date: 30 September books and other expenses Further information: Further information: Duration: Duration of the course if progress is The Registrar (Bursaries and Loans) The Senior Assistant Registrar satisfactory University of Stellenbosch Financial Aid and Scholarships Tenable at: Any South African university 212 Bursaries 197 Private Bag Xl Value: Amount variestuition fees and monthly Eligibility B.Sc. (Surveying) students from the second MAT1ELAND 7602 stipends year of study Duration: 1 year, renewable for the duration of the Service contract Required to register as professional HOME ECONOMICS ASSOCIATION OF SOUTH- course land surveyor after degree ERN AFRICA BURSARY (HEASA) Tenable at Any university in South Africa Closing date: 31 October Eligibility. Awarded, as from the first year of study, on Further information: Field of study Home Economics and Dietetics the basis of academic achievement (A aggregate) and The President Value: R2 500 p.a. financial need to Muslim students who are SA Institute of Professional Duration: 1 year citizens. Students will be interviewed and must also Land Surveyors Tenable at: Any technikon, college or university participate in programmes organised by the Islamic PO Box 1089 Eligibility. Full-time students who have passed their DURBAN 4000 first year of study. Applicants must be junior mem- Development Bank (IDB) Service contract Must work in South Africa for the bers or full paid-up members of the HEASA same period for which the loan was received INSTITUTION OF CERTIFICATED MECHANICAL Service contract: None Closing date: Advertised in the media in December AND ELECTRICAL ENGINEERS BURSARY Closing date: 15 January Further information: January Field of study. Mechanical and Electrical Engineering The Administrative Secretary Further information: (Heavy Current) The Southern African Counterpart HEASA Head Office Value: R2 000 p.a. (can vary) IDS Scholarship Programme PO Box 29585 Duration: 1 year, renewable annually subject to PO Box 2672 SUNNYSIDE 0132 satisfactory progress DURBAN 4000 Tenable at: Any university or technikon HOPEFIELD AND KUILSRIVER CONGREGATIONS Eligibility Awarded on the basis of academic ade- IMMANUEL BURSARY BURSARY quacy and financial need to actual or prospective full- Field of study BA (Theology) time students. Preference to dependants or nomi- Field of study. Theology nees of Institution members Value: Amount varies Value: R500 Service contract None Tenable at University of Stellenbosch Duration: 1 year, renewable Closing date: 31 December Eligibility Awarded on the basis of financial need Tenable at: University of Stellenbosch Further information: ONLY to undergraduate students whose parents are Eligibility Undergraduate students who are in extreme financial need. Bursars should undertake to The Secretary residents of HOPEFIELD or KUILSRIVER continue their studies at the Seminary. Married The Institution of Certificated Mechanical Service contract: None persons also qualify, but not students who marry and Electrical Engineers, South Africa Closing date: 30 September PO Box 93480 Further information: during the course of their theological studies YEOVILLE 2143 The Church Administrator Service contract None Closing date: 15 January Information not confirmed PO Box 107 Further information: KUILSRIVER 7580 The Registrar (Bursaries and Loans) IRVIN AND JOHNSON BURSARY University of Stellenbosch I.M.K. DE VILLIERS BURSARY Field of study Food Science Private Bag Xl Value: Amount varies Field of study Electrical Engineering MA11ELAND 7602 Duration: Duration of the course Value: Up to a maximum of full tuition fees Tenable at: University of Stellenbosch Duration: I year, renewable annually for the duration INSTITUTE OF CHARTERED ACCOUNTANTS Eligibility A second-year student on the basis of of the course subject to satisfactory progress and BURSARY satisfactory academic achievement in the first year of conduct study. Prefence will be given to students in financial Tenable at University of the Witwatersrand Field of study Accounting need Eligibility. Awarded on the basis of financial need and Value: Tuition and books up to R6 500 pa. Service contract None academic performance to a first year-student Duration: 1 year, renewable Tenable at Potchefstroom University for CHE Closing date: 15 January accepted for B.Sc. (Electrical Engineering) Eligibility. Undergraduate students for B.Com. Further information: Service contract: Norte The Registrar (Bursaries and Loans) Closing date: 30 September (Accounting) University of Stellenbosch Further information: Service contract: Must be a trainee accountant at a chartered accounting firm for 3 years Private Bag Xl The Senior Assistant Registrar MATIELAND 7602 Financial Aid and Scholarships Closing date: 31 August University of the Witwatersrand Further information: SA Institute for Chartered Accountants ISCOR BURSARIES FOR TECH - Private Bag 3 PO Box 59875 NIKON/TECHNICAL COLLEGE AND UNIVERSITY WITS 2050 KENGREY 2100 STUDIES Information not confirmed IBM BURSARY Field of study: Chemical Plant Operation; Electrical (Heavy Current), Mechanical, Electronic, Industrial, Field of study. Computer Science INSTITUTE OF PACKAGING BURSARY Civil and Structural Engineering; Analytical Chemistry; Value: Amount varies Metallurgy Instrumentation; Ceramic Technology; Duration: 1 year Field of study Packaging and Printing Technology Production; Engineering Design; Engineering Drawing Tenable at: University of the Western Cape Value: R5 000 Value: Registration, tuition, examination and resi- Eligibility. Awarded on the basis of financial need and Duration: 1 year dence fees plus a specified amount per semester, academic achievement to full-time undergraduate Tenable at Cape Technikon Eligibility. Second- and third-year students only trimester or year for books and allowance students Service contract Employment in packaging industry Duration: Renewable every semester, trimester or Service contract. None year if progress is satisfactory for a period as Closing date: New first-year students: 1 March. Closing date: Apply before 31 October specified by the specific studies Current (Senior) students: 31 October of the previous Further information: Institute of Packaging Tenable at Any technikon/technical college or year Western Cape Region university as contracted Further information: PO Box 252 Eligibility Candidates should have passed Mathemat- The Registrar EPPINDUST 7475 ics (at least Standard Grade D symbol) and Physical University of the Western Cape Science in the Standard 10 or N3 examination. Private Bag X17 INSTITUTE OF PROFESSIONAL LAND SURVEY- Students are required to undergo an aptitude test BELLVILLE 7535 ORS BURSARY Service contract Is required Closing date: 31 August IDB SCHOLARSHIP TRUST BURSARY LOAN Field of study. Land Surveying Further information: Value: Tuition feespartial or full Field of study. Information Systems, Engineering (all The Training Manager Duration: I 3 years (second yearfourth year) fields), Computer Science, Medicine, Dentistry, ISCOR WORKS Tenable at: University of Natal (Durban) Pharmacy, Fisheries, Forestry, Agriculture, Veterinary PO Box 19 Science 198 Bursaries PRETORIA 0001 Service contract: None Eligibility: Awarded on the basis of financial need and Information not confirmed Closing date: 30 September academic achievement to full-time undergraduate Further information: students ISCOR BURSARY LOAN The Senior Assistant Registrar Service contract: None Financial Aid and Scholarships Closing date: New first-year students: 1 March. Field of study B.Com. (Accounting, Information University of the Witwatersrand Current (Senior) students: 31 October of the previous Systems, Economics, Business Economics) or Private Bag 3 year B.Business Science (Computer Science), Engineering WITS 2050 Further information: (All Branches), Natural Sciences (Computer Science, The Registrar Chemistry, Geology with Chemistry or Physics) J.C. BITCON SCHOLARSHIP University of the Western Cape Value: Tuition and residence fees plus a book Private Bag X17 allowance and computer subsidy Field of study: B.Sc. (Building Management) BELLVILLE 7535 Duration: 1 year, renewable up to 3 years Value: R14 000 p.a. Tenable at: Any university or technikon Duration: 1 year, renewable if progress is satisfactory J.G. MEIRING BURSARY FUND Eligibility. South Africans only Tenable at: Universities of Cape Town, Natal, Orange Service contract: Compulsory vacation training as Free State, Port Elizabeth, Pretoria and the Witwa- Field of study: Theology from the second year of study tersrand Value: Amount varies Closing date: 30 June Eligibility Matriculants and students who are already Duration: 1 year Further information: enrolled at a university Tenable at: University of the Western Cape Personnel Manager Service contract: Work in the building industry for a Eligibility Awarded on the basis of financial need and Iscor Head Office period of six months for every year for which the academic achievement to full-time undergraduate PO Box 450 bursary was received students PRETORIA 0001 Closing date: 2 January Service contract: None Further information: Closing date: New first-year students: 1 March. ITESSA BURSARY The Director Current (Senior) students: 31 October of the previous National Development Fund year Field of study. Surveying Building Industry Further information: Vaiue: R500 per semester PO Box 1619 The Registrar Duration: 1 year HALFWAY HOUSE 1685 University of the Western Cape Tenable at: Cape Technikon Private Bag X17 Eligibility Awarded on the basis of academic merit J.C. COETZEE BURSARY FOR ECCLESIASTICAL BELLVILE 7535 Service contract: None ORGAN MUSIC Closing date: 15 August J.L.M. FRANK EN BURSARY Further information: Field of study Music ITESSA Value: R2 000 each Field of study. Music PO Box 20030 Tenable at: University of Stellenbosch Value: R2 000 DURBAN NORTH 4016 Eligibility Undergraduate students who want to Duration: 1 year Information not confirmed become church organists Tenable at: University of Stellenbosch Service contract: None Eligibility: An exceptionally deserving full-time J. DU P. SCHOLTZ BURSARY Closing date: 30 September undergraduate student in musicany speciality Further information: Service contract: None Field of study Afrikaans en Nederlands The Chairperson Closing date: 30 September Value: Amount varies Music Dept Further information: Duration: 1 year, renewable University of Stellenbosch The Chairperson Tenable at: University of Stellenbosch Private Bag Xl Dept of Music Eligibility. Undergraduate and postgraduate students MATIELAND 7602 University of Stellenbosch Service contract: None Private Bag X1 Closing date: I S January J.C.D. HECKROODT BURSARY MATIELAND 7602 Further information: The Registrar (Bursaries and Loans) Field of study: Any university degree J.W. DU PREEZ BURSARY University of Stellenbosch Value: Amount varies Private Bag X1 Duration: Duration of the course Field of study Natural Sciences, Medicine and MAT1ELAND 7602 Tenable at: University of Stellenbosch Dentistry Eligibility. ONLY descendants of P.H. Heckroodt Value: Amount varies J.B. COLLINS LOAN FUND Service contract: None Duration: Duration of the course if progress is Further information: satisfactory Field of study Medicine and Engineering The J.C.D. Heckroodt Trust Tenable at: University of Stellenbosch Value: RI 000R5 000 p.a. First National Trust Eligibility. Awarded on the basis of financial need and Duration: Duration of the course PO Box 2036 merit to students as from their second year of study Tenable at: University of Stellenbosch JOHANNESBURG 2000 Service contract: None Eligibility. White students Closing date: 15 January Service contract: None J.E. CONRADIE LOAN Further information: Closing date: 15 January The Registrar (Bursaries and Loans) Further information: Field of study Occupational Therapy University of Stellenbosch The Registrar (Bursaries and Loans) Value: Amount varies Private Bag X1 Duration: Minimum duration of the course University of Stellenbosch MATIELAND 7602 Private Bag Xl Tenable at: Any technikon or university Eligibility Only students whose mothers are members MATIELAND 7602 JACK MINCER BURSARY of CWAA J.C. BITCON FOUNDATION BURSARIES Service contract: None Field of study Social Work Closing date: 31 July Value: R2 000 Field of study. Architecture, Building, Quantity Further information: Duration: 1 year, renewable subject to satisfactory Surveying, Town and Regional Planning CWAA academic progress Value: Up to a maximum of tuition fees Tenable at: University of the Witwatersrand Duration: One year, renewable annually subject to PO Box 273 STELLENBOSCH 7599 Eligibility: Awarded on the basis of financial need and satisfactory performance and continued financial academic performance need J.F. OOSTHUIZEN MEMORIAL FUND Service contract: None Tenable at: University of the Witwatersrand Closing date: 30 September Eligibility. Awarded on the basis of financial need and Field of study: Economics Further information: academic achievement to students of any race, colour Value: Amount varies The Senior Assistant Registrar or creed who have successfully completed the first Duration: 1 year Financial Aid and Scholarships year of study Tenable at: University of the Western Cape 214 Bursaries 199 University of the Witwatersrand Eligibility. Residents of SA who have completed matric The Senior Assistant Registrar Private Bag 3 with a C symbol on Higher Grade for Mathematics Financial Aid and Scholarships WITS 2050 and Science University of the Witwatersrand Service contract One year service for each year for Private Bag 3 JAMES MAY DUTHIE BURSARY which the bursary was awarded WITS 2050 Field of study. Medicine (M.B. B.Ch.) Closing date: 31 May JOHANN G. LEIPOLDT MEMORIAL TRUST Value: At the discretion of the University Further information: BURSARY Duration: One year, renewable The Group Training Manager Tenable at: University of the Witwatersrand Recruitment & Statistics Dept Field of study: Any field of study, but preference to Eligibility. Awarded on the basis of financial need and JCI Limited Engineering, Science, Mathematics, Theology, academic achievement to coloured students PO Box 976 Education, Social Work, Medicine RANDFONTEIN 1760 Service contract: None Value: Varies from R500 to R2 000. Determined by Closing date: 30 September Information not confirmed the Trustees Further information: Duration: 1 year, renewable The Senior Assistant Registrar JEANETTE GOLDMAN TRUST BURSARY Tenable at: Any university or technikon Financial Aid and Scholarships Field of study Physiotherapy Eligibility Matriculants of ESSELEN PARK SENIOR University of the Witwatersrand Value: Amount varies SECONDARY SCHOOL WORCESTER ONLY Private Bag 3 Duration: Maximum of 3 years Service contract: None WITS 2050 Tenable at: University of Cape Town Closing date: 31 January Eligibility. Undergraduate and postgraduate students Further information: JAN DRECHMEIER MEDICAL BURSARY Service contract: None The Bursary officer Johann G Leipoldt Memorial Trust Field of study Medicine (M.B. B.Ch.) Closing date: 31 December SA Inst of Race Relations Value: At the discretion of the University Further information: 5 Long Street Duration: One year, renewable annually subject to The Trustees MOWBRAY 7700 satisfactory academic performance and continued Jeanette Goldman Trust financial need PO Box 206 JOHANNES C. PIETERSE STUDY BURSARY Tenable at: University of the Witwatersrand CAPE TOWN 8000 Eligibility Awarded on the basis of financial need and Field of study: Medicine, Natural Sciences, Theology academic achievement to Indian students JEFFARES AND GREEN, CONSULTING ENGI- Value: Determined annually Service contract: None NEERS BURSARY SCHEME Duration: 1 year, renewal will be considered on merit Closing date: 30 September Field of study. Civil Engineering Tenable at: University of Pretoria Further information: Value: Tuition fees and a monthly allowance for other Eligibility: Awarded on the basis of academic The Senior Assistant Registrar expenses achievement and financial need Financial Aid and Scholarships Duration: 1 year, renewable for the duration of the Service contract: None University of the Witwatersrand course Closing date: 15 October Private Bag 3 Tenable at: Any university or technikon Further information: WITS 2050 Eligibility. Full-time undergraduate or diploma The Head: Study Finance students who have successfully completed their first University of Pretoria JAN LEENDERDT ACHTERBERG BURSARY year of study PRETORIA 0002 Field of study. Science Service contract One year service for each year for JOHANNESBURG CONSOLIDATED INVESTMENT Value: At the discretion of the University which the bursary was granted CO LTD 'JOHNNIES' CATEGORY C BURSARY Duration: One year, renewable annually Closing date: 1 October Tenable at: University of the Witwatersrand Further information: Field of study B.Sc. (Chemistry) (Inorganic); Chemical, Eligibility. Awarded on the basis of financial need and Jeffares and Green Electrical, Metallurgical, Mechanical and Mining academic achievement to white students PO Box 2973 Engineering Service contract: None PRETORIA 0001 Value: Tuition and residence fees, book allowance of Closing date: 30 September Information not confirmed R1 400 and salary including fringe benefits such as Further information: pension and medical aid The Senior Assistant Registrar JO BROWNE TRUST FUND FOR MEDICAL Duration: 1 year, renewable for the duration of the Financial Aid and Scholarships STUDENTS course University of the Witwatersrand Field of study. Medicine Tenable at Any university Private Bag 3 Value: Amount varies Eligibility. Undergraduate students who are SA WITS 2050 Tenable at: Any university residents Eligibility. Awarded on the basis of financial need and Service contract: Required to work for the company JAN THOMAS MARTENS BURSARY merit for a period of one year PRIOR to attending university and to render one year's service for each year for Field of study. Theology Further information: which the bursary was received Value: Amount varies The Trustee Closing date: 31 May Duration: Duration of the course Jo Browne Trust for Medical Students Further information: Tenable at: University of Stellenbosch PO Box 231 The Education and Bursaries Manager Eligibility. Awarded on the basis of financial need and DURBAN 4000 PO Box 976 merit to full-time undergraduate students RANDFONTEIN 1760 Service contract: None JOAN AND LEN STARFIELD FAMILY BURSARY Information not confirmed Closing date: 15 January FUND Further information: Field of study. Medicine (M.B. B.Ch.), Arts, Education JOHANNESBURG CONSOLIDATED INVESTMENT The Registrar. Bursaries and Loans or Science (Teaching); thereafter any other faculty CO LTD (JCI) CATEGORY B BURSARY University of Stellenbosch Value: Tuition fees and, in special cases, residence Private Bag X1 fees Field of study: Chemical, Metallurgical, Mechanical, MATIELAND 7602 Duration: One year, renewable annually on reapplica- Electrical and Mining Engineering; B.Sc. (Chemistry) tion subject to satisfactory academic performance (Inorganic) and Geology JCI LIMITED BURSARY and continued financial need Value: Tuition and residence fees plus annual book and personal allowance of R2 900 Field of study. Chemical, Metallurgical, Electrical, Tenable at: University of the Witwatersrand Duration: 1 year, renewable if progress is satisfactory Mechanical and Mining Engineering; Geology Eligibility. Awarded on the basis of financial need and Tenable at: Any university Value: Tuition and residence fees plus a book academic performance to first-year students of all Eligibility. Undergraduate students who are residents allowance and a personal allowance population groups of SA and who have successfully completed at least Duration: 1 year, renewable if progress is satisfactory Service contract: None one year of study at university Tenable at: Any university or technikon Closing date: 30 September Further information: 200 215 Bursaries Service contract: Work for the company for one year PO Box 912719 Service contract: One year service with Trencor for after graduation SILVERTON 0127 each year for which the bursary was received Closing date: 31 May Information not confirmed Closing date: 30 October Further information: Further information: The Education and Bursary Manager JOHN MICHAEL HANSEN BURSARY The Secretary Dept of Transport Economics JCI Field of study: Medicine Rand Afrikaans University PO Box 976 Value: R600 p.a. RANDFONTEIN 1760 Duration: 1 year, renewable up to 3 years if progress PO Box 524 AUCKLAND PARK 2006 Information not confirmed is satisfactory Tenable at: Universities of Pretoria, Stellenbosch. JOSEPH SINGER BURSARY JOHANNESBURG REPERTORY PLAYERS BURSARY Witwatersrand and the OFS FOR DRAMATIC ART Eligibility: Awarded on the basis of academic Field of study: Law Field of study: B.A. (Dramatic Art) achievement and financial need to undergraduate Value: R500 p.a. Value: Up to a maximum of R1 500 students as from the second year of study Duration: One year, renewable Duration: One year Service contract: None Tenable at: University of the Witwatersrand Tenable at: University of the Witwatersrand Closing date: 15 January Eligibility: Awarded on the basis of financial need and Eligibility: Awarded on the basis of financial need and Further information: academic performance to an LLB. or B.Proc. student. academic performance The registrar of the university concerned B.Proc. student must be registered for the second Service contract: None year of study Closing date: 30 September JOHNSON AND JOHNSON 'PROFESSIONAL Service contract: None Further information: PRODUCTS' BURSARY Closing date: 30 September Further information: The Senior Assistant Registrar Field of study. Medicine, Pharmacy The Senior Assistant Registrar Financial Aid and Scholarships Value: Tuition fees, residence fees (if applicable) Financial Aid and Scholarships University of the Witwatersrand Duration: One year, renewable for the duration of the University of the Witwatersrand Private Bag 3 course Private Bag 3 WITS 2050 Tenable at: University of the Witwatersrand WITS 2050 Eligibility: Awarded on the basis of financial need and JOHANNESBURG TRANSPORT DIVISION (JTD) academic performance to second-year students., JOSSIE ACKERMANN LOAN JOHANNESBURG MUNICIPALITY BURSARY Preference will be given to black students but Field of study: B.Com. (Transport Economics) coloured and Asian students are encouraged to Field of study: Home Economics Value: Registration, tuition and examination fees apply. Preference will also be given to students in Value: Amount varies Duration: 1 year, renewable residence Duration: Minimum duration of the course Tenable at: Rand Afrikaans University Service contract: None Tenable at: Any technikon or university Eligibility: Undergraduate students Closing date: 30 September Eligibility: Students whose mothers are members of Service contract: Vacation work at JTD for holidays Further information: the CWAA longer than 14 days The Senior Assistant Registrar Service contract: None Closing date: 31 August Financial Aid and Scholarships Closing date: 31 July Further information: University of the Witwatersrand Further information: The Secretary Private Bag 3 CWAA Dept of Transport Economics WITS 2050 PO Box 273 Rand Afrikaans University STELLENBOSCH 7599 PO Box 524 JOHNSON AND JOHNSON BURSARY JUNIOR RAPPORTRYERSKORPS KLERKSDORP- AUCKLAND PARK 2006 Field of study: Any field of study excluding Teaching BEURSE Value: Amount varies JOHN DEERE BURSARIES Tenable at: Any university or technikon Field of study: Communication Field of study: Mechanical Engineering, Industrial Eligibility: Undergraduate students Value: R1 500 Engineering, Education Service contract: Depending on the availability of Duration: 1 year Value: Tuition fees vacancies Tenable at: Potchefstroom University for CHE Duration: One year, renewable on reapplication and Closing date: 31 October Eligibility: Full-time undergraduate students who are satisfactory academic progress Further information: Afrikaans-speaking and have passed matric at a high Tenable at: University of the Witwatersrand The Bursary Administrator school in Klerksdorp or Stilfontein Eligibility: Awarded on the basis of financial need and Johnson & Johnson (Pty) Limited Service contract: None academic performance to a student registered for the P 0 Box 727 Closing date: 15 October second or third year of study who is not of the white EAST LONDON 5200 Further information: population group. Preference will be given to a The Director student who resides in Duduza JOSEPH GRANELLI BURSARY Dept Bursaries & Loans PU for CHE Service contract: None Field of study: Medicine POTCHEFSTROOM 2520 Closing date: 30 September Value: Amount varies Further information: Tenable at: University of Stellenbosch JUTA BURSARIES The Senior Assistant Registrar Eligibility: Awarded on the basis of financial need and Financial Aid and Scholarships academic merit to students as from their second year Field of study: Law, Accounting, Medicine, Commerce University of the Witwatersrand of study Value: Approximately R2 000 Private Bag 3 Service contract: None Duration: 1 year WITS 2050 Closing date: 15 January Tenable at: Universities of Stellenbosch, Rhodes, Further information: Venda, Witwatersrand and Western Cape JOHN DEERE BURSARY The Asst Registrar Eligibility: Awarded on the basis of financial need and Field of study: Agricultural Engineering Tygerberg Campus academic merit to a student as from the second year Value: R2 000 each p.a. PO Box 19063 of study Duration: 1 year, renewable if progress is satisfactory TYGERBERG 7505 Service contract: None Tenable at: University of Pretoria, University of Natal Closing date: Contact the university concerned Eligibility: Undergraduate students from the second JOSEPH JOWELL BURSARY Further information: The Registrar (Bursaries and Loans) of the university year of study Field of study: Transport Economics concerned Service contract: None Value: R5 000 p.a. Closing date: 28 February Duration: 1 year, renewable Further information: Tenable at: Rand Afrikaans University The Secretary Eligibility: Full-time undergraduate and postgraduate SA Inst of Agricultural Engineers students 216 Bursaries 201 KAGISO TRUST BURSARIES Eligibility. Undergraduate students Closing date: 31 October Service contract. Is required Further information: Field of study: Priority will be given to Natural Closing date: 31 July Mr R Karsen Science-based subjects, Commerce, Law, Architec- Further information: Ken Stephens Construction ture, Teacher Training, Health Sciences, Communica- The Personnel Manager PO Box 78 tion, Social Work Karbochem division of Sentrachem RONDEBOSCH 7700 Value: Registration, tuition and residence fees plus Private Bag X25 Information not confirmed books. Awards are granted on the basis of 60% grant BRYANSTON 2021 and 40% loan KESSEL FEINSTEIN BURSARIES (CHARTERED Duration: 1 year, renewable depending on successful academic performance and availability of funds KAS VIR TEOLOGIESE STUDENTE-BEURSE ACCOUNTANTS) Tenable at Any university or technikon Field of study Theology Field of study. A degree leading towards the qualifi- Eligibility: Awarded to undergraduate SA citizens from Value: Amount varies cation of Chartered Accountant (SA) disadvantaged backgrounds who display leadership Duration: 1 year Value: R5 000 p.a. and academic potential Tenable at: Potchefstroom University for CHE Duration: One year, renewable until completion of Service contract: None Eligibility. Full-time undergraduate students of the degree if progress is satisfactory Closing date: Contact the institution concerned Reformed Church Tenable at: Any university Further information: Service contract: None Eligibility. Awarded on the basis of academic merit to The bursary office of the institution concerned Closing date: 15 October full-time students Further information: Service contract: Must serve traineeship of three years KANGWANE MEDICAL BURSARIES The Registrar with Kessel Feinstein as prescribed by the Public School for Theology Accountants and Auditors Board Field of study. Medicine Closing date: 31 August Value: R12 000 PU for CHE Further information: Duration: 1 year POTCHEFSTROOM 2520 The Human Resources Manager Tenable at: University of Natal Kessel Feinstein Eligibility. Awarded on the basis of academic merit KAT BURSARY Private Bag X28 and financial need to undergraduate students Field of study. Drama BENMORE 2010 Service contract On completion of degree, student is Value: R400 expected to work for KaNgwane Department of Duration: 1 year KHOLVAD MADRESSA FUND Health Tenable at: University of Stellenbosch Closing date: 31 October Eligibility. Undergraduate students, excluding first- Field of study Medicine (any degree in the faculty) Further information: year students Value: Approximately R2 000 The Secretary Service contract: None Duration: One year, renewable subject to satisfactory Public Service Commission Closing date: 15 January academic performance and continued financial need Private Bag X1007 Further information: Tenable at University of the Witwatersrand LOUWS CREEK 1302 The Registrar (Bursaries and Loans) Eligibility. Awarded on the basis of financial need and Information not confirmed University of Stellenbosch academic performance to students from an under- Private Bag X1 priveleged background KANTEY AND TEMPLER BURSARY MATIELAND 7602 Service contract: None Closing date: 30 September Field of study. Civil Engineering Further information: Value: Tuition fees KATHLEEN ALISTER HARP SCHOLARSHIP The Senior Assistant Registrar Duration: 1 year, renewable for a maximum of 3 Field of study Music (Harp) Financial Aid and Scholarships years Value: At the discretion of the University University of the Witwatersrand Tenable at Any university in South Africa Duration: 1 year, renewable Eligibility. Undergraduate students from the first year Tenable at: University of the Witwatersrand Private Bag 3 WITS 2050 of study onwards Eligibility. Awarded on the basis of academic merit Service contract: Compulsory vacation training with Service contract: None KIRKNESS SCHOLARSHIP the donor and six months service for each year for Closing date: 10 January which the bursary was received Further information: Field of study. Architecture, Building, Civil, Electronic Closing date: 31 July The Financial Aid Office and Mechanical Engineering and Town and Regional Further information: University of the Witwatersrand Planning Kantey & Templer Private Bag 3 Value: Amount varies PO Box 3132 WITS 2050 Duration: 1 year CAPE TOWN 8000 Tenable at Any tertiary institution KEMPTON PARK CITY COUNCIL BURSARY Eligibility. Old boys from Pretoria Boys High School KAPLAN CENTRE AWARD IN JEWISH EDUCA- SCHEME (LOCAL GOVERNMENT) only, as from their second year of study TION Field of study. Local Government Service contract None Closing date: End of the year Field of study. Jewish and/or Hebraic studies, Value: Tuition and residence fees of up to R11 000 Further information: B.Prim.Ed, BA or HED Duration: Duration of the course The Bursary Committee Value: RI 500 Tenable at: Any university or technikon in South Africa Pretoria Boys High School Duration: 1 year, renewable Eligibility Full-time students who are permanent Roper Street Tenable at University of Cape Town residents of Kempton Park BROOKLYN 0181 Eligibility Students in any year of study who are Service contract Is required prospective teachers of Jewish and/or Hebraic studies Closing date: End of October KPMG SCHOLARSHIP (CHARTERED ACCOUNT- Closing date: 31 January Further information: ANTS) Further information: Head The Administrative Director Management Field of study. A degree leading towards the qualifi- Kaplan Centre forJewish Studies Kempton Park City Council cation of Chartered Accountant (SA) UCT PO Box 13 Value: Tuition fees up to a maximum of R5 000 Private Bag KEMPTON PARK 1620 Duration: 1 year, renewable subject to satisfactory RONDEBOSCH 7701 Information not confirmed progress and performance Tenable at: Any university in South Africa KARBOCHEM BURSARY KEN STEPHENS CONSTRUCTION BURSARY Eligibility. Awarded on the basis of academic merit to full-time students Field of study. Chemistry Field of study: Civil Engineering Service contract: Must serve a training contract of Value: Tuition and residence fees plus books and Value: Amount varies three years with the South African office of KPMG pocket money Tenable at: Peninsula Technikon Closing date: None Duration: 1 year, renewable Eligibility Diploma students Further information: Tenable at Any university or technikon in South Africa Service contract. None 202 Bursaries The Staff Partner Service contract None WITS 2050 KPMG Closing date: 30 September PO Box 7400 Further information: LEO AND SARA BUCHEN SCHOLARSHIPS JOHANNESBURG 2000 The Senior Assistant Registrar Field of study: Medicine (all degrees) Financial Aid and Scholarships Value: At the discretion of the University KWA-DUKUZA/STANGER TRANSITIONAL University of the Witwatersrand Duration: One year, renewable LOCAL COUNCIL Private Bag 3 Tenable at: University of the Witwatersrand WITS 2050 Field of study: All diploma and degree courses Eligibility. Awarded on the basis of financial need and Value: R1 000 each p.a. academic performance LANGELER SCHOLARSHIP Duration: 1 year Service contracr. None Tenable at: Any registered university, technikon or Field of study: Engineering Closing date: 30 September college Value: At the discretion of the University Further information: Eligibility: Full-time students who have successfully Duration: 1 year, renewable for a maximum of 4 The Senior Assistant Registrar completed matric and whose parents are ratepayers years provided the scholarship standard has been Financial Aid and Scholarships and/or residents of Kwa-Dukuza/Stanger maintained University of the Witwatersrand Service contract: None Tenable at: University of the Witwatersrand Private Bag 3 Closing date: Advertised in the local newspaper in Eligibility. Awarded on the basis of academic merit to WITS 2050 January of every year a matriculant entering university for the first time Further information: Service contract None LEONTINE SAGAN SCHOLARSHIP The Chief Executive Town Clerk Closing date: 10 January Field of study. Dramatic Art Kwa-Dukuza/Stanger T L C Further information: Value: At the discretion of the University PO Box 72 The Financial Aid Office Duration: 1 year, renewable STANGER 4450 University of the Witwatersrand Tenable at: University of the Witwatersrand P/Bag 3 Eligibility Awarded on the basis of financial need and KWAZULU-NATAL PROVINCIAL ADMINISTRA- WITS 2050 academic performance to students who have TION BURSARY SCHEME successfully completed the first year of study towards LATE G.A. NIVEN TRUST VETERINARY BURSARY Field of study Medicine the degree of BA (Dramatic Art) Value: Amount varies Field of study: Veterinary Science Service contract None Duration: I year Value: Determined annually Closing date: 30 September Tenable at: University of Pretoria Duration: 1 year Further information: Eligibility. Full-time students as from the first year of Tenable at University of Pretoria The Senior Assistant Registrar study Eligibility. Full-time undergraduate students from the Financial Aid and Scholarships Closing date: 7 October third year onwards on recommendation of the Faculty University of the Witwatersrand Further information: of Veterinary Science Private Bag 3 The Secretary Service contract: None WITS 2050 Health Services Closing date: 15 October Private Bag X9051 Further information: LEOPOLD PREMYSLAV BURSARY PIETERMARITZBURG 3200 The Head (Financial Assistance) Field of study. Music University of Pretoria Value: Variable KWEEKSKOOL BEURSE EN LENINGS PRETORIA 0002 Duration: 1 year Field of study: Theology Tenable at University of the Western Cape LAURENCE DAVID ADLER BURSARY Value: R2 000 R10 000 Eligibility. Full-time students on the basis of academic Duration: 1 year Field of study Medicine (any undergraduate degree achievement and financial need Tenable at University of Stellenbosch course) Closing date: First-year students: 1 March: current Eligibility. Students in Theology (B.Th. and B.D.) Value: At the discretion of the University students: 31 October Closing date: After the opening of the academic year Duration: One year, renewable Further information: Further information: Tenable at University of the Witwatersrand The Registrar The Church Secretary Eligibility Awarded on the basis of financial need and University of the Western Cape Theological Seminary academic performance. Special consideration will be Private Bag X17 171 Dorp Street given to B.Pharrn. and B.Nursing students and BELLV1LLE 7535 STELLENBOSCH 7600 students from underprivileged backgrounds Information not confirmed Service contract. None LESLIE HILL HIGHER EDUCATION TRUST Closing date: 30 September Field of study Any field of study with preference to KWV UNDERGRADUATE BURSARY Further information: Commerce, Natural Science and Technological The Senior Assistant Registrar Field of study Viticulture, Oenology and Chemistry courses Financial Aid and Scholarships Value: Tuition, registration and residence fees Value: Amount varies University of the Witwatersrand Duration: Duration of the course Duration: 1 year, renewable if progress is satisfactory Private Bag 3 Tenable at: University of Stellenbosch, University of Tenable at Any university, technikon, teacher's WITS 2050 CapP Town training college or technical college Eligibility. Awarded on the basis of potential to Eligibility. Undergraduate students LAZAR RAVID MEMORIAL SCHOLARSHIP Service contract: One year service for each year for students who are domiciled in the Western Cape which the bursary was received Field of study. Medicine (M.B. B.Ch.) Service contract None Closing date: 31 July Value: At the discretion of the University Closing date: 31 October Further information: Duration: One year, renewable annually for the Further information: Human Resources duration of the course subject to satisfactory progress The Bursary Secretary SA Institute of Race Relations KWV Tenable at University of the Witwatersrand PO Box 528 Eligibility. Awarded on the basis of financial need and 5 Long Street SOUTHERN-PAARL 7624 academic performance to a student of good character MOWBRAY 7700 and intellect irrespective of colour, race or creed who L. COHEN BURSARY as successfully completed the first year of study LESOTHO GOVERNMENT BURSARY Service contract None Field of study. B.Sc. (Building Science) Reid of study: Medicine Closing date: 30 September Value: Tuition and accommodation fees Value: Approximately R300 Further information: Duration: One year, renewable Duration: 1 year The Senior Assistant Registrar Tenable at: University of the Witwatersrand Tenable at: University of Natal Financial Aid and Scholarships Eligibility: Awarded on the basis of financial need and Eligibility M.B., Ch.B. students University of the Witwatersrand academic performance to a full-time student in any Service contract: None Private Bag 3 year of study Closing date: 31 October 203- Further information: PO Box 10499 Further information: The Secretary JOHANNESBURG 2000 The Registrar (Finance) Public Service Commission Rand Afrikaans University PO Box X517 LIEBENBERG AND STANDER WESTERN CAPE PTY PO Box 524 100 Maseru LTD BURSARY AUCKLAND PARK 2006 LESOTHO Field of study. Civil Engineering LTA LTD BURSARY SCHEME Information not confirmed Value: Tuition fees only or as agreed with the successful! applicant Field of study. Civil Engineering LEVI AND BESSIE JONES BURSARIES Duration: 1 year, renewable annually depending on Value: Tuition and residence fees plus book allow- Field of study Natural Sciences examination success ance Value: Variable Tenable at: Any SA university Duration: 1 year, renewable annually Duration: 1 year Eligibility Awarded on the basis of academic merit to Tenable at: Any tertiary institution Tenable at: University of Stellenbosch SA citizens with above average marks in Mathematics, Eligibility. Awarded on the basis of academic merit Eligibility. Awarded on the basis of merit and financial Natural Science and languages at matric level and suitability as future employee to undergraduate need Service contract: One year service for each year for students. Preference given to SA citizens Closing date: 15 January which the bursary was awarded. Vacation employ- Service contract: Six months service for each year for Further information: ment is compulsory which the bursary was awarded. Compulsory vacation The Registrar (Bursaries & Loans) Closing date: 30 October training is also required University of Stellenbosch Further information: Closing date: 31 July P/Bag Xl The Personnel Manager Further information: MATIELAND 7602 PO Box 4733 The Bursaries Department CAPE TOWN 8000 LTA Civil and Earth Works LEZA LEGALWISE BURSARY PO Box 2994 LIGHT HOUSE CLUB BURSARY KEMPTON PARK 1620 Field of study. Law Value: Approximately R5 000 Field of study. Civil Engineering, Construction, LUKAS HAVENGA BURSARY Duration: One year, renewable on reapplication Architecture and Building subject to continued financial need and satisfactory Value: R600 Field of study. BA (Theology) academic performance Duration: 1 year Value: Approximately R600 p.a. Tenable at University of the Witwatersrand Tenable at: Cape Technikon Duration: Duration of the course Eligibility Awarded on the basis of financial need and Eligibility Awarded to needy students Tenable at University of Stellenbosch academic performance. Students/parents to be Leza Closing date: 31 January Eligibility Awarded on the basis of financial need and Legalwise Policy holders Further information: academic merit to a first-year student Service contract: None The Registrar Service contract: None Closing date: 30 September Cape Technikon Closing date: 15 January Further information: PO Box 652 Further information: The Senior Assistant Registrar CAPE TOWN 8000 The Registrar (Bursaries and Loans) Financial Aid and Scholarships University of Stellenbosch University of the Witwatersrand LILITHEA SINGER ART FORUM BURSARY P/Bag Xl MAT1ELAND 7602 Private Bag 3 Field of study. Arts WITS 2050 Value: R250 LUKIN BURSARY Duration: One year, renewable annually for the LIBERO FATTI MEDICAL BURSARY FUND duration of the course subject to satisfactory progress Field of study. Professional, Commercial and Techni- Field of study Medicine (M.B. B.Ch.) Tenable at: University of the Witwatersrand cal fields Value: At the discretion of the University Eligibility Awarded on the basis of financial need and Value: Amount varies Duration: One year, renewable academic performance to a student who has Duration: I year Tenable at: University of the Witwatersrand completed the first year of study Tenable at: Potchefstroom University for CHE Eligibility. Awarded on the basis of financial need and Service contract: None Eligibility. Awarded to the sons of citizens of the academic performance Closing date: 30 September Republic of SA who served in the navy, army or air Service contract: None Further information: force of the United Kingdom during the 1914-1918 Closing date: 30 September The Senior Assistant Registrar war. If there are no such applications the bursary may Further information: Financial Aid and Scholarships be awarded to sons of citizens who serve or served in The Senior Assistant Registrar University of the Witwatersrand the Permanent Force . Financial Aid and Scholarships Private Bag 3 Service contract. None University of the Witwatersrand WITS 2050 Closing date: 15 January Private Bag 3 Further information: WITS 2050 LION MATCH COMPANY BURSARY The Head of Staff Personnel Private Bag X159 Field of study: Commerce and Natural Science PRETORIA 0001 LIBERTY LIFE BURSARY SCHEME Value: Approximately R600 p.a. Information not confirmed Field of study Actuarial Science and Computer Duration: 1 year, renewable Tenable at: All institutions Science LUTHER FIELD VETERINARY TRUST (BURSARY) Value: Tuition and residence fees plus a book Eligibility. Undergraduate students who are SA allowance citizens Field of study. Veterinary Science Duration: Renewable annually for the duration of the Service contract: None Value: Determined annually course Closing date: 30 September Duration: 1 year Tenable at: Universities of Pretoria, Witwatersrand and Further information: Tenable at University of Pretoria Rand Afrikaans University The Personnel Officer Eligibility Awarded to full-time undergraduate Eligibility. Awarded on the basis of academic PO Box 918 students from the second year onwards on the basis achievement (a distinction in Mathematics HG and a DURBAN 4000 of achievement and financial need. Preference given further distinction for any other HG subject). Partici- to students from Natal. Awards granted on the pation in extra-mural activities i.e. member of prefect LOEKIE ODENDAAL BURSARY recommendation of the Faculty of Veterinary Science Service contract: None body, debating society, maths olympiads, science Field of study. Engineering Closing date: 15 October olympiads, school/university newspaper, sports etc. Value: Determined annually Further information: Service contract: One and a half year's service for each Duration: 1 year, renewable The Head (Study Finance) year for which the bursary was awarded Tenable at: Rand Afrikaans University University of Pretoria Closing date: 31 August Eligibility. Awarded on the basis of academic merit to Further information: full-time undergraduate and postgraduate students PRETORIA 0002 Bursary Administrator Oosing date: 15 November Bursaries M.E.I. CONSTRUCTION TRAINEE TECHNICIAN MAGGIE LAUBSER LOCAL BURSARY Service contract: None SCHEME Field of study. Fine Arts Closing date: 30 September Further information: Field of study Mechanical Engineering and Electrical Value: Amount varies The Senior Assistant Registrar Engineering (Heavy current) Duration: 1 year Financial Aid and Scholarships Value: Amount varies Tenable at: University of Stellenbosch University of the Witwatersrand Duration: 1 year Eligibility. Awarded on the basis of financial need Private Bag 3 Tenable at Technikon Witwatersrand (first-year students excluded) with preference to WITS 2050 Eligibility Technikon students more advanced students in Painting Service contract: Is required Service contract: None MARGARET THOMSEN SCHOLARSHIP Closing date: 30 September Closing date: 31 August Further information: Further information: Field of study Architecture MEI Construction Trainee The Registrar (Bursaries and Loans) Value: At the discretion of the University Technician Scheme University of Stellenbosch Duration: One year, renewable up to a maximum of 3 PO Box 14101 P/Bag Xl years WADEVILLE 1422 MAllELAND 7602 Tenable at: University of the Witwatersrand Information not confirmed Eligibility. Awarded on the basis of financial need and MAGWA TEA CORPORATION BURSARY SCHEME academic performance to students in any year of M.F. ESMONDE-WHITE BURSARIES Field of study. B.Com. (Accounting) or Mechanical study Service contract: None Field of study. Medicine (M.B. B.Ch.) Engineering Closing date: 30 September Value: At the discretion of the University Value: Tuition, residence and book fees Further information: Duration: 1 year, renewable Duration: 1 year, renewable for duration of the course The Senior Assistant Registrar Tenable at: University of the Witwatersrand if progress is satisfactory Financial Aid and Scholarships Eligibility Awarded on the basis of financial need and Tenable at: Universities of Fort Hare, Natal and Cape University of the Witwatersrand academic merit to black woman students Town Private Bag 3 Service contract: None Eligibility. SA students WETS 2050 Closing date: 30 September Service contract: One year service for each year for Further information: which the bursary was received MARILYN LOUW SCHOLARSHIPS The Senior Assistant Registrar Closing date: 31 October Financial Aid & Scholarships Further information: Field of study English University of the Witwatersrand The Human Resource Manager Value: Amount varies Private Bag 3 Magwa Tea Corporation Duration: 1 year WITS 2050 Private Bag X6027 Tenable at University of Stellenbosch UMTATA 5100 Eligibility. Awarded on the basis of financial need as M.L. SULTAN TECHNIKON BURSARIES Information not confirmed well as academic and sport achievements Closing date: 15 January Field of study Contact the Technikon MANGOSUTHU TECHNIKON ACADEMIC Further information: Tenable at: M.L Sultan Technikon The Registrar (Bursaries and Loans) Eligibility Awarded on the basis of academic merit ACHIEVEMENT AWARDS University of Stellenbosch and financial need to full-time registered students Field of study. Contact the Technikon PO Box X1 Closing date: Contact the Technikon Duration: 1 semester MAT1ELAND 7602 Further information: Tenable at Mangosuthu Technikon The Bursary Officer Eligibility Awarded on the basis of academic MAKIORIE HOCKEN BURSARY ML Sultan Technikon achievement to students from disadvantaged PO Box 1334 backgrounds Field of study. Any field of study except the field DURBAN 4000 Closing date: First semester: 31 October of the which includes experiments with animals previous year; second semester: 30 April Value: Amount varies MABEL QUICK BURSARY Further information: Duration: 1 year, renewable if progress is satisfactory The Head Tenable at University of Stellenbosch Field of study. Music and Singing Financial Aid Bureau Eligibility. Awarded on the basis of financial need and Value: R4 000 Mangosuthu Technikon merit to full-time undergraduate students Duration: 1 year PO Box 12363 Service contract: None Tenable at University of Stellenbosch Closing date: 15 January Eligibility Prospective and registered students. Award JACOBS 4026 Further information: is made on a competitive basis MANGOSUTHU TECHNIKON SPORTS AWARDS The Registrar (Bursaries and Loans) Service contract: None University of Stellenbosch Closing date: 30 September Field of study. Contact the Technikon Private Bag Xl Further information: Duration: 1 semester MAllELAND 7602 The Chairperson Tenable at: Mangosuthu Technikon Dept of Music Eligibility The student shall at least represent the MARLEY BURSARY University of Stellenbosch Kwazulu Natal Province in a specific sports code P/Bag X1 Closing date: First semester: 31 October of the Field of study Architecture (B.Arch./BAS) MATIELAND 7602 previous year; second semester: 30 April Value: Amount varies Further information: Duration: 1 year, renewable subject to satisfactory MAGDALENA GRUNDLING TRUST The Head performance and conduct Financial Aid Bureau Tenable at: University of the Witwatersrand Field of study Theology Mangosuthu Technikon Eligibility. Awarded on the basis of financial need and Value: Amount varies PO Box 12363 satisfactory academic performance to matriculants or Duration: 1 year students in any year of study Tenable at University of Stellenbosch JACOBS 4026 Service contract: None Eligibility. Undergraduate students who are members Closing date: 30 September of the Dutch Reformed Church and who are residents MARGARET GIBSON BURSARY FUND Further information: of Oudtshoorn West Field of study Medicine (M.B. B.Ch.) or Science The Senior Assistant Registrar Service contract: None Value: At the discretion of the University Financial Aid & Scholarships Closing date: 15 February Duration: One year, renewable annually for a University of the Witwatersrand Further information: maximum of 3 years subject to satisfactory progress Private Bag 3 The Trustee and conduct WITS 2050 M Grundling Trust Tenable at: University of the Witwatersrand Eligibility Awarded on the basis of financial need and PO Box 1260 MARY AND LOUIS GOLDFOOT SCHOLARSHIPS SANLAMHOF 7532 academic performance to students in any year of study Field of study. Medicine (M.B. B.Ch. or Dentistry (BDS)) 220 205 Value: At the discretion of the University Further information: MAX FELDMAN BURSARY Duration: 1 year, renewable for a maximum of 4 The Secretary Field of study. Medicine (M.B. B.Ch.) years subject to satisfactory progress ROGU Value: Up to R600 Tenable at University of the Witwatersrand C/o Rustenburg High School for Girls Duration: 1 year, renewable Eligibility. Awarded on the basis of financial need and Camp Ground Road Tenable at. University of the Witwatersrand satisfactory academic progress RONDEBOSCH 7700 Eligibility Awarded on the basis of financial need and Service contract None satisfactory academic progress to undergraduate Closing date: 30 September MAX AND LOUISE ACKERMANN BURSARIES FOR students Further information: AFRIKAANS Service contract: None The Senior Assistant Registrar Field of study Afrikaans Closing date: 30 September Financial Aid & Scholarships Value: Amount varies (111 000 pa. maximum) Further information: University of the Witwatersrand Duration: 3 years The Senior Assistant Registrar Private Bag 3 Tenable at: University of Stellenbosch Financial Aid & Scholarships WITS 2050 Eligibility. White, Afrikaans-speaking, nationally University of the Witwatersrand inclined, Christian, male, first-year students who Private Bag 3 MARY GORDON BURSARY obtained outstanding marks in Afrikaans. Bursar WITS 2050 Field of study. Medicine (M.B. B.Ch.) should take Afrikaans as major subject for his degree Value: At the discretion of the University Service contract: None MECHANICAL ENGINEERING (ANONYMOUS Duration: 1 year, renewable Closing date: 15 January DONOR) Tenable at: University of the Witwatersrand Further information: Field of study Mechanical Engineering Eligibility Awarded on the basis of financial need and The Registrar (Bursaries and Loans) Value: Amount varies satisfactory academic progress to a matriculant or University of Stellenbosch Duration: 1 year student in any year of study Private Bag X1 Tenable at University of Stellenbosch Service contract: None MAT1ELAND 7602 Eligibility. Awarded on the basis of academic Closing date: 30 September achievement and financial need Further information: MAX AND LOUISE ACKERMANN BURSARIES FOR Service contract: None The Senior Assistant Registrar HOME ECONOMICS Closing date: 15 January Financial Aid & Scholarships Field of study Home Economics Further information: University of the Witwatersrand Value: Amount varies The Registrar. Bursaries and Loans Private Bag 3 Duration: Duration of the course University of Stellenbosch WITS 2050 Tenable at University of Stellenbosch Private Bag X1 Eligibility. White, Afrikaans-speaking, nationally MAT1ELAND 7602 MAUDE CATHERINE BIRD MEMORIAL SCHOL- inclined, Christian female first-year students ARSHIPS Service contract: None MEDICAL ASSOCIATION OF SA ( TYGERBERG Field of study Arts or Natural Science Closing date: 15 January BOLAND) BURSARY Value: R600 Further information: Field of study. Medicine Duration: 1 year, renewable for a maximum of 4 The Registrar (Bursaries and Loans) Value: R500 years subject to satisfactory progress University of Stellenbosch Duration: 1 year Tenable at University of the Witwatersrand Private Bag X1 Tenable at University of Stellenbosch Eligibility. Awarded on the basis of financial need and MAT1ELAND 7602 Eligibility. Awarded on the basis of financial need and satisfactory academic progress to white English- merit to a third-year student speaking South Africans (by birth or naturalisation). MAX AND LOUISE ACKERMANN LOANS FOR Service contract None Preference to applicants who intend to become MEDICINE Closing date: 15 January school teachers or university lecturers Field of study Medicine Further information: Service contract: None Value: R1 100 The Assistant Registrar Closing date: 30 September Duration: 1 year Tygerberg Campus Further information: Tenable at University of Stellenbosch PO Box 19063 The Senior Assistant Registrar Eligibility. Christian, white, Afrikaans-speaking, TYGERBERG 7505 Financial Aid & Scholarships nationally inclined male students University of the Witwatersrand Service contract: None MEDICAL ASSOCIATION OF SA BURSARY Private Bag 3 Closing date: I 5January Field of study. Medicine WITS 2050 Further information: Value: R6 000 p.a. The Assistant Registrar Duration: 3 years MAUERBERGER BURSARY Tygerberg-kampus Tenable at: Any university in South Africa Field of study. Dentistry PO Box 19063 Eligibility. Prospective medical students Value: Amount varies TYGERBERG 7505 Service contract: Results must be satisfactory after Duration: 1 year each year Tenable at. University of Stellenbosch MAX AND WINNIE SALOMON MEMORIAL Closing date: 15 September tligibility. Awarded on the basis of financial need and BURSARY Further information: merit Field of study. Natural Sciences The Bursary Officer Service contract None Value: Amount varies Medical Association of South Africa Closing date: 15 January Duration: 1 year, renewable subject to satisfactory PO Box 20272 Further information: progress and continued financial need ALKANTRANT 0005 The Registrar (Bursaries and Loans) Tenable at Rhodes University University of Stellenbosch Eligibility. Awarded on the basis of financial need to MEDICAL ASSOCIATION OF SA LOWVELD P/Bag X1 any South African-bom student who has successfully BRANCH MEDICAL BURSARY MAT1ELAND 7602 completed the first year of B.Sc. (majoring in Chemis- Field of study. Medicine try) and who has done well in Chemistry Value: R2 000 p.a. MAVIS WAKEFORD BURSARY Service contract: None Duration: 1 year, renewable for fourth year of study if Field of study. Teaching Closing date: 1 December progress is satisfactory Value: R4 000 p.a. Further information: Tenable at University of the OFS Duration: 1 year, renewable up to 4 years maximum The Financial Aid Officer Eligibility. Undergraduate third-year students who Tenable at Any university or college Rhodes University matriculated within the boundaries of the MASA Eligibility. Past pupils of Rustenburg High School for PO Box 94 Lowveld Branch, or whose parents lived there during Girls in any year of study GRAHAMSTOWN 6140 the students' high school careers Service contract: None Information not confirmed Service contract: None Closing date: 31 July Closing date: 30 November Further information: Alisa Hide Value: RS00 Duration: 1 year The Dean ISU Campus ` Tenable at University of the Witwatersrand Faculty of Medicine 13th Floor BP Centre Eligibility. Awarded on the basis of outstanding sports University of the OFS Thibault Square achievement and adequate academic performance to PO Box 339 CAPE TOWN 8001 third- and fourth-year students studying towards a BLOEMFONTEIN 9300 MIEN HAMMERSMA BURSARY FOR SINGING B.Sc. (Engineering) degree Service contract: None MEDICAL EDUCATION FOR SA BLACKS (MESAS) Field of study: Singing Closing date: 10 January BURSARY Value: Amount varies Further information: Duration: 1 year Field of study. All medical related disciplines e.g. Financial Aid & Scholarship Office Tenable at: Potchefstroom University for CHE Medicine, Dentistry, Physiotherapy, Occupational University of the Witwatersrand Eligibility. A promising undergraduate student in Therapy, Nursing, Nutrition. Pharmacy P/Bag 3 singing Value: Amount varies WITS 2050 Duration: 1 year, renewable Closing date: 30 September Further information: Tenable at: Universities of the Western Cape, OFS, PU MIMI COERTZE BURSARY for CHE, Stellenbosch, Rhodes, North West The Head Eligibility: Awarded on the basis of financial need and Dept of Music Field of study: Human Sciences academic achievement to full-time undergraduate PU for CHE Value: R860 to R8 030 p.a. Duration: 1 year, renewable students P/Bag X6001 Tenable at: Rand Afrikaans University Service contract: None POTCHEFSIROOM 2520 Eligibility. Awarded on the basis of financial need and Closing date: Contact the university concerned merit to undergraduate and postgraduate students Further information: MIG SULTER MEMORIAL FUND BURSARY Closing date: 15 November The Registrar of the university concerned Field of study. Land Surveying Further information: Value: Tuition only The Registrar (Finance) MEDICAL GRADUATES' ASSOCIATION BURSARY Duration: 1 year, renewable (4 years maximum) Rand Afrikaans University Tenable at: University of Cape Town Field of study Medicine (all degree courses offered by PO Box 524 Eligibility: SA citizens in any year of study the faculty, M.B. B.Ch. and the allied medical disci- AUCKLAND PARK 2006 plines included) Service contract: None Closing date: 31 December Value: Full tuition fees and R500 towards cost of MINTEK BURSARY books Further information: Field of study. Chemistry (Analytical, Physical, Duration: 1 year, renewable upon reapplication SA Council for Surveyors Inorganic); Metallurgy (Extractive, Physical); Engineer- subject to satisfactory progress and continued Mig Sulter Memorial Fund ing (Materials, Metallurgical, Chemical, Electri- financial need PO Box 62041 cal/Electronic); Mineralogy; Geology; Physics Tenable at: University of the Witwatersrand MARSHALLTOWN 2107 Value: Tuition and residence fees plus an allowance Eligibility. Awarded on the basis of financial need and Information not confirmed academic merit to undergraduate students of South for books Duration: Duration of the course (maximum of 4 African birth MIKE AND HANNAH AMOILS MEDICAL BUR- years) if progress is satisfactory Service contract: None SARY FUND Tenable at: Any recognised university or technikon in Closing date: 30 September Field of study: Medicine (M.B. B.Ch.) South Africa Further information: Value: Approximately R5 000 p.a. Eligibility Awarded on the basis of academic merit The Senior Assistant Registrar Duration: I year, renewable on reapplication for the (according to Mintek standards) to any SA citizen in Financial Aid & Scholarships duration of the course subject to continued financial any year of study, including Honours University of the Witwatersrand need and satisfactory academic performance Service contract: Six months service for each year for Private Bag 3 Tenable at: University of the Witwatersrand which the bursary was received WITS 2050 Eligibility Awarded on the basis of financial need and Closing date: 30 April satisfactory academic performance to a SA citizen or a Further information: MER-NATIONAL BURSARY permanent resident whose parents are also living in The Head: Recruitment South Africa and who undertake to remain in SA for at Field of study. Medicine Human Resources Division least 6 years after qualification Value: R2 500 for the semifinal year; R1 500 for the Mintek Service contract None final year Private Bag X3015 Closing date: 30 September Duration: 1 year, renewable if progress is satisfactory RANDBURG 2125 Tenable at: University of the OFS Further information: Information not confirmed Eligibility. Medical students in their semifinal or final The Senior Assistant Registrar year of study Financial Aid & Scholarships MOBIL OIL REFINING DIVISION STUDY GRANT Closing date: 31 October University of the Witwatersrand Field of study. Chemical, Electrical and Mechanical Further information: Private Bag 3 Engineering The Faculty of Medicine WITS 2050 Value: Amount varies UOFS Tenable at: Any university in SA PO Box 339 MILLNER'S DENTAL SUPPLIERS BURSARY Eligibility: Full-time undergraduate students BLOEMFONTEIN 9301 Field of study: Dentistry Service contract: 2 years Value: Amount varies Closing date: 31 May MICROSOFT APPRENTICESHIP PROGRAMME Duration: 1 year Further information: EDUCATIONAL TRUST (MAPET) Tenable at University of the Western Cape The Study Grant Co-ordinator Eligibility. Awarded on the basis of financial need and Field of study: Microsoft Certified Systems Engineer Engen Refinery academic merit to full-time undergraduate students (MCSE) PO Box 956 Service contract: None Value: R35 000 which covers a year's tuition and an DURBAN 4000 Closing date: First-year students I March; seniors 3I allowance of R1 000 per month Information not confirmed Duration: 1 year October of the previous year Tenable at: ISU Campus Further information: MOLTENO BROTHERS BURSARY Eligibility. Apprentices between the ages of 18 25 Financial Aid Office with Mathematics and English (read, write and speak University of the Western Cape Field of study: Horticulture Value: Amount varies well) from disadvantaged backgrounds (defined as Private Bag X17 Duration: 1 year people who are unemployed or under-employed and BELLVILLE 7535 Tenable at: Cape Technikon cannot afford to undertake this level of training) Eligibility. Awarded on the basis of merit Service contract: Is required MILTON ALUMNI ENGINEERING SPORTS Closing date: 1st semester: 31 January; 2nd semester: Closing date: Any time BURSARY I 31 July Further information: Field of study. Engineering 222 R eIrc a ries 207 Further information: Murray & Roberts Buildings (Pty) Ltd The Registrar PO Box 8212 MYRA CHAPMAN EDUCATIONAL TRUST Cape Technikon ELANDSFONTEIN 1406 (BURSARY) PO Box 652 Field of study. Music CAPE TOWN 8000 MURRAY AND ROBERTS CONTRACTORS Value: RI 000 or R2 000 BURSARY LOAN SCHEME Duration: Maximum of 3 years MONSANTO BURSARY Field of study B.Com. (Accounting); Electrical, Civil, Tenable at: University of the Western Cape, University Field of study Natural Sciences Industrial and Mechanical Engineering of Stellenbosch Value: R18 000 Value: Tuition, residence and book fees Eligibility Full-time undergraduate students Duration: 1 year, renewable Duration: Renewable annually for the duration of the Service contract None Tenable at: University of the Witwatersrand course Closing date: Contact the university concerned Eligibility. Awarded on the basis of financial need and Tenable at: Any university Further information: academic merit to a black student who has success- Eligibility Undergraduate students The Registrar of the university concerned fully completed one year of college Service contract: 6 months service for each year for Service contract: None which the bursary was received MYRTLE L. ARON BURSARY Closing date: 30 September Closing date: 30 September Field of study. B.Sc. (Logopaedics) (Speech Therapy Further information: Further information: and Audiology) The Senior Assistant Registrar The Bursary Office Value: Approximately R500 Financial Aid & Scholarship Murray & Roberts Contractors Duration: 1 year University of the Witwatersrand PO Box 984 Tenable at: Any university in South Africa offering a Private Bag 3 BEDFORDVIEW 2008 degree/diploma in Speech Therapy and Audiology WITS 2050 Eligibility SA citizens as from the second year MURRAY AND ROBERTS ENGINEERING LIMITED onwards MPUMALANGA PREMIER PRIVATE SECTOR BURSARY Service contract None BURSARY FUND Field of study. B.Com., Electrical, Mechanical and Closing date: 31 October Field of study. Any field of study with preference to Materials (Physical) Engineering Further information: Commerce and Engineering Value: Tuition and residence fees and a book The Secretary Value: Maximum R5 000 with other bursaries not to allowance SA Speech & Hearing Association exceed registration, tuition, residence and book fees Duration: 1 year, renewable PO Box 600 Duration: B degree if progress is satisfactory Tenable at: Any university WITS 2050 Tenable at. University of Zululand, PU for CHE, Eligibility. Awarded to SA citizens of all races, but Information not confirmed Pretoria, Rand Afrikaans, Unisa, Technikon Pretoria or special consideration will be given to black applicants. another technikon for special reasons Preference to second-year students and onwards N.J. DEAN BURSARY Eligibility. Students from the Mpumalanga Province Service contract: One year service for every two years Field of study. Natural Sciences, Agricultural Sciences, Service contract: None for which the bursary was received Economics and Management Sciences, Law, Medicine, Closing date: As soon as enough acceptable applica- Closing date: 31 October Dentistry tions have been received Further information: Value: Amount varies Further information: The Group Human Resources Manager Duration: Maximum of 3 years The Director Murray & Roberts Engineering Ltd Tenable at University of Stellenbosch Laeveldtrust Be leggings Bpk PO Box 874 Eligibility. Undergraduate second-year students PO Box 861 BEDFORDVIEW 2008 Service contract None NELSPRUIT 1200 Information not confirmed Closing date: 15 January Further information: MURRAY AND ROBERTS (BUILDINGS) BURSARY MURRAY AND ROBERTS GILLIS-MASON The Registrar (Bursaries and Loans) Field of study. Building Management BURSARY University of Stellenbosch Value: Tuition fees only Field of study. Civil Engineering Private Bag X1 Duration: 1 year, renewable for the duration of the Value: Tuition and residence fees (where applicable) MAT1ELAND 7602 course subject to satisfactory progress and a book allowance Tenable at: University of the Witwatersrand Duration: 1 year, renewable if progress is satisfactory NAFCOC MASEKELA-MAVIMBELA MEMORIAL Eligibility. Awarded on the basis of academic merit to Tenable at: Any university SCHOLARSHIP FUND future potential builders who must already be in at Eligibility. Undergraduate students as from the Field of study. Any field of study except Medicine least the first year at university second year of study Value: Tuition, registration and boarding fees plus a Service contract: One year service for each year for Service contract: One year service for each year for maximum of R350 book allowance which the bursary was awarded which the bursary was received. Vacation training Duration: I year, renewable if progress is satisfactory Closing date: September must be done with the company Tenable at: Any university or technikon Further information: Closing date: 1 September Eligibility Awarded on the basis of academic Human Resources Director Further information: achievement to black undergraduate students Murray & Roberts Buildings (Pty) Ltd The Bursary Administrator Closing date: 30 September PO Box 8212 Murray & Roberts Gillis-Mason (Pry) Ltd Further information: ELANDSFONTEIN 1406 PO Box 292 The Secretary BEDFORDVIEW 2008 Masekela-Mavimbela Scholarship Fund MURRAY AND ROBERTS BURSARY (TECHNIKON PO Box X81 STUDY) MUSHET BURSARY SOSHANGUVE 0152 Field of study. Building and Building Surveying Field of study. Economics, Medicine, Engineering, Information not confirmed Value: Tuition fees only Social Work or Sociology Duration: One year, renewable for the duration of the Value: R400 NAMDEB DIAMOND CORPORATION (PTY) LTD course subject to satisfactory progress Duration: Duration of the course Field of study. Accounting, Engineering, Mining, Tenable at: Technikon Witwatersrand and Technikon Tenable at: University of Stellenbosch Metallurgy, Geology, Surveying Pretoria Eligibility. Awarded on the basis of financial need and Value: Tuition and residence fees plus an allowance Eligibility. Awarded on the basis of academic merit to merit to undergraduate students Duration: I year, renewable annually future potential builders who must already be in at Service contract: None Tenable at: Any university or technikon least the first year at technikon Closing date: 15 January Eligibility Awarded on the basis of merit and financial Service contract: One year service for each year for Further information: need to NAMIBIAN STUDENTS ONLY which the bursary was awarded The Registrar (Bursaries and Loans) Service contract: One year service for each year for Closing date: September University of Stellenbosch which the bursary was received Further information: Private Bag X1 Closing date: 31 July Human Resources Director MAT1ELAND 7602 Further information: The Bursary Administrator BEDFORDVIEW 2008 Namdeb Diamond Corporation (Pry) Ltd NATAL PROVINCIAL ADMINISTRATION BUR- Information not confirmed Training and Development SARY SCHEME NATIONAL ECONOMIC EDUCATION TRUST PO Box 996 Field of study: Full-time: M.B., Ch.B. (from the 3rd (NEET) ORANJEMUND 9000 year onwards), Physiotherapy, Radiography, Phar- macy, Mechanical Engineering, Civil Engineering; Field of study: Management and Commerce; NANCY LITTLE BURSARY part-time: BA., B.A. (Admin.), B.Com., as well as Agriculture and Farming; Technical Education; Science-related studies Field of study: English National Diplomas in Public Administration, State Value: RI 500 Finance, Organisation and Work Study and Computer Value: Amount varies Duration: 1 year Data Processing Duration: 1 year, renewable Tenable at: Any local or national university, technikon, Tenable at: Rhodes University Value: Amount varies Eligibility: Awarded on the basis of academic merit to Duration: Minimum duration of the course technical college, agricultural college second-year students at Rhodes University Tenable at: Any university or technikon in South Africa Eligibility: Awarded on the basis of academic achievement, financial need and fields of study to Service contract: None Eligibility All racial groups may apply. Part-time study black students residing in the territory that formed Closing date: 31 October only for employers of the Administration and full- part of the RSA as at the 31st May 1961 Further information: time study only for undergraduate students Service contract: None The Executive Director Service contract: One year service for each year for Closing date: 31 October for completed forms. Apply Grahamstown Foundation which the bursary was received. Bursary holders must for application forms from 1 May to 31 August PO Box 304 accept posts at institutions within the Administration GRAHAMSTOWN 6140 where the need originates Further information: Closing date: 30 September National Economic Education Trust NASIONALE MEDIA BPK BURSARY Further information: Private Bag X4 The Director-General LANGLAAGTE 2102 Field of study: An approved degree course with a view Natal Provincial Administration to a career in journalism Private Bag X9043 NATIONAL READJUSTMENT COMMITTEE AND Value: Tuition and residence fees plus RI 000 p.a. for PIETERMARITZBURG 3200 VOCATIONAL BOARD BURSARY FUND other expenses. Additional merit awards with a maximum of R450 p.a. are also awarded Field of study: Career orientated courses NATBEV/COCA-COLA BOTTLERS' TERTIARY Duration: Duration of the course Value: All fees EDUCATION Tenable at: University of Venda, University of Port Tenable at: Any university Eligibility: Full-time undergraduate students and Field of study: Commerce, Engineering, Natural Elizabeth Honours degree students. Must have the basic Sciences (Biochemistry, Chemistry) Eligibility: Any disabled person qualities necessary for a journalist Value: At the discretion of the University Further information: Service contract: One year service for each year for Duration: 1 year, renewable and subject to continued The Director General which the bursary was received plus one additional financial need, satisfactory academic performance Department of Manpower Private Bag X117 year and availability of funds Closing date: 31 October Tenable at: University of the Witwatersrand PRETORIA 0001 Information not confirmed Further information: Eligibility: Awarded on the basis of financial need and Personnel Services satisfactory academic performance to black, coloured NATIONAL STATE/INDEPENDENT STATE Nasionale Pers Beperk and Indian students only BURSARY LOANS PO Box 2271 Service contract: None CAPE TOWN 8000 Closing date: 30 September Field of study: Teaching Information not confirmed Further information: Value: Amount varies The Senior Assistant Registrar Duration: 1 year, renewable if progress is satisfactory NASIONALE PERS BPK BEURS Financial Aid & Scholarships Tenable at: Any university or college of education in University of the Witwatersrand South Africa Field of study: Journalism Private Bag 3 Eligibility: Undergraduate students who qualify for Value: Tuition and residence fees, a cash allowance of WITS 2050 RI 000 and a merit award for distinctions (maximum citizenship of Gazankulu Service contract: One year service for each year for of R450) NATIONAL CHEMICAL PRODUCTS SCHOLAR- Duration: The duration of the course which the bursary was received SHIP Closing date: 15 November Tenable at: Any university Eligibility: Undergraduate students. Honours students Field of study. B.Sc. with Chemistry, Microbiology or Further information: The Director General will also be considered Biochemistry as major; Chemical Engineering. Service contract: One year service for each year for National Diploma in Chemical Engineering Department of Education which the bursary was received plus one additional Value: Tuition, residence fees plus a personal Private Bag X9S78 GIYANI 0826 year allowance Information not confirmed Closing date: 31 October Duration: 1 year, renewable if progress is satisfactory Further information: Tenable at: Any university or technikon NCORA IRRIGATION SCHEME AGRICULTURAL Personnel Services Eligibility: Awarded on merit to students in any year of BURSARY Nasionale Pers Bpk study PO Box 2271 Service contract: One year service for each year for Field of study: Agricultural Management CAPE TOWN 8000 which the bursary was received. Must undertake Value: Tuition and residence fees plus prescribed vacation work each year books NATAL BUILDING SOCIETY BURSARY Closing date: 30 June Tenable at: University of Natal Further information: Eligibility Transkeian students who have completed Field of study: Science, Commerce The Bursary Committee the first year towards the B.Agric. Management Value: Amount varies NCP degree and who are under the age of 30 years Duration: 1 year, renewable PO Box 284 Service contract: On completion of the degree the Tenable at: Rhodes University BEDFORDVIEW 2008 bursar must fill a post within the scheme Eligibility: Awarded on the basis of academic merit Closing date: 30 September and financial need to full-time undergraduate NATIONAL CHEMISTRY BURSARY Further information: students who are SA citizens The Projects Manager Closing date: 1 December Field of study: B.Sc.Chemistry Ncora Irrigation Scheme Further information: Value: Tuition and residence fees plus an allowance Private Bag X5025 The Financial Aid Officer Tenable at: University of the Western Cape UMTATA Rhodes University Eligibility: Full-time students with Chemistry as major TRANSKEI 5100 PO Box 94 Further information: Information not confirmed GRAHAMSTOWN 6140 The Bursary Committee Information not confirmed PO Box 284 224 Bursaries 209 NDF STUDY BURSARY (NATIONAL DEVELOP- Service contract Borrowers must enter the service of MENT FUND) the Ondersteuningsraad of the Nederduitsch NG KERK-BEURS Add of study BSc. Building-Management or Con- Hervormde Kerk van Afrika if there is a vacancy Field of study Theology Closing date 31 January struction Management Value: R400 p.a. Further information: Value: Tuition fees and a book allowance of R500 Duration: 1 year, renewable The Administrator Duration: Renewable on an annual basis Tenable at University of Stellenbosch NHSV Tenable at: Universities of Cape Town, Natal, Port Eligibility. Students who undertake to continue their PO Box 2368 Elizabeth, Orange Free State, Pretoria and the studies at the Seminary after completion of the B.D. Witwatersrand PRETORIA 0001 course Information not confirmed Eligibility Full-time students as from the first year of Service contract None study Closing date: 15 January Service contract: Six months' service for each year for NEDERLANDSE STUDIEFONDS-BEURS Further information: which the bursary was awarded Field of study Afrikaanse en Nederlandse Kultuur- The Registrar (Bursaries and Loans) Closing date: 30 September geskiedenis University of Stellenbosch Further information: Duration: 1 year or more P/Bag X1 The Director Tenable at University of Pretoria MAT1ELAND 7602 NDF Eligibility. Awarded on the basis of academic PO Box 1619 achievement and financial need to full-time, final- NORAH TAYLOR BURSARY . HALFWAY HOUSE 1685 year undergraduate students with Afrikaanse en Field of study Speech Training, Oral Communication, Nederlandse Kultuurgeskiedenis as major Radiowork or English Teaching NDF STUDY LOAN /BURSARY Service contract None Value: Variable Closing date: 15 October Field of study Construction Management Tenable at University of the Western Cape Further information: Value: Tuition fees Eligibility. For students in speech training, oral The Head (Study Finance) Duration: 1 year, renewable communication, radio work or the teaching of English University of Pretoria Tenable at Universities of Port Elizabeth, Cape Town, as a second language PRETORIA 0002 Pretoria, Witwatersrand, Free State and Natal Closing date: 1July of the previous year Eligibility. Undergraduate students Further information: Service contract Six months for every year during NEW SETTLERS' FOUNDATION BURSARY The Director Bursaries which support was received Field of study Education (B.Prim.Ed.) PO Box 660 Closing date: 2 January Value: At the discretion of the University PRETORIA 0001 Further information: Duration: 1 year, renewable. Reviewed half-yearly Information not confirmed The Director based on academic results National Development Fund Tenable at University of the Witwatersrand NORISTAN BURSARY for the Building Industry Eligibility. Awarded on the basis of financial need and Field of study. Medicine PO Box 1619 satisfactory academic performance to educational Value: RI 250R2 000 HALFWAY HOUSE 1685 disadvantaged students Duration: 1 year Service contract None Tenable at Universities of Pretoria, OFS, Stellenbosch NED GEREF GEMEENTE KUILSRIVIER BEURS Closing date: 30 September and Cape Town Further information: Field of study Theology Eligibility. Awarded on the basis of academic Value: Variable The Senior Assistant Registrar achievement and financial need to fifth-year students Financial Aid & Scholarships Tenable at University of the Western Cape Closing date: Contact the university concerned Eligibility. Theological students with financial need University of the Witwatersrand Further information: Closing date: 30 September of the previous year Private Bag 3 The Registrar of the university concerned Further information: WITS 2050 The Administrator NORISTAN MEDICAL STUDY LOAN PO Box 107 NG KERK (OOS -KAAP) BEURSE Field of study Medicine KUILSRIVIER 7580 Field of study. Music with organ as major subject Value: RI 250 - R2 000 Information not confirmed Value: RI 000 Duration: 1 year, renewable (2 years maximum) Duration: 1 year Tenable at Universities of Cape Town, Pretoria, NEDBANK STUDENT LOAN SCHEME Tenable at University of Port Elizabeth Stellenbosch, OFS Field of study Selected professional degree faculties Eligibility. Awarded to undergraduate students with Eligibility: Awarded to students as from the fourth Value: Negotiable and related to actual cost of organ as a major and who are members of the Dutch year of study studies. Ceiling limits apply Reformed Church Closing date: Contact the university concerned Duration: Renewable annually for the duration of the Service contract None Further information: course Closing date: 31 December The Registrar of the university concerned Tenable at Any university or technikon approved by Further information: The Head the Bank NORMAN E. ROSENBERG BURSARY Eligibility. Loans are considered for full-time or part- Music Department Field of study. Law (LLB.) time professional degree students who are SA UPE Value: At the discretion of the University residents PO Box 1600 Duration: 1 year, renewable annually for a maximum Service contract: None PORT ElJZABETH 6000 of 3 years subject to satisfactory progress Closing date: No dosing date is applicable Tenable at University of the Witwatersrand Further information: NG KERK VAN GAUTENG-LENINGS/BEURSE Eligibility. Awarded on the basis of financial need and The Student Loans Officer Field of study: Theology, Social Work, Missionary satisfactory academic performance to a student in PO Box 31013 Work any year of study BRAAMFONTEIN 2017 Value: Amount varies Service contract None Information not confirmed Duration: Duration of the course Closing date: 30 September Tenable at University of Pretoria, Rand Afrikaans Further information: NEDERDUITSCH HERVORM DE University, PU for CHE The Senior Assistant Registrar SUSTERVERENIGING (NHSV) STUDY LOAN FOR Eligibility. Full-time undergraduate students Financial Aid & Scholarships SOCIAL WORK Service contract Is required University of the Witwatersrand Field of study Social Work Closing date: 15 December Private Bag 3 Value: RI 000 - RI 500 p.a. Further information: WS 2050 Duration: Annually renewable The Director Tenable at Any university Dutch Reformed Church Eligibility. Undergraduate students who are members PO Box 433 of the Nederduitsch Hervormde Kerk van Afrika PRETORIA 0001 NORTH WEST GOVERNMENT BURSARIES PO Box 1094 Further information: KIMBERLEY 8300 Executive Director Field of study. Any field of study relevant to the Public OFS Education Department Service NSB EDUCATIONAL TRUST PO Box 52) Value: Tuition and residence fees BLOEMFONTUN 9300 Field of study. Engineering: Civil, Chemical, Electrical, Duration: Duration of the course if progress is Information not confirmed satisfactory Mechanical; Finance; Auditing; Agricultural Science: Management: Secretarial Studies Tenable at: Any tertiary institution in South Africa OLD MUTUAL ACTUARIAL BURSARY Eligibility SA citizens who are willing to work in the Tenable at: Any technikon Field of study: Actuarial field, Commerce, Natural North West Province Eligibility: Awarded on the basis of academic Service contract: Is required achievement to technikon students Sciences Closing date: 31 October Closing date: 31 October for completed forms Value: Tuition and residence fees plus a book Further information: Further information: allowance The Chief Director NSB Educational Trust Duration: 3 or 4 years Tenable at: Any university where the course is offered Provincial Service Commission PO Box 785067 North West Provincial Government SANDTON 2146 Eligibility. An applicant with an A symbol in Mathe- matics and an excellent pass in the Matriculation or Private Bag X2065 Information not confirmed MMABATHO 2735 Senior Certificate examinations. A Baccalaureus Information not confirmed NURCOMBE SUMMERLEY RINGROSE AND TODD degree must include at least Mathematics II BURSARY Service contract: Work for a period equal to the number of years for which the bursary was received NORTH WEST PROVINCIAL SERVICE COMMIS- Field of study: Architecture (B.Arch./BAS or B.Sc. (TRP)) Closing date: 15 August SION BURSARY Value: Amount varies Further information: Duration: 1 year, renewable subject to satisfactory Field of study. Fields of study required by the Public The Co-ordinator progress Service Actuarial Education Programme Tenable at: University of the Witwatersrand Value: Amount varies Old Mutual Eligibility. Awarded on the basis of financial need and Duration: Duration of the course subject to satisfac- PO Box 66 a high standard of scholastic achievement and tory progress and conduct CAPE TOWN 8000 Tenable at: Any university or technikon in South Africa motivation Service contract: None Eligibility. Awarded on the basis of financial need and OLD TRUST BANK BURSARY academic merit to undergraduate and postgraduate Closing date: 30 September students who are citizens of SA. Preference will be Further information: Field of study. Economics and Management Sciences given to students residing in the North West Province The Senior Assistant Registrar Value: RI 000 Service contract: One year service for each year for Financial Aid & Scholarships Duration: Duration of the course which the bursary was awarded University of the Witwatersrand Tenable at: University of Stellenbosch Closing date: 31 October of the preceding year Private Bag 3 Eligibility: Undergraduate students Further information: WITS 2050 Service contract: None Closing date: 15 January The Chief Director North West Provincial Service Commission OCCUPATIONAL THERAPY BURSARY Further information: The Registrar (Bursaries and Loans) Private Bag X2065 Field of study. Occupational Therapy University of Stellenbosch MMABATHO 8681 Value: R600 each Information not confirmed P/Bag X1 ! Duration: Duration of the course MATIELAND 7602 Tenable at: University of Stellenbosch NORTH WEST TRANSPORT INVESTMENTS Eligibility. Undergraduate students OLIVE TAYLOR BURSARIES BURSARY Service contract: None Field of study B.A. (Fine Arts) and B.Mus. Field of study B.Com. Closing date: 15 January Value: At the discretion of the University Value: R2 000 p.a. Further information: Duration: 1 semester, renewable subject to continued The Registrar (Bursaries and Loans) Duration: 1 year, renewable annually for a maximum and satisfactory performance University of Stellenbosch of 3 years Tenable at: University of the North West P/Bag X1 Tenable at: University of the Witwatersrand Eligibility Awarded on the basis of financial need and Eligibility Awarded on the basis of financial need and MATIELAND 7602 satisfactory academic performance to students in any academic merit to undergraduate students year of study towards the BA Fine Arts or B.Mus. Service contract. None ODA BURSARY/LOAN SCHEME degree Closing date: Notices will be posted at the financial Field of study. Engineering and Natural Sciences Service contract: None aid office Value: Amount varies Closing date: 30 September Further information: Duration: 1 year, renewable Further information: Financial Aid Office Tenable at University of the Witwatersrand The Senior Assistant Registrar University of the North West Eligibility. Awarded on the basis of financial need and Financial Aid & Scholarships Private Bag X2046 satisfactory academic performance to black, coloured University of the Witwatersrand MMABATHO 8681 and Indian students Private Bag 3 Information not confirmed Service contract: None WITS 2050 Closing date: 30 September NORTHERN CAPE AGRICULTURAL UNION Further information: ORAL-B BURSARY BURSARY (VISAGIE/MORELIG TRUST) The Senior Assistant Registrar Field of study Dentistry (BDS) Field of study. Agriculture Financial Aid & Scholarships Value: At the discretion of the University Value: Approximately R2 000 University of the Witwatersrand Duration: 1 year, renewable Tenable at Any tertiary institution Private Bag 3 Tenable at: University of the Witwatersrand Eligibility: Students from the Northern Cape Agricul- WITS 2050 Eligibility: Awarded on the basis of financial need and tural Union area who have already completed their satisfactory academic performance first year of study OFS DEPARTMENT OF EDUCATION BURSARIES Service contract: None Service contract: After completion of studies, students Field of study Teaching Closing date: 30 September should follow a career in the agricultural field by Value: Average R4 500 p.a. Further information: being a farmer or by being employed by an approved Duration: 1 year, renewable if progress is satisfactory The Senior Assistant Registrar institution (up to 4 years) Financial Aid & Scholarships Closing date: 30 September Tenable at: Any university University of the Witwatersrand Further information: Eligibility. SA citizens, majoring in school subjects Private Bag 3 The General Manager Service contract: One year service for each year for WITS 2050 Northern Cape which the award was received Agricultural Union Closing date: 31 August 226 Bursaries 211 OSMOND LANGE ARCHITECTS BURSARY Tenable at: Technikon SA Closing date: 15 January Eligibility. People who are in the packaging industry or Field of study. Fine Arts Further information: wanting to enter it Value: R2 500 The Registrar (Bursaries & Loans) Closing date: 15 November Duration: 1 year, renewable if progress is satisfactory University of Stellenbosch Tenable at: University of the North West Further information: P/Bag X1 Eligibility Awarded on the basis of financial need and Financial Aid Officer MAT1ELAND 7602 academic achievement to prospective and enroled Technikon SA students Private Bag X6 PEROLD-STEINER BURSARY LOAN SCHMEME Closing date: Notices will be posted at the financial FLORIDA 1710 Field of study Viticultural Science and Oenology aid office Value: Variable Further information: PALABORA MINING COMPANY LTD BURSARY Duration: 1 year, renewable Financial Aid Officer Field of study. Mining, Metallurgical and Chemical Tenable at: University of Stellenbosch University of the North West Engineering; Computer Science, Accountancy and Eligibility. Awarded to students as from the 2nd year Private Bag X2046 Human Resources of study on the basis of merit and financial need. MMABATHO 8681 Value: Tuition and residence fees plus a personal Depending on the academic results, the loan may be Information not confirmed allowance of R2 500 for university students and R2 converted into a bursary 000 for technikon students. An accommodation Closing date: 1 May OUTSPAN BURSARY allowance if student does not stay in a university or Further information: Field of study B.Sc. (Agric.) with Horticulture, technikon residence The Dean Entomology or Plant Pathology Duration: 1 year Faculty of Agricultural Sciences Value: Covers tuition fees, accommodation and an Tenable at: Any South African university or technikon University of Stellenbosch P/Bag X1 allowance Eligibility. Matriculants who are residents of the Duration: Renewable annually if progress is satisfac- Northern Province with at least C symbols in Mathe- MATIELAND 7602 tory matics and Physical Science on HG (for engineering Tenable at: Universities of Natal, Pretoria or Stellen- courses) or students of the Northern Province already PERSKOR BURSARY bosch registered at university or technikon Field of study. Communication Eligibility. Matriculants and undergraduate students Service contract: One year service for each year for Value: Amount varies Service contract: Serve Outspan International for a which the bursary was received with a minimum of Duration: 1 year period equal to the number of years for which the two years. Vacation work is also required Tenable at University of the OFS bursary was received Closing date: 31 August Eligibility. Awarded on the basis of merit to a final- Closing date: 30 September Further information: year or Honours student in Communication Further information: The Secretary Service contract: One year service at Perskor The Manager Human Resources Bursary Committee Closing date: 15 December Outspan International Palabora Mining Company Ltd Further information: PO Box 7733 PO Box 65 Director (Finacial Assistance) HENNOPSMEER 0046 PHALABORWA 1390 University of the OFS PO Box 339 OVE ARUP INCORPORATED SCHOLARSHIP PAM GREGORY MEMORIAL BURSARY BLOEMFONTEIN 9300 Field of study. Civil Engineering Field of study. Any field of study, but preference to PETER AND SYDNEY DICKSON TRUST BURSARY Value: Tuition fees plus R3 000 p.a. students in the Faculty of Arts Duration: 1 year, renewable if progress is satisfactory Value: At the discretion of the University Field of study Medicine (M.B. B.Ch.) Tenable at: Any university Duration: 1 year, renewable subject to satisfactory Value: At the discretion of the University Eligibility Selection is based on outstanding academic academic progress Duration: 1 year, renewable subject to satisfactory achievement and leadership potential supported by a Tenable at University of the Witwatersrand academic progress reference from the school principal or head of the Eligibility. Awarded on the basis of financial need and Tenable at University of the Witwatersrand department if the applicant is already at university satisfactory academic performance Eligibility Awarded on the basis of financial need and Service contract: None Service contract: None satisfactory academic performance Closing date: 31 August Closing date: 30 September Service contract. None Further information: Further information: Closing date: 30 September The Personnel Officer The Senior Assistant Registrar Further information: Ove Arup Incorporated Financial Aid & Scholarships Office The Senior Assistant Registrar Consulting Engineers University of the Witwatersrand Financial Aid & Scholarships Office PO Box 47012 Private Bag 3 University of the Witwatersrand PARKLANDS 2121 WITS 2050 Private Bag 3 Information not confirmed WITS 2050 PANNAR SEED (PTY) LTD BURSARY OVERBEEK TRUST Field of study. Agriculture PETRUSBURG THEOLOGICAL STUDY FUND Field of study. Arts, Education, Medical related Value: R10 000 p.a. Field of study. Theology courses, Natural Science and Social Science Duration: Duration of study Value: Determined by donor Value: Amount varies Tenable at University of Natal, University of Pretoria Duration: Duration of the course Duration: 1 year Eligibility Students as from their second year of study Tenable at University of Pretoria Tenable at: University of the Westem Cape Service contract One year service for each year for Eligibility Selected students of the Nederduitsch Eligibility. Full-time students which the bursary was received Hervormde Kerk van Afrika Service contract: None Closing date: 31 August Service contract: Determined by donor Closing date: First-year students 1 March; seniors 31 Further information: Closing date: None October of the previous year Human Resources Manager Further information: Further information: Pannar Seed (Pty) Ltd The Church Secretary The Registrar PO Box 19 Curatory for Theological Training University of the Western Cape GREYTOVVN 3250 PO Box 2368 Private Bag X17 PRETORIA 0001 PATRIC OWENS BURSARIES BELLVILLE 7535 Information not confirmed Field of study. Law PACKAGING INSTITUTE OF SA Value: Variable PHALABORWA TOWN COUNCIL BURSARY Duration: 1 year Field of study Packaging Field of study. Any field of study related to municipal Tenable at: University of Stellenbosch Value: Amount varies affairs Duration: 1 year, renewable only after academic Eligibility. Awarded on the basis of merit and financial Value: Full tuition, residence and registration fees plus need success books 212 Bursaries Service contract: Student aid loans reduced propor- Duration: Duration of the course tianally over a period of service one year longer than Tenable at: Any statutory, tertiary educational POLIFIN BURSARY SCHEME period of study institution Field of study: Engineering: Chemical, Electrical, Closing date: Apply through local PCSA congregation Eligibility. Parents must be residents of the municipal- Electro-Mechanical, Mechanical, IndustrialPolimer before 28 February in preceeding year ity of Phalaborwa Scientist Further information: Service contract: None Value: Tuition, residence and book allowance The Rev EA. Parking Closing date: 1 October Duration: 1 year, renewable subject to satisfactory PO Box 96188 Further information: progress BRIXTON 2019 Head of Management Services Tenable at: Any approved South African University PO Box 67 Eligibility. Undergraduate students who are SA PRETORIA CHAMBER OF COMMERCE BURSARY PHALABORWA 1390 citizens, Bursars may not change course of study without approval Field of study: B.Com. PHARMACEUTICAL SOCIETY BURSARIES Service contract: One year service for each year for Value: Determined annually Duration: 1 year Field of study. Pharmacy which the bursary was received Tenable at: University of Pretoria Value: Variable Closing date: 30 July Eligibility: Full-time undergraduate students Duration: 1 year Further information: Tenable at: Universities of Port Elizabeth, Western The Bursary Office Service contract None Closing date: 15 October Cape, Witwatersrand, Durban-Westville, Potchef- Training and Development stroom, The North and Rhodes University Polifin Midlands Factory Further information: Eligibility B.Pharm. students who have succesfully PO Box 321 The Secretary Pretoria Chamber of Commerce completed the first year of study SASOLBURG 9570 PO Box 40653 Service contract: None ARCADIA 0007 Closing date: 30 September PORT ELIZABETH CITY COUNCIL BURSARIES Further information: Field of study B.Sc. (Electrical Engineering) (Heavy PRETORIA CITY COUNCIL FULL-TIME BURSARY The Secretary Current), B.Sc. (Town and Regional Planning), B.Sc. SCHEME Foundation for Pharmaceutical Educ (Civil Engineering), National Diploma in Civil Engi- PO Box 31360 neering Field of study: Depends on the annual determination BRAAMFONTEJN 2017 Value:Tuition and residence fees plus a personal of forecasted needs allowance Value: Tuition and residence fees plus an allowance PIERRE F. THERON BURSARY Duration: Duration of the course for books Duration: Renewable annually if progress is satisfac- Field of study B.Accounting Tenable at: Any university or technikon tory Value: Amount varies Eligibility. Full-time students resident in Port Elizabeth Tenable at: Any university, technikon or technical Duration: Duration of the course and who wish to join the Port Elizabeth municipal college in South Africa Tenable at: University of Stellenbosch service after successful completion of their studies Eligibility: Matriculants and full-time students Eligibility. A needy, but preferably deserving, first- Service contract: Bursars will be required to enter into Service contract: One year service for each year for year student a formal written agreement to serve the Council for a which the bursary was received Service contract: Service contract with Coopers period equal to that over which the bursary was paid Closing date: August Theron Du Toit Closing date: 15 July Further information: Closing date: 15 January Further information: The Executive Director Further information: The Personnel Manager Personnel Services Department The Registrar (Bursaries and Loans) City Council of Port Elizabeth City Council of Pretoria University of Stellenbosch PO Box 116 PO Box 440 P/Bag X1 PORT ELIZABETH 6000 PRETORIA 0001 MAT1ELAND 7602 PRECIOUS METALS REFINERS BURSARY AWARD Information not confirmed PLASTICS INDUSTRY TRAINING BOARD BUR- Field of study: Applied Chemistry PRETORIA PORTLAND CEMENT BURSARY SARY Value: Tuition and residence fees plus a cash SCHEME (MEMBER BARLOWS) Field of study Plastics Technology allowance of RI 400 p.a., book allowance of R1 500 Field of study: Chemical, Electrical and Mechanical Value: R3 000 per semester p.a. and cost of compulsory excursions Engineering, B.Sc. Chemistry Duration: Till another source is found Duration: 1 year, renewable if progress is satisfactory Value: Full tuition fees, book allowance plus a Tenable at: Technikon Pretoria, Cape Technikon Tenable at Any university discretionary accommodation allowance Eligibility: Students with Standard 10 Mathematics Eligibility. Only available to full-time third-year and Duration: 1 year, renewable and Science HG (D symbol) or SG (C symbol) Honours students. The award is based on academic Tenable at: Any university in South Africa Service contract: The RIB sets conditions merit and suitability as a future employee Eligibility Undergraduate students for full-time study. Closing date: 31 November/15 May Service contract: One year's service Award is based on academic ability and suitability as Further information: Closing date: 31 May future employees The Chief Executive Officer Further information: Service contract: At the discretion of the Company Plastics Industry Training Board Bursaries Office Closing date: 30 June Private Bag X68 Johannesburg Consolidated Further information: HALFWAY HOUSE 1685 Investment Co Ltd The Bursary Officer Information not confirmed PO Box 976 RANDFONTEN 1760 Pretoria Portland Cement PO Box 3811 PLATO DEVELOPMENT FUND BURSARY Information not confirmed JOHANNESBURG 2000 Field of study: Engineering (Geodetic) and Science PRESBYTERIAN CHURCH OF SOUTHERN AFRICA Information not confirmed (Surveying) Field of study Theology as preparation for the Value: Variable PRETORIUM TRUST BURSARY Duration: 1 year, renewable ministry of the denomination Field of study: Music Tenable at: Any university Value: Amount varies Value: Amount varies Eligibility SA citizens in all study years on the basis of Duration: Duration of the course Duration: 1 year proven financial need Tenable at: Universities of Durban-Westville, Rhodes, Tenable at: University of Pretoria Closing date: 31 December South Africa and Natal Pietermaritzburg, TEE College or other institutions selected in consultation with the Eligibility. Full-time deserving students. First-year Further information: students are selected by means of an audition Bursary Office PCSA at the selection conference Closing date: 31 October SA Council of Professional Eligibility. A student who is a member of the Presby- Further information: & Technical Surveyors terian Church and who is selected as a student for the The Head: Study Financing PO Box 62041 Ministry of this Denomination University of Pretoria MARSHALLTOWN 2107 228 ICU ircarielc 213 PRETORIA 0002 Eligibility. Full-time undergraduate students as from MAT1ELAND 7602 their second year of study who are SA citizens and PRICE WATERHOUSE BURSARY reside in the Westem Cape Province RAND CARBIDE LIMITED BURSARY Service contract One year service for each year for Field of study Accounting Field of study Any field of study and specifically for which the bursary was awarded Value: To be established every year Chemistry, Physics and Chemical or Electrical Duration: 1 year, renewable if progress is satisfactory Closing date: 15 August Engineering Further information: Tenable at: Any university Value: Amount varies The Director Eligibility. Full-time undergraduate students Duration: 1 year, renewable Department of Health Service contract Is required Tenable at Potchefstroom University for CHE Personnel Management Closing date: 30 September Eligibility. Dependents of employees or past- PO Box 2060 Further information: employees and employees of the company, as well as CAPE TOWN 8000 The Staff Partner residents of Bronkhorstspruit, Witbank, Middelburg, Price Waterhouse Belfast, Delmas or Bethal PU VIR CHO FAK MUSIEKBEURS PO Box 35296 Service contract A period of service equivalent to half MENLO PARK 0102 Field of study Music the number of years for which the bursary was Value: Tuition fees for one year to the winner and an received, if the company requires his service PRICE WATERHOUSE MEMORIAL BURSARY amount of R1 000 to the runner-up Closing date: 31 December Field of study BAccounting Duration: 1 year Further information: Value: R800 pa. Tenable at Potchefstroom University for CHE The Secretary Duration: Two years Eligibility Undergraduate students for outstanding Rand Carbide Ltd Tenable at. University of Stellenbosch performance in Music PO Box 4380 Eligibility. A full-time students from the second year Closing date: 15 October JOHANNESBURG 2000 of study. Must excel academically and be determined Further information: Information not confirmed to become a chartered accountant (SA) The Director (Music Department) Service contract Contract as artided clerk with Price PU for CHE RANDCOAL SERVICES BURSARY P/Bag X6001 Waterhouse for a minimum of two years Field of study. Engineering, Commerce, Natural POTCHEFSTROOM 2520 Closing date: 15 January Sciences, Social Science and Mining Geology Further information: Value: All fees plus R3 600 p.a. The Registrar (Bursaries and Loans) PUBLIC SERVICE BURSARY SCHEME Duration: 4 years University of Stellenbosch Field of study Any field of study identified as a need Tenable at Universities of Port Elizabeth, Stellen- Private Bag Xl by a particular Provincial Departement bosch, Cape Town and Natal MATIELAND 7602 Value: Tuition, registration, book and residence fees Eligibility Undergraduate students Duration: Duration of the course if progress is Service contract Is required PROFESSIONAL EXAMINATION BURSARY satisfactory Closing date: 30June Field of study. Law (excluding LLB) Tenable at Any university or technikon in SA Further information: Value: R800 Eligibility. Students who are citizens of the Eastern The Bursary Officer Duration: 1 year, renewable Cape Randcoal Services LTD Tenable at Any university in South Africa Service contract: Is required PO Box 78861 Eligibility Awarded on the basis of financial need and Closing date: 30 November SANDTON 2146 scholastic and/or academic achievements to ma- Further information: Information not confirmed triculants and undergraduate students The Permanent Sectretary Service contract None Department of Administration RANDU DURAND THEOLOGY BURSARY Private Bag X0015 Closing date: 31 January. Please enclose a self- Field of study. Theology addressed envelope BISHO Value: R2 000 Information not confirmed Further information: Duration: 1 year The Chief Director Tenable at University of the Western Cape R.B.TAYLOR ACCOUNTANCY BURSARY CUP Eligibility Students as from their second year of study PO Box 27392 Field of study. Accounting Service contract. On completion of studies the SUNNYSIDE 0132 Value: Approximately R1 000 p.a. towards tuition fees applicant must be prepared to take up ministry in the Information not confirmed Duration: 1 year, renewable subject to satisfactory Dutch Reformed Church in Africa The requirements academic performance would not be applicable in the event of unity in the PROTEA BURSARY FUND Tenable at University of the Witwatersrand Dutch Reformed Churches Field of study Accounting Eligibility. Awarded on the basis of financial need and Closing date: 31 October Value: Determined annually satisfactory academic performance to second-year Further information: Duration: 1 year B.Com. (Accounting) students who are currently The Dean Tenable at University of Pretoria serving Articles of Clerkship with a firm intention of Faculty of Theology Eligibility. Full-time or extramural undergraduate qualifying as a Chartered Accountant (SA) University of the Western Cape students who wish to qualify as chartered account- Service contract: None Private Bag X17 ants Closing date: 30 September BELLV1LLE 7535 Service contract: None Further information: Closing date: 15 October The Senior Assistant Registrar RAPPORTRYERSKORPS PIKETBERG-BEURS Financial Aid & Scholarships Office Further information: Field of study Afrikaans-Nederlands or History University of the Witwatersrand The Head (Study Finance) Value: R800 Private Bag 3 University of Pretoria Tenable at: University of Stellenbosch WETS 2050 PRETORIA 0002 Eligibility. A deserving needy student who matricu- lated at the High School Fiketberg R.E. PRETORIUS BURSARY PROVINCIAL ADMINISTRATION WESTERN CAPE Service contract None BURSARY SCHEME Field of study. Electrical Engineering Closing date: 15 January Field of study B.Ch.D., M.B., Ch.B., B.Pharm., BSc. Value: Amount varies Further information: (Pharm.), B.Sc. (Physiotherapy), B.Sc. (Occupational Duration: Duration of the course The Registrar (Bursaries and Loans) Therapy), B.Sc. (Dietetics) (four year course), B.Sc. Tenable at University of Stellenbosch University of Stellenbosch (Speech Therapy/Logopaedics), National Diploma in Eligibility. Awarded on the basis of academic Private Bag Xl Food Service Management achievement and financial need MATIELAND 7602 Value: Amount varies from year to year Further information: Duration: Remaining duration of studies The Registrar (Bursaries and Loans) RAPS TRUST BURSARIES Tenable at: Any university in South Africa University of Stellenbosch Field of study Dramatic Art Private Bag Xl Value: Amount varies 214 Bursaries Tenable at: University of the Witwatersrand Duration: 1 year, renewable on reapplication provided Eligibility. Second-year student on the basis of Eligibility. Awarded on the basis of financial need that an aggregate of 60% in the qualifying courses is financial need and satisfactory academic performance (income not more than R1 000 pa) and satisfactory maintained Service contract None academic performance Tenable at University of the Witwatersrand Closing date: 30 September Eligibility Awarded to third or fourth-year students Further information: Service contract: None Closing date: 30 September on the basis of financial need and a minimum The Senior Assistant Registrar aggregate of 60% in the qualifying courses taken Financial Aid & Scholarships Office Further information: The Senior Assistant Registrar during the previous year University of the Witwatersrand Financial Aid & Scholarships Office Service contract: None Private Bag 3 University of the Witwatersrand Closing date: 30 September WITS 2050 Private Bag 3 Further information: WITS 2050 The Senior Assistant Registrar REGINALD N. DRYDEN BURSARIES Financial Aid & Scholarships Office Field of study. Theology RICHARDS BAY COAL TERMINAL BURSARY University of the Witwatersrand Value: Amount varies Private Bag 3 Duration: 1 year Field of study Electrical and Mechanical Engineering, WITS 2050 Tenable at Rhodes University Computer Science, Information Systems, Administra- Eligibility Awarded on the basis of financial need to tion and Commercial fields, Health Care with RAU DEPARTMENT OF TRANSPORT ECONOM- candidates for the ordained ministry of the church or emphasis on preventative and industrial health, ICS BURSARY to ordained ministers pursuing further study. Education Value: Full fees Field of study: B.Com. (Transport Economics) or Preference is given to full-time students Duration: I year B.Com. (Hons.) (Transport Economics) Closing date: 1 December Tenable at University of Natal Value: Approximately R7 200 pa. Further information: Eligibility: Full-time students Duration: 1 year Head of Department Divinity Closing date: 10 September Tenable at: Rand Afrikaans University Rhodes University Eligibility: Undergraduate and postgraduate students PO Box 94 Further information: The Training Secretary Closing date: 31 January GRAHAMSTOVVN 6140 PO Box 56 Further information: Information not confirmed RICHARDS BAY 3900 The Secretary Information not confirmed Dept Transport Economics REPFIN FINANCE BURSARY Rand Afrikaans University Field of study: Economic and Management Sciences RICHARDS BAY MINERALS BURSARIES (FOR PO Box 524 Value: R860 R4 680 p.a UNIVERSITY STUDY) AUCKLAND PARK 2006 Duration: 1 year Tenable at Rand Afrikaans University Field of study Electrical or Mechanical Engineering, RC DIOCESE OF KIMBERLEY BURSARY FUND Eligibility. Full-time undergraduate students Metallurgy, Chemistry Value: Tuition and residence fees Field of study. Commercial, technical, agricultural, Service contract: None Duration: 1 year, renewable scientific or medical courses Closing date: 15 November Tenable at: Any university in South Africa Value: R500 R3 500 Further information: Eligibility Awarded on merit to undergraduate Duration: Duration of the course if progress is The Registrar (Finance) students satisfactory Rand Afrikaans University Service contract: Is required as well as vacation Tenable at. Any university, college or technikon PO Box 524 Eligibility. Undergraduate students originating from AUCKLAND PARK 2006 employment Closing date: 31 March the diocese of Kimberley Further information: Service contract: None REX POYNTON AND BEN COHEN BURSARY The Personnel Manager Closing date: 31 December Field of study Commerce Richards Bay Minerals Further information: Value: Determined annually PO Box 401 Bursary Grants Duration: 1 year RICHARDS BAY 3900 RC Diocese of Kimberley Tenable at: University of Pretoria PO Box 309 Eligibility. Full-time undergraduate students who are RICHTER BURSARY KIMBERLEY 8300 resident in Pretoria Service contract None Field of study. Electronic Engineering RED CROSS CALEDONIAN MARKET SCHOLAR- Closing date: 15 October Value: R750 SHIPS Further information: Duration: 1 year Tenable at University of Stellenbosch Field of study: Medicine, Dentistry, Speech & Hearing The Head (Study Financing) Eligibility Undergraduate students Therapy University of Pretoria Service contract: None Value: Amount varies PRETORIA 0002 Closing date: 15 January Duration: 1 year, renewable subject to satisfactory Further information: academic performance REX RUSHWORH LENNOX MEMORIAL FUND The Registrar (Bursaries and Loans) Tenable at: University of the Witwatersrand Field of study Mining Engineering University of Stellenbosch Eligibility Students registered for M.B. B.Ch., Value: At the discretion of the University P/Bag X1 B.Nursing, BDS, BA (Sp & H Therapy) or Dip (Sp & H Duration: 1 year, renewable subject to satisfactory MAT1ELAND 7602 Therapy) on the basis of financial need and satisfac- progress tory academic performance Tenable at: University of the Witwatersrand ROBERT HULME BURSARY Service contract None Eligibility. Full-time students on the basis of financial Closing date: 30 September need and satisfactory academic performance Field of study Architecture or Civil Engineering Further information: Service contract None Value: At the discretion of the University The Senior Assistant Registrar Closing date: 30 September Duration: 1 year, renewable Financial Aid & Scholarships Office Further information: Tenable at: University of the Witwatersrand University of the Witwatersrand The Senior Assistant Registrar Eligibility. A second-year student in financial need Private Bag 3 Financial Aid & Scholarships Office who is recommended by the Head of the Department WITS 2050 University of the Witwatersrand Service contract: None Private Bag 3 Closing date: 30 September REEVE SHAPIRO MEMORIAL BURSARY WITS 2050 Further information: The Senior Assistant Registrar Field of study. Dentistry (BDS) Financial Aid & Scholarships Office Value: R100 pa. RICHARD NIEBUHR SCHOLARSHIP University of the Witwatersrand Duration: 1 year Field of study. Architecture (BArch./BAS) Private Bag 3 Tenable at University of the Witwatersrand Value: At the discretion of the University WITS 2050 Duration: 1 year ursaries 215 ROTARY CLUB OF CAPE TOWN BURSARY Value: At the discretion of the University ROBERT JUNG SCHOLARSHIP Field of study Courses with an accent on community Duration: 1 year, renewable Field of study: A recognised B. degree in Electrical service Tenable at University of the Witwatersrand Engineering Value: Tuition and registration fees plus a book Eligibility. Awarded on the basis of financial need and Value: R5 000 pa. allowance satisfactory academic performance Duration: 1 year, renewable for normal duration of Duration: 1 year Service contract: None the course Tenable at: University of Stellenbosch Closing date: 30 September Tenable at: Any approved university in SA Eligibility. Students as from the second-year of study, Further information: Eligibility. Awarded on merit to SA citizens or resident in the Cape Peninsula The Senior Assistant Registrar permanent residents of SA with four or more Closing date: 31 December Financial Aid & Scholarships Office distinctions in the matric examinations and who Further information: University of the Witwatersrand might be expected to become leaders in the career of The Registrar (Bursaries and Loans) Private Bag 3 their choice University of Stellenbosch WITS 2050 Closing date: 31 October Private Bag Xl Further information: MAT1ELAND 7602 S.F. AND V.R. DU TOIT BURSARY The National Administration Manager Field of study Any field of study but preferably in a Electrical Development & Training Fund ROTARY SEA POINT BURSARY technical field PO Box 9694 Field of study Theology Value: Tuition fees EDENGLEN 1613 Value: Amount varies Duration: 1 year Duration: 1 year Tenable at Cape Technikon ROBT. B. VILJOEN LOAN Tenable at University of the Westem Cape Eligibility Candidates should be Afrikaans-speaking Field of study. Quantity Surveying Eligibility. Prospective theology students members of the Dutch Reformed Church and living Value: Determined annually Closing date: First-year students: 1 March; seniors: within 200 kilometres from Cape Town Duration: 1 year 31 October of the previous year Closing date: 31 October Tenable at University of Pretoria Further information: Further information: Eligibility Full-time undergraduate students in the The Registrar The Registrar first or second year of study University of the Western Cape Cape Technikon Service contract: None Private Bag X17 PO Box 652 CAPE TOWN 8000 Closing date: 15 October BELLVILLE 7535 Further information: The Head (Study Financing) ROTARY STUDENT FUND Sjj CILLIERS BURSARY University of Pretoria Field of study Social Work Field of study. Theology PRETORIA 0002 Value: R100 Value: Amount varies Tenable at University of the Western Cape Tenable at University of Stellenbosch ROODEPOORT MUNICIPALITY BURSARY LOAN Eligibility 2nd-year student in Social Work Eligibility Theology students from the following Field of study. Almost any field of study Further information: Dutch Reformed congregations in order of prefer- Value: R4 800 pa. The Chairman ence: Swellendam West, mother congregation of Duration: Duration of the course if progress is PO Box 4922 Swellendam, Buffeljagts River satisfactory CAPE TOWN 8000 Service contract: None Tenable at Any university or technikon Information not confirmed Closing date: 15 September Eligibility Matriculants and undergraduate students Further information: residing in Roodepoort ROUND TABLE BURSARY FUND (UNIVERSITY OF The Trustee Service contract: On completion of studies, the loan THE WESTERN CAPE) Sjj Cilliers Trust Sanlam Trust plus interest must be repaid in 60 equal monthly Field of study. A teaching career payments at the rate which will then be effective PO Box 1260 Value: R500 p.a. SANLAMHOF 7532 Closing date: 1 December Duration: 1 year Further information: Tenable at: University of the Western Cape S.P. GREEN BURSARY The City Treasurer Eligibility Prospective students who wish to prepare Private Bag X30 themselves for a teaching career (university or Field of study Zoology ROODEPOORT 1725 college) Value: RI 000 Information not confirmed Closing date: 31 October of the previous year Duration: 1 year Further information: Tenable at University of Stellenbosch ROOTH & WESSELS SCHOLARSHIP Mr V Morta Eligibility A deserving and needy student Field of study. Law Student Administrator Service contract: None Value: Tuition fees University of the Western Cape Closing date: 15 January Duration: 1 year Private Bag X17 Further information: The Registrar (Bursaries and Loans) Tenable at: University of Port Elizabeth BELLVILLE 7535 Eligibility. Final-year B.Proc. or LLB. students Information not confirmed University of Stellenbosch Closing date: 28 February P/Bag Xl Further information: ROY BEAMISH BURSARY MAITLAND 7602 Rooth & Wessels Field of study. Medicine and Civil Engineering SA ASSOCIATION FOR CROP PRODUCTION PO Box 208 Value: Tuition fees PRETORIA 0001 Duration: Duration of the course Field of study. Agronomy Information not confirmed Tenable at University of Stellenbosch Value: R4 000 p.a. Eligibility. Needy and deserving male students as Duration: 1 year ROTARY CLUB NELSPRUIT BURSARY from the second year of study Tenable at: University of Stellenbosch Eligibility Undergraduate and postgraduate students Field of study. Any tertiary course Closing date: 15 January Value: Amount vanes Further information: Closing date: 15 January Tenable at: Nelspruit Technikon The Registrar (Bursaries and Loans) Further information: Eligibility. Awarded from the second year of study University of Stellenbosch The Secretariat Further information: Private Bag Xl Stellenbosch Office The President MAITLAND 7602 PO Box 3087 MAT1ELAND 7602 Rotary ClubNelspruit PO Box 320 RUBY REEVES BURSARY NELSPRUIT 1200 Field of study. Dentistry (BDS) and Medicine (M.B. Information not confirmed B.Ch.) Duration: 1 year SA ASSOCIATION FOR FOOD SCIENCE AND and Technical Surveyors Tenable at A technikon or university in the Western TECHNOLOGY (SAVVOT) UNDERGRADUATE PO Box 62041 Cape, as well as the University of South Africa or BURSARY MARSHALLTOWN 2107 Information not confirmed Technikon SA (provided that students are resident in Field of study. Food Science the SAIUS Western Cape Branch area) Value: RI 000RI SOO pa. SA DRIED FRUIT CO-OPERATION (EMPLOYEES' Eligibility. Deserving students in their final year of Duration: 1 year, renewable if progress is satisfactory BURSARIES) study for a first qualification, irrespective of race, Tenable at: Universities of Stellenbosch and the OFS gender or creed. Awarded on the basis of academic Field of study: Hortology, Food Technology or other Eligibility. A full-time, needy student in Food Science achievement, financial need, personality and aptitude Science, Electrical or Mechanical Engineering, Service contract: One year service for each year for for the profession Marketing or any acceptable financial course which the bursary was received Closing date: 31 March Value: Tuition and residence fees Closing date: Contact the university concerned Further information: Duration: 1 year Further information: The Secretary Tenable at University of Stellenbosch The Registrar of the university concerned SAIUS Western Cape Eligibility Dependants of SAD-employees in a certain PO Box 5482 catogory to further their studies at a university or SA BREWERIES BEER DIVISION BURSARY CAPE TOWN 8000 SCHEME technikon Service contract: A service contract is required Field of study. Predominantly Engineering. Chemical, SA INSTITUTE OF ELECTRICAL ENGINEERS Closing date: 15 January Electrical, Mechanical and Industrial Engineering, BURSARY SCHEME Further information: Production or Packaging Management, Marketing, The Registrar (Bursaries & Loans) Field of study. Electrical or Electronic Engineering Food Technology, B.Sc.Chemistry, Biochemistry and University of Stellenbosch Value: R2 000R15 000 Microbiology P/Bag Xl Duration: 1 year Value: Full tuition, residence or living allowanceR7 MATIELAND 7602 Tenable at Any university, technikon or technical 000 p.a., a book allowance of RI 750 p.a. and a once college (selected) off payout computer allowance of R6 000 SA DRIED FRUIT CO-OPERATION (JAN BOS- Eligibility. Awarded on the basis of academic Duration: Duration of the course, depending on good MAN) BURSARY achievement and financial need to students as from progress the first year of study Field of study. Horticulture or Food Science Tenable at: Any recognised university or technikon in Service contract: None Value: R10000 SA Closing date: 30 September Duration: 3 years (every 3rd year) Eligibility. Only bona fide SA citizens as from the first Further information: Tenable at: University of Stellenbosch year of study The Secretary Eligibility. A second-year student Service contract: Year for year, vacation and in-service The SAIEE Service contract: Should be willing to work for the SA training excluded PO Box 93541 Dried Fruit Co-operation if required Further information: YEOVILLE 2143 The Bursary Administrator Beer Division Closing date: 15 January SA Breweries Further information: SA INSTITUTE OF FOUNDRYMEN SPONSORSHIP PO Box 782178 The Registrar (Bursaries and Loans) Field of study. Metallurgical Engineering SANDTON 2146 University of Stellenbosch P/Bag Xl Value: Partial payment of salary during 3 or 6 months practice SA COUNCIL FOR PROFESSIONAL LAND MATIELAND 7602 Duration: 3 to 6 months practice SURVEYORS AND TECHNICAL SURVEYORS SA DRUGGIST BURSARY Tenable at: Any university or technikon (BURSARIES FOR TECHNIKON STUDY) Eligibility Full-time students who intend to study Field of study. Surveying Field of study. B. (Medical Science) Physical Metallurgy or Foundry in the final year of Value: R7 500 Value: Tuition fees study Duration: 1 semester, renewable if progress is Duration: 1 year Service contract: None Tenable at: University of Stellenbosch satisfactory Closing date: 31 October Eligibility. Awarded on the basis of merit and financial Tenable at: Technikons of Pretoria, Mangosuthu, Further information: need Natal, M.L Sultan, Northern Transvaal, Port Elizabeth SA Foundry Institute Closing date: 15 January and Cape Technikon PO Box 1930 Further information: Eligibility SA citizens KELVIN 2054 Service contract: Must register with the Council for The Assistant Registrar Professional and Technical Surveyors within 3 years of Tygerberg Campus SA INSTITUTE OF RACE RELATIONS (SAIRR) PO Box 19063 completion of the course BURSARIES Closing date: 2 January TYGERBERG 7505 Field of study. Preference given to Science, Engineer- Further information: SA GE EDUCATIONAL TRUST BURSARY ing, Commerce, Agriculture, Education, Public Die Registrar Administration and technical courses SA Council for Professional Land Surveyors Field of study Engineering (any branch, but preferably Value: Amount varies and Technical Surveyors Electrical/Electronics) Duration: 1 year, renewable if progress is satisfactory PO Box 62041 Value: R3 000 Tenable at: Any university, technikon, technical MARSHALLTOWN 2107 Duration: 1 year, renewable college, agricultural college or teacher's training Information not confirmed Tenable at: University of the Witwatersrand college in South Africa Eligibility. Awarded on the basis of financial need and Eligibility Undergraduate SA students SA COUNCIL FOR PROFESSIONAL LAND satisfactory academic performance to a black student Service contract: None SURVEYORS AND TECHNICAL SURVEYORS (Coloured or Indian student if there is no eligible Closing date: 31 October BURSARY black student) Further information: Closing date: 30 September Field of study. Land Surveying Bursary Director Further information: Value: Tuition fees SAIRR The Senior Assistant Registrar Duration: Renewable annually for all 4 years of the PO Box 32597 Financial Aid & Scholarships course BRAAMFONTBN 2017 Tenable at: Universities of Cape Town, Natal and University of the Witwatersrand Information not confirmed Pretoria Private Bag 3 Eligibility. Residents of SA WITS 2050 SA INSTITUTION OF MECHANICAL ENGINEER- Service contract: Must register with the Council for ING MERIT AWARDS Surveyors within 4 years of completion of the course SA INSTITUTE FOR LIBRARIANSHIP AND INFORMATION SCIENCE (SAILIS) (WESTERN Field of study. Mechanical Engineering Closing date: 2 January Value: Contribution towards tuition and residence Further information: CAPE BRANCH) STUDY GRANT fees The Registrar Field of study: Library Science Duration: 1 year, renewable SA Council for Prof Land Surveyors Value: R2 000 Tenable at Any South African university or technikon Value: Determined yearly Service contract The course must be completed Eligibility. Awarded for merit to undergraduate Duration: 1 year, renewable within 4 years and the bursar should be available for university students and final-year National Diploma Tenable at Any approved training institution employment or vacation work technikon students proceeding to a B.Tech degree Eligibility. Undergraduate and postgraduate students Closing date: 30 September Closing date: 31 August Service contract Is required Further information: Further information: Closing date: 30 September Bursary Co-ordinator Bursary Applications Further information: SA Sugar Association SAIMechE The Personnel Manager PO Box 507 PO Box 13395 SA Reserve Bank DURBAN 4000 YEOVILL1 2143 PO Box 427 PRETORIA 0001 SA VISION CARE PTY (LTD) BURSARY SA LIBRARY ASSOCIATION (WEST. CAPE Information not confirmed Field of study. Optometry BRANCH) STUDENT BURSARY Value: Amount varies Field of study. Lower or Higher Diploma in Library SA ROADS BOARD (SARB) BURSARIES Duration: 1 year Science Field of study. Civil Engineering Tenable at: University of Durban-Westville, University Value: Academic fees Value: R20 000 p.a., reviewed annually of the North, Rand Afrikaans University Duration: 1 year Duration: 1 year, renewable Eligibility Final-year students only Tenable at University of the Westem Cape Tenable at Any university Service contract None Eligibility. Final-year Library Science students Eligibility. Prospective and current students who are Closing date: 31 December Closing date: 31 October of the previous year SA citizens Further information: Further information: Service contract One year service for each year for The Management Director The Treasurer which the bursary was received South African Vision Care SA Library Association Closing date: 30 June PO Box 1096 West Cape Branch Further information: FERNDALE 2160 Univ Stellenbosch The Chairman Information not confirmed STELLENBOSCH 7600 SA Roads Board Information not confirmed PO Box 415 SAADAKKER BURSARY PRETORIA 0001 Field of study. Theology SA NATIONAL COMMITTEE ON ILLUMINATION Information not confirmed Value: Determined annually BURSARY Tenable at Rand Afrikaans University Field of study Architecture, Civil and Electrical SA SCHOLARSHIP PROGRAMME Eligibility. Full-time undergraduate Theology students Engineering Field of study. Any field of study. Limited for Law and Closing date: 15 November Value: Amount varies Medicine Further information: Tenable at Cape Technikon Value: Tuition and residence fees plus an allowance The Registrar (Finance) Eligibility. Awarded to National Diploma or B.Tech for books Rand Afrikaans University students Duration: 1 year, renewable if progress is satisfactory PO Box 524 Closing date: 31 January Tenable at: Any university or technikon in SA AUCKLAND PARK 2006 Further information: Eligibility Awarded on the basis of merit and financial The Chairman need to black, Indian and coloured disadvantaged SA SABELO MAGWENTSHU MEMORIAL SCHOLAR- Education and Grants Committee citizens as from the second year of study SHIP FUND Sand Service contract None Field of study. B.Com. 37 Wenning Street Closing date: 30January Value: Variable GROENKLOOF 0181 Further information: Duration: 1 year Information not confirmed The Student Counsellor Tenable at University of Transkei, University of Fort SA Scholarship Programme Hare SA NURSERY ASSOCIATION BURSARY EOP Eligibility. Second-year students Field of study. Horticulture PO Box 3323 Service contract: None Value: R5 600 JOHANNESBURG 2000 Closing date: 31 October Duration: 1 year Further information: Tenable at Cape Technikon, Technikon Natal, SA STUDENTS EDUCATION TRUST BURSARY The Secretary Technikon Pretoria, Peninsula Technikon (SASET) Sabelo Magwentshu Scholarship Fund Eligibility: Deserving Horticultural students after one Field of study Any field of study except Pharmacy PO Box 808 year of study and Dentistry UMTATA Service contract None Value: As determined by sponsor TRANSKO Closing date: 31 August Tenable at Any university or technikon Information not confirmed Further information: Eligibility. Full-time students who are SA citizens SA Nursery Association Closing date: Contact the institution concerned SABIE BOSFEESKOMITEE-BEURS PO Box 514 Further information: Field of study Forestry, Wood Science, Wood HALFWAY HOUSE 1685 The Secretary Technology, Pulp and Paper Science SASET Value: RI 500 p.a. SA ORT BURSARY TRUST PO Box 349 Duration: 1 year, renewable if progress is satisfactory Field of study Any field of study, preferably vocational SALT RIVER 7925 Tenable at University of Stellenbosch, Saasveld or technical Information not confirmed College (Port Elizabeth Technikon) and Natal Tech- Value: Amount varies nikon Duration: 1 year SA SUGAR INDUSTRY TRUST FUND Eligibility Awarded on the basis of merit and financial Tenable at Any technikon or university Field of study Sciences, engineering or agricultural need to undergraduate students as from their second Eligibility: Jewish students in need of financial fields year of study assistance Value: Approximately 80% of tuition and residence Closing date: Contact the institution concerned Service contract: None fees plus a book allowance of a maximum of RI 000 Further information: Further information: Duration: 1 year The bursary office of the institution concerned The Secretary Tenable at. Tertiary institutions in sugar producing SA ORT Bursary Trust areas of SA SAFRIPOL BURSARY PO Box 95090 Eligibility. Students with a direct link to the sugar Field of study. Chemical, Mechanical and Electro- GRANT PARK 2051 industry who are SA citizens, as from the second year mechanical Engineering of study. Bursaries are awarded on the basis of Value: R25 000 each p.a. SA RESERVE BANK BURSARY academic merit or both merit and financial need. Duration: 1 year, renewable for a maximum of 3 Field of study. B.Com., BSc. Preference to students with a rural affiliation years Tenable at Any South African university Tenable at Any tertiary institution Eligibility Matriculants and diploma students (full- Eligibility. Any undergraduate student from the Eligibility. Third- and fourth-year music students who time study) second year of study onwards are citizens of the RSA, Botswana, Lesotho and Service contract A period equal to the number of Service contract None Swaziland for major-subject composition study years for which the bursary was received Closing date: October Closing date: 31 January Closing date: 31 July Further information: Further information: Further information: The Manager. Public Relations The Secretary Board of Trustees Recruitment and Bursaries Safripol Samro Endowment for the National Arts Sanlam Head Office PO Box 700 PO Box 31609 PO Box 1 SASOLBURG 9570 BRAAMFONTEIN 2017 SANLAMHOF 7532 SAKKIE GEYSER BURSARY SAMST BURSARY/LOAN SANLAM PROPERTIES BURSARY Field of study Library and Information Science Field of study. Pharmacy, Dentistry, Occupational Field of study: B.Sc. (Building Management), B.Sc. Value: Variable up to R5 000 Therapy and Physiotherapy (Engineering) (Civil/Structural) Duration: 1 year, renewable Value: Amount varies Value: Tuition and residence fees plus R2 500 for Tenable at: University of Stellenbosch Duration: 1 year, renewable if progress is satisfactory books and pocket money Eligibility: Awarded to students as from the 2nd year Tenable at: Any university in SA Duration: Duration of the course of study on the basis of merit, financial need, Eligibility Full-time undergraduate students Tenable at Universities and technikons leadership potential and suitability for the career Service contract: None Eligibility Awarded to SA citizens on the basis of Closing date: 15 January Closing date: 30 November academic achievement in the year-end examinations Further information: Further information: Service contract: One year service for each year for The Registrar (Bursaries & Loans) The Secretary which the bursary was received if there is a suitable University of Stellenbosch SAMST vacancy available P/Bag X1 PO Box 349 Closing date: 1 December31 January MATIELAND 7602 SALT RIVER 7925 Further information: The Senior Manager. Human Recourses SALMA BURSARIES (FOR UNIVERSITY STUDY) SANDER AND LAURIE OSTROWIAK SCHOLAR- Sanlam Properties Ltd SHIP PO Box 455 Field of study: B.Sc. (Wood Science) (Mechanical RANDBURG 2125 Field of study: Natural Sciences (B.Sc.) Processing) and Mechanical Engineering Information not confirmed Value: R12 000 p.a. Value: Amount varies Duration: 1 year, renewable subject to satisfactory Duration: 1 year, renewable subject to maintaining SANTAM BURSARIES academic performance scholarship standard Tenable at: University of Stellenbosch Tenable at University of the Witwatersrand Field of study: Business Management, Marketing and Eligibility. Deserving students with a natural science Eligibility. Awarded on the basis of academic Financial Management background and an interest in technology, who wish achievement to students as from their second year of Value: Amount varies to specialise in Mechanical Processing study Duration: 1 year Service contract: One year service for each year for Service contract: None Tenable at Technikon SA which the bursary was received Closing date: 10 January Eligibility: Awarded on the basis of academic per- Closing date: 15 January Further information: formance and financial need preferably to second and Further information: The Registrar third-year students The Dean Financial Aid & Scholarships Closing date: 15 November Faculty of Forestry University of the Witwatersrand Further information: University of Stellenbosch P/Bag 3 Financial Aid Officer P/Bag X1 WITS 2050 Technikon SA MAT1ELAND 7602 Private Bag X6 SANLAM BURSARIES (UNIVERSITIES) FLORIDA 1710 SAMRO BURSARIES FOR GENERAL MUSIC Field of study: Actuarial Science, Computer Science SAPPI BURSARY STUDY IN SOUTHERN AFRICA and Accounting with a view on a career as an Field of study: Music chartered accountant Field of study: Chemistry, Chemical, Electrical and Value: R4 000 Value: Tuition, residence and registration fees, an Mechanical Engineering, Forestry and Electro- Tenable at: An approved tertiary institution amount towards books and pocket money plus merit mechanical Engineering Eligibility. First- or second-year music students bursaries based on performance Value: Tuition and residence fees plus a book Closing date: 31 January Duration: The number of years to obtain the qualifi- allowance Further information: cation which is negotiated with the grant of the Duration: 1 year, renewable if progress is satisfactory The Secretary Board of Trustees bursary Tenable at Any university or technikon SAMRO Endowment for the National Arts Tenable at: Any South African university Eligibility. Students with higher grade Mathematics PO Box 31609 Eligibility. Awarded on the basis of academic and Science. A minimum C symbol average is BRAAMFONTEIN 2017 achievement, leadership, merit, versatility and/or the required (university) and a minimum D symbol business needs of the company average (technikon) SAMRO BURSARIES FOR SCHOOL MUSIC Service contract: A period equal to the number of Service contract: Service obligation linked to duration TEACHING IN SOUTHERN AFRICA years for which the bursary was received of bursary Closing date: 31 July Closing date: 30 June Field of study: School Music Teaching Further information: Further information: Value: R4 000 Recruitment and Bursaries The Bursary Officer Tenable at An approved tertiary institution Sanlam SAPPI SA Eligibility. First- or second-year students with Class PO Box 1 PO Box 31560 Music as major subject SANLAMHOF 7532 BRAAMFONTEIN 2017 Closing date: 31 January Information not confirmed Further information: SANLAM BURSARY FOR TECHNIKON STUDENTS The Secretary Board of Trustees SAPREF ENGINEERING SCHOLARSHIP SAMRO Endowment for the National Arts Field of study: Information Technology Field of study Chemical, Electrical, Electronic and PO Box 31609 Value: Tuition, residence and registration fees, an BRAAMFONTEIN 2017 amount towards books and pocket money plus merit Mechanical Engineering bursaries based on performance Value: Tuition and residence fees Duration: 1 year, renewable for duration of the course SAMRO'S INTERMEDIATE BURSARIES FOR Duration: Maximum of 3 years for a diploma and an COMPOSITION STUDY IN SOUTHERN AFRICA additional year for a B.Tech. if progress is satisfactory Tenable at: Any technikon in South Africa Tenable at Any South African university Field of study: Music Value: R4 000 CIercnrioc 219 Eligibility. Awarded on the basis of academic merit to 'General Botha' Old Boys' Ass SHOREDITS BURSARY matriculants and undergraduates who are SA citizens War Memorial Fund Field of study B.Sc. (Building Management) Service contract None PO Box 3767 Value: Tuition fees and a book allowance Closing date: 30 September CAPE TOWN 8000 Duration: 1 year, renewable if progress is satisfactory Further information: Tenable at: University of Pretoria Employee Relations Ass., Shell & BP SCHUMANN-WENGEL BURSARY Eligibility. Full-time undergraduate students in B.Sc. SA Petroleum Refineries (Pty) Ltd Field of study Economic and Management Sciences, (Building Management) as from the second year of PO Box 3179 Natural Sciences, Law study DURBAN 4000 Value: R860 to R4 680 p.a. Closing date: 15 October Information not confirmed Duration: 1 year Further information: Tenable at: Rand Afrikaans University The Head (Study Financing) SAREL AND GERTIE VISSER TRUST FUND Eligibility. Needy full-time students from high schools University of Pretoria (BURSARIES AND LOANS) in the municipal area of Kempton Park as well as from PRETORIA 0002 Field of study: Theology high schools on the East Rand Value: Amount varies Closing date: 15 November SHULTON MUSIC BURSARY Tenable at University of Stellenbosch Further information: Field of study. Music Eligibility. Undergraduate and postgraduate students The Registrar (Finance) Value: Tuition fees Closing date: 28 February Rand Afrikaans University Duration: 1 year Further information: PO Box 524 Tenable at. University of the Witwatersrand Die Skriba AUCKLAND PARK 2006 Eligibility Awarded on the basis of financial need and Kuratorium Kweekskool satisfactory academic performance to a first-year 171 Dorp Street SEIFSA TECHNIKON BURSARY student, preferably who studied previously at STELLENBOSCH 7600 Field of study Engineering, Metallurgy, Information Pelmana Academy, Soweto, or, should there be no Technology (all disciplines) such candidate, a student who studied at Wits Music SASOL CHEMICAL INDUSTRIES BURSARIES FOR Value: Tuition fees plus RI 000. Students employed Enrichment Workshop TECHNIKON STUDIES in the metal and engineering industry receive a Service contract None Field of study. Chemical, Electrical (Light and Heavy bursary covering tuition fees only Closing date: 30 September Current) and Mechanical Engineering Duration: Duration of the course Further information: Value: R5 000 per semester Tenable at Any technikon The Senior Assistant Registrar Duration: Completion of theoretical part of studies Eligibility. Selection is based on academic merit and Financial Aid & Scholarships Office Tenable at Vaal Triangle Technikon interest in employment in the metal industry University of the Witwatersrand Eligibility: Diploma students on the basis of academic Service contract None Private Bag 3 achievement Closing date: First semester: 31 October; second W175 2050 Service contract: Is required semester 30 April Closing date: End of May and October yearly Further information: SIDNEY JACOBZ BURSARY FUND Further information: The Head Field of study. Theology The Human Resources Manager Education and Training Division Value: Amount varies SCI SEIFSA Duration: 1 year PO Box 1 PO Box 1338 Tenable at: University of the Western Cape SASOLBURG 9570 JOHANNESBURG 2000 Eligibility. Full-time students Information not confirmed Service contract None SEIFSA UNIVERSITY SCHOLARSHIP Closing date: First-year students 1 March; seniors 31 SASOL LTD BURSARY Field of study. Chemical, Civil, Electrical, Electronic, October of the previous year Field of study. Chemical, Electrical, Electronic, Industrial, Mechanical, Metallurgical or Agricultural Further information: Mechanical, Metallurgical, Industrial and Mining Engineering, Materials Science Financial Aid Office Engineering; B.Sc. (Hons.) Chemistry; Value: R14 200 pa. University of the Western Cape B.Com.(Computer Science) and B.Com.(Accountancy) Duration: 1 year, renewable before 31. August if Private Bag X17 Value: Tuition, residence and registration fees plus a progress is satisfactory BELLVILLE 7535 cash allowance Tenable at: Any university in South Africa Duration: 1 year, renewable annually if progress is Eligibility. At the basis of academic merit to full-time SIEMENS BURSARY satisfactory undergraduate students Field of study Electrical and Electronic Engineering Tenable at A university Service contract. None Value: Full tuition and residence fees plus an allow- Eligibility Full-time students who are SA citizens Closing date: 31 August ance for books Service contract A period equal to the tenure of the Further information: Duration: 1 year, renewable if progress is satisfactory bursary The Head Tenable at Any university in South Africa Closing date: 1 June Education and Training Division Eligibility. Undergraduate students who have already Further information: SEIFSA started studying Bursary Department PO Box 1338 Service contract A period equal to the number of Sasol Ltd JOHANNESBURG 2000 years for which the bursary was received PO Box 5486 Closing date: 31 July JOHANNESBURG 2000 SERVIER BURSARY Further information: Field of study Medicine (M.B. B.Ch. or Pharm.) Training Department SATS 'GENERAL BOTHA' OLD BOYS' ASSOCIA- Value: Approximately R4 000 Siemens Ltd TION WAR MEMORIAL FUND BURSARY Duration: 1 year, renewable Private Bag X71 Field of study Higher Education Tenable at: University of the Witwatersrand HALFWAY HOUSE 1685 Value: Amounts vary from R400 to RI 000 p.a. Eligibility. Awarded to black and coloured students on (depending on number of applicants) the basis of financial need and satisfactory academic SIR HENRY STRAKOSCH MEMORIAL SCHOL- Duration: Duration of the course (apply each year) performance ARSHIP Tenable at Any tertiary institution Service contract None Field of study Engineering, Geology or Architecture Eligibility: Sons and daughters of ex-cadets of Closing date: 30 September Value: R10 000 p.a. 'General Botha' establishments (training ship, college, Further information: Duration: 1 year, renewable for a maximum of 3 academy) The Senior Assistant Registrar years provided that scholarship standard has been Service contract: None Financial Aid & Scholarships Office maintained Closing date: 31 October, bursaries awarded University of the Witwatersrand Tenable at: University of the Witwatersrand February/March Private Bag 3 Eligibility. Students as from their second year of study Further information: WITS 2050 with outstanding academic achievement and The SATS leadership qualities Bursaries Service contract: None Eligibility Awarded on the basis of academic merit University of Transkei Closing date: 10 January and financial need to deserving South Africans, as Private Bag Xl Further information: from their second year onwards, irrespective of race, UNITRA 5117 Senior Assistant Registrar colour, creed or sex, but preferably African Nursing Financial Aid & Scholarships students SPOORNET University of the Witwatersrand Service contract: None Field of study: Engineering, B.Com., BAccounting, Private Bag 3 Closing date: 31 August of the previous year B.Sc. (Computer Science), BA (Communication) WITS 2050 Further information: Value: Tuition and residence fees plus an allowance The Secretary Duration: Duration of study depending on perform- SMITH AND NEPHEW EDUCATIONAL TRUST The Sally Ginwala Memorial Trust ance BURSARY PO Box 4138 Tenable at: Institution of student's choice DURBAN 4000 Field of study: Medicine Eligibility Undergraduate students Value: R2 500 p2., probably renewable Service contract: Year for year SOLOMON AND ANN WINER BURSARIES Duration: 1 year Closing date: 15 May Tenable at: University of the OFS, University of the Field of study. Science or Engineering, thereafter any Further information: The Manager Witwatersrand other faculties Eligibility. Awarded on the basis of academic Value: At the discretion of the University Spoomet Bursaries achievement and financial need to students as from Duration: 1 year, renewable subject to satisfactory PO Box 2179 their second year of study academic performance, good conduct and continued JOUBERTPARK 2044 Closing date: Contact the university concerned financial need Information not confirmed Further information: Tenable at: University of the Witwatersrand The Rector of the university concerned Eligibility. Awarded on the basis of financial need and SPOORNET academic performance to black students Field of study. Engineering, Commerce SMITH EDUCATION FUND Closing date: 30 September Value: All costs plus an allowance during experiential Further information: Field of study Theology training The Senior Assistant Registrar Duration: 3 years, if progress is satisfactory Value: According to merit Financial Aid & Scholarships Tenable at: Technikon of student's choice Tenable at: University of the OFS University of the Witwatersrand Eligibility: Current and prospective theology students Eligibility Matrics, first-, second- and third-year Private Bag 3 students Service contract: None WITS 2050 Service contract: Is required Closing date: 31 October Closing date: 15 May Further information: SOUTH EASTERN CAPE ATTORNEYS ASSOCIA- Further information: Fouche - Van Rensburg Incorporated TION BRUSARY The Manager PO Box 54 Spoomet Bursaries ROUXVILLE 9958 Field of study: Law Value: R3 500 PO Box 2179 SOCIAL WORK BURSARY Duration: 1 year JOUBERTPARK Tenable at: University of Port Elizabeth Information not confirmed Field of study Social Work Eligibility. B.Proc. or LL.B. students who are in financial Value: Amount varies need and residents of the Eastern Cape STANDARD BANK GROUP BURSARY AND Duration: Duration of the course Closing date: 12 December EDUCATIONAL ASSISTANCE SCHEME Tenable at: University of Stellenbosch Further information: Field of study. Any field of study. Preference to Eligibility Needy and deserving undergraduate Financial Support Office professional/commercial fields of study students UPE Value: Depending on number of applications Service contract: None PO Box 1600 Duration: 1 year Closing date: 15 January PORT ELIZABETH 6000 Tenable at: Any South African tertiary educational Further information: The Registrar (Bursaries and Loans) institution SOUTHERN AFRICAN INSTITUTE FOR STEEL Eligibility Children of employees and pensioners of University of Stellenbosch CONSTRUCTION BURSARIES the Standard Bank Group may apply for assistance P/Bag Xl under this scheme MATIELAND 7602 Field of study: Civil Engineering Value: Tuition fees Further information: The Standard Bank SOL MOSHAL BURSARY Duration: 1 year, renewable depending on academic performance Human Resourses Division Field of study Forestry (Forest Management or Wood Tenable at: Any university in South Africa PO Box 7758 Science) Eligibility. South African citizens JOHANNESBURG 2000 Value: R400 Service contract: Applicable to third- and fourth-year Information not confirmed Duration: Duration of the course students Tenable at: University of Stellenbosch Closing date: 31 August STANDARD BANK SCHOLARSHIP SCHEME Eligibility. A needy and academically above-average Further information: Field of study Business Studies, Building, Engineering, student in any year of study The Bursary Co-ordinator Service contract: None, but the Bursar is expected to Health Sciences SA Institute of Steel Construction inquire about vacancies at Mondi Timbers Value: Amount varies PO Box 1338 Duration: 1 year Closing date: 15 January JOHANNESBURG 2000 Tenable at: Any technikon Further information: Information not confirmed Eligibility Awarded on the basis of academic merit to The Registrar (Bursaries and Loans) full-time first-year undergraduate and postgraduate University of Stellenbosch SPARGS WHOLESALE BURSARY students who are permanent residents of SA P /Bag Xl Closing date: Contact the technikon concerned MAT1ELAND 7602 Field of study B.Com. (Accounting) Value: Tuition and residence fees Further information: The Registrar of the technikon concerned SOLLY GINWALA MEMORIAL TRUST BURSARY Tenable at: University of Transkei Eligibility. First-year Transkeien-bom students Field of study A degree or diploma course in any field studying towards a B.Com. (Accounting) degree for STANWAY EDWARDS NGOMANE GROUP of study the purpose of proceeding to qualify as chartered BURSARY Value: Variable, up to a maximum of R500 accountants and who meet the conditions of the Field of study: All fields related to transportation Duration: Duration of the relevant academic year bursary subject to satisfactory progress and good conduct planning and traffic engineering Closing date: Contact the University Value: Tuition and hostel fees and books Tenable at: Any university or college in South Africa Further information: Duration: Annual The Bursary Officer Tenable at: Any tertiary education institution Financial Aid Bureau Eligibility. All academic years 236 CtIltrcariesc 221 Service contract By arrangement Duration: 1 year Eligibility Undergraduate students. Award is based on Closing date: 30 December Tenable at University of Stellenbosch academic achievements, aptitude, character, person- Further information: Eligibility. A promising final-year student ality and financial position of the applicant The Bursary Administrator Service contract None Service contract: One year service for each year for Stanway Edwards Ngomane Associates Closing date: End of first term of the year concerned which the bursary was received PO Box 11555 Further information: Closing date: 15 October HATFIELD 0028 The Registrar (Bursaries and Loans) Further information: University of Stellenbosch Group Human Resources Manager STATE STUDY LOAN FUND P/Bag X1 Stocks and Stocks Holdings Ltd Field of study. Fields of study which are annually MAT1ELAND 7602 Private Bag X022 published in the Bursary Notice of the Commission RIVONIA 2128 Information not confirmed for Administration STEVE LOUW SCHOLARSHIPS Value: Maximum of R6 160 p.a. Field of study Law Duration: 1 year, renewable Value: Amount varies STUDENT SERVICES CENTRE BURSARIES Tenable at: Rand Afrikaans University Duration: 1 year Field of study Any field of study, except Dentistry and Eligibility. Full-time needy, merit worthy candidates Tenable at: University of Stellenbosch Pharmacy who are not able to continue their studies without Eligibility. Awarded on the basis of financial need and Value: Variable. The amount is determined by the financial aid academic and sport achievements Trustee Closing date: 15 November Closing date: 15 January Duration: 1 year, renewable Further information: Further information: Tenable at University of the Western Cape The Registrar (Finance) The Registrar (Bursaries and Loans) Eligibility Full-time students Rand Afrikaans University University of Stellenbosch Closing date: 30 November of the previous year PO Box 524 PO Box X1 Further information: AUCKLAND PARK 2006 MATIELAND 7602 The Secretary SSC PO Box 349 STELLA AND PAUL LOEWENSTEIN CHARITABLE STEVE ROSSOUW BURSARY SALT RIVER 7925 AND EDUCATIONAL TRUST BURSARIES Field of study B.Com. (Accounting) Information not confirmed Field of study. Science or Engineering Value: R860 to R4 680 pa. STUDIETRUST BURSARY Value: Amount varies Duration: 1 year Duration: 1 year, renewable Tenable at Rand Afrikaans University Field of study. Preferred fields of study. Agriculture, Tenable at University of the Witwatersrand Eligibility. Full-time second- and third-year students Commerce, Engineering Eligibility. Awarded on the basis of financial need and Closing date: 15 November Value: R2 500 for technikon and university students satisfactory academic performance Further information: and RI 050 R1200 for college students Closing date: 30 September The Registrar (Finance) Duration: 1 year, renewable Further information: Rand Afrikaans University Tenable at Any university, technikon or teacher's The Senior Assistant Registrar PO Box 524 training college Financial Aid & Scholarships AUCKLAND PARK 2006 Eligibility. Open to all races from anywhere in South University of the Witwatersrand Africa on the basis of academic merit, financial need Private Bag 3 STEWART SCOTT BURSARY and career-oriented study courses WITS 2050 Field of study. Engineering: Civil, Electrical, Mechanical Service contract None Value: Variable Closing date: 31 August STELLENBOSCH AGRICULTURAL SOCIETY Duration: 1 year, renewable Further information: BURSARY Tenable at: Any university or technikon Studietrust PO Box 29192 Field of study. Agriculture and Home Economics Eligibility. Citizens of South Africa MELVILLE 2109 Value: R400 Service contract: Year-for-year service contract. Duration: 1 year Required to do vacation work Tenable at University of Stellenbosch Closing date: 31 August SWISS RE SA Eligibility. A needy and deserving undergraduate Further information: Field of study. Commerce student bom in, or living in the divisional council Human Resources Director Value: Tuition and residence fees plus a book district of Stellenbosch PO Box 784361 allowance Service contract None SANDTON 2146 Duration: 1 year, renewable if progress is satisfactory Closing date: 15 January Tenable at University of the Witwatersrand Further information: STIGLINGH MEMORIAL BURSARY Eligibility. Black students as from their second year of The Registrar (Bursaries and Loans) Field of study. Natural Sciences or Medicine study Service contract: One year service for each year for University of Stellenbosch Value: R3 000 p.a. which the bursary was received P/Bag X1 Duration: 1 year, renewable MATIELAND 7602 Tenable at: The universities where these courses are Closing date: None offered Further information: STELLENBOSCH BOERE-ORKES-BEURS Eligibility. Awarded to public servants and/or The Bursaries Officer Swiss Re Southern Africa Field of study. Music members of the Association and their dependent PO Box 7049 Value: R500 children, as from the second year of study. Preference Duration: 1 year given to members of the Association and their JOHANNESBURG 2000 Information not confirmed Tenable at University of Stellenbosch children Eligibility. A deserving and needy undergraduate Service contract: None SWISS RE SA LTD BURSARY (ACTUARIAL student Closing date: Contact the university concerned SCIENCE) Service contract: None Further information: Closing date: 15 January The Registrar of the university concerned Field of study. Actuarial Science Further information: Value: Tuition and residence fees plus a book The Registrar (Bursaries and Loans) STOCKS AND STOCKS MANAGEMENT UNIVER- allowance University of Stellenbosch SITY BURSARY Duration: 1 year, renewable if progress is satisfactory Tenable at: University of the Witwatersrand P/Bag XI Field of study B.Sc. (Building Management) Eligibility. Undergraduate students with academic MAT1ELAND 7602 Value: Varies from year to year merit Duration: Duration of the course if progress is Service contract: One year service for each year for STELLENBOSCH CHAMBER OF COMMERCE satisfactory which the bursary was received BURSARY Tenable at Any South African university Closing date: None Field of study Commerce Further information: Value: R750 Bursaries Tenable at: Universities of Cape Town, Stellenbosch The Bursaries Officer Eligibility. Employees of the company for full-time or and the Western Cape Swiss Re Southern Africa Ltd part-time study. Applicants must be South African Eligibility. Full-time, needy, coloured and African PO Box 7049 citizens, hold a matriculation certificate or equivalent students from the Western Cape JOHANNESBURG 2000 with English and Afrikaans as subjects (as well as Service contract: None Information not confirmed Mathematics and Physical Science in the case of prospective B.Sc. students): and be in good health. Closing date: Contact the university concerned Further information: TEACHERS' ASSOCIATION OF TRANSVAAL Those who are not employed by the company must The Registrar of the university concerned SECONDARY SCHOOLS BURSARY enter the service of Telkom should their applications be successful. Matriculants and students already Field of study Economic and Management Sciences, studying may also apply TRANSFARM BURSARY Natural Sciences, Education Service contract: Must remain in the service of Telkom Value: R860 R4 680 p.a. Field of study Pharmacy for a period equivalent to the tenure of the bursary Value: R5 000 Duration: 1 year, renewable Closing date: 30 September Duration: 1 year Tenable at: Rand Afrikaans University Further information: Tenable at Potchefstroom University for CHE Eligibility. Teachers or student teachers who under- The General Manager Eligibility. Awarded on the basis of financial need and take to teach at least 3 years at Transvaal high Human Resource Planning and Provision academic performance to final-year students schools Private Bag X780 Service contract: None Closing date: 15 November PRETORIA 0001 Closing date: 15 October Further information: Information not confirmed Further information: The Registrar (Finance) The Director (Financial Bureau) Rand Afrikaans University TETJE PATTISON BURSARIES PU for CHE PO Box 524 P/Bag X1006 AUCKLAND PARK 2006 Field of study. Architecture (B.Arch./BAS), Biblical and Religious Studies and Medicine (M.B. B.Ch.) POTCHEFSTROOM 2520 TECHNICARE BURSARY Value: At the discretion of the University Duration: 1 year TRANSKEI INSURANCE BROKERS BURSARY Field of study. Computer Systems Engineering Tenable at University of the Witwatersrand Field of study. B.Com. Value: R2 000 Eligibility. A Christian student in the sixth year of Value: RI 500 Tenable at: Technikon Witwatersrand study for the courses Architecture and Medicine, as Tenable at University of Transkei Eligibility: Awarded on merit to S4 students well as a registered student for Biblical and Religious Eligibility. Second-year Transkeian bom students Closing date: I st semester 31 May; 2nd semester: 15 Studies III Closing date: Contact the University November Closing date: 30 September Further information: Further information: Further information: The Bursary Officer Human Resources Manager The Senior Assistant Registrar Financial Aid Bureau Technicare Financial Aid & Scholarships University of Transkei PO Box 1461 University of the Witwatersrand Private Bag X1 PRETORIA 0001 Private Bag 3 UNITRA 5117 WITS 2050 TECHNIKON FREE STATE BURSARIES TRANSKEI NATIONAL BURSARY Field of study Contact the Technikon THEOLOGICAL STUDENTS PROVIDENT FUND Field of study Commerce Tenable at: Technikon Free State (LOAN) Value: RI 000 Eligibility. Contact the Technikon for more informa- Reid of study Theology, BA (Admissie), B.Th. Tenable at: University of Transkei tion Value: Amount varies Eligibility. Second-year Trankeian born students Further information: Duration: Awarded annually for 6 years Closing date: Contact the University The Bursary Officer Tenable at: University of the OFS Further information: Bursaries & Loans Eligibility. Undergraduate and postgraduate theology The Bursary Officer Technikon Free State students up to B.Th.III Financial Aid Bureau Private Bag X20539 Service contract: Should enter the ministry of the University of Transkei BLOEMFONTEIN 9300 Dutch Reformed Church after completion of studies Private Bag X1 Closing date: 31 August UNITRA 51 17 TECHNIKON NORTHERN TRANSVAAL BUR- Further information: SARIES/LOANS Director. Administration & Finance TRANSKEI TEA MANAGEMENT Field of study Contact the Technikon Dutch Reformed Church in the OFS Field of study: Agricultural Management, Agronomy, Tenable at Technikon Northem Transvaal PO Box 399 Horticulture, Economics, Engineering Eligibility. Registered students BLOEMFONTEIN 9300 Value: All costs Closing date: Contact the Technikon Duration: 1 year Further information: THEOLOGICAL TRAINING FUND (NEDERDUITCH Tenable at: University of Natal The Head HERVORMDE KERK VAN AFRIKA) Eligibility Transkeien students Financial Aid Bureau Field of study Theology Service contract: 1 year service for each year for which Technikon Northern Transvaal Value: Variable the bursary was received Private Bag X07 Duration: Duration of the course Closing date: 31 August PRETORIA NORTH 0116 Tenable at: University of Pretoria Further information: Eligibility. Theological students of the Nederduitsch Transkei Tea Management (Pty) Ltd TELKOM SA (LTD) BURSARY AND STUDY AID Hervormde Kerk van Afrika for BA and B.D. study PO Box 931 SCHEME (ALL REGIONS) Service contract: Should enter the ministry of the UMTATA Field of study Electrical (Light Current), Electronic and Nederduitsch Hervormde Kerk after completion of TRANSKEI Mechanical Engineering; B.Sc. (Computer Science), studies Information not confirmed B.Com. (Accounting, Financial Management, Internal Closing date: 31 January Auditing and Marketing) Further information: TRANSNET BURSARY Value: Academic and residential fees plus an addi- Die Skriba Field of study Civil, Electrical, Electro-Mechanical, tional amount Curatory for Theological Education Electronic, Industrial and Mechanical Engineering; Duration: Duration of the course if progress is PO Box 2368 Computer Science; Chemistry; Human Resources satisfactory PRETORIA 0001 Management; Industrial Psychology Information Tenable at: Any university, technikon or technical Technology; Computer Science; Transport Econom- college in SA TILLY STAPPER TRUST (BURSARY) ics: Transport Logistics; Economics; Accounting; Field of study. Teaching, Medicine Business Economics; Marketing Management; Value: Amount varies Purchasing Management; Land Surveying Duration: 1 year, renewable 23.3 Bursaries 223 Value: Tuition and residence fees plus a book and Service contract: One year service for each year for Closing date: 15 January miscelaneous allowance which the bursary was received Further information: Duration: Renewed annually Closing date: 18 August The Area Facilitator Tenable at Any university or technikon in SA Further information: The Ubuntu Foundation Eligibility: Full-time undergraduate and pre-diploma Superintendent General PO Box 39058 students Bursary Dept CRAWFORD 7770 Service contract: One year service for each year for Private Bag X221 Information not confirmed which the bursary was received PRETORIA 0001 Closing date: 15 May Information not confirmed UMGENI WATER BURSARY Further information: Field of study: CMI, Mechanical and Chemical Manager TREK PETROLEUM BURSARY Engineering, Microbiology, Analytical Chemistry, Transnet Bursaries Field of study: B.Com., B.Business Science Accounting, B.Com./B.Sc. (Information Systems) PO Box 23200 Value: All fees Value: Tuition and residence fees plus a book JOUBERT PARK 2044 Tenable at: Universities of Natal, Cape Town, allowance Witwatersrand and Peninsula Technikon Duration: Duration of study (3-4 years) TRANSPORT TECHNICAL INDUSTRIES (PTY) LTD Eligibility: Undergraduate black South African citizens Tenable at Any tertiary institution in Natal (TTI) BURSARY with good academic performance. Preferably from the Eligibility: Diploma or degree students Field of study: B.Com. (Transport Economics) and second year onwards Service contract: One year service for each year for B.Com. (Hons) (Transport Economics) Service contract: One year service for each year for which the bursary was received Value: Tuition and residence fees and related costs which the bursary was received Closing date: 31 August Tenable at: Rand Afrikaans University Closing date: Contact the university concerned Further information: Eligibility Undergraduate and postgraduate students Further information: Training and Development Officer Closing date: 30 September The Manpower Manager Human Resources Further information: Trek Petroleum (Pty) Ltd Umgeni Water The Secretary PO Box 4448 PO Box 9 Dept of Transport Economics RANDBURG 2125 PIETERMARITZBURG 3200 Rand Afrikaans University Information not confirmed Information not confirmed PO Box 524 AUCKLAND PARK 2006 TUPPERWARE BURSARY UNITED NATIONS EDUCATIONAL AND TRAIN- Field of study: Chemistry, B.Com. (Business Econom- ING PROGRAMME FOR SOUTHERN AFRICA (UNETPSA) BURSARIES TRANSVAAL ASSOCIATION OF TEACHERS ics) LOAN/BURSARY Value: Tuition and book fees plus pocket money Field of study: Commerce, Science, Education, Law Field of study: Teaching Duration: 1 year and Medical related courses Value: R250 Tenable at: Potchefstroom University for CHE Value: Tuition, residence and books Tenable at: University of the Western Cape Eligibility: Awarded on the basis of academic Duration: 1 year Eligibility: Students residing in Transvaal achievement to students from the second year of Tenable at: University of the Western Cape Closing date: 31 December of the previous year study Eligibility: Full-time students Further information: Service contract: One year service for each year for Closing date: First-year students: 1 March; current The Secretary which the bursary was received students: 31 October of the previous year PO Box 356 Closing date: 15 October Further information: NEWCLARE Further information: The Registrar JOHANNESBURG 2112 The Director (Financial Bureau) University of the Western Cape Information not confirmed PU for CHE Private Bag X17 Private Bag X6001 BELLVILLE 7535 TRANSVAAL INTER-CONSTITUTIONAL MA- POTCHEFSTROOM 2520 SONIC CHARITY LOAN UNITRANS LTD BURSARY Field of study: Any field of tertiary study leading to TURKSTRA BURSARY Field of study: Transport Economics gainful employment Field of study: Social Work Value: Determined annually Value: Approximately R3 500 pa. Value: R100 p.a. Duration: 1 year Duration: Renewable annually for duration of the Duration: 1 year Tenable at Rand Afrikaans University course if progress is satisfactory Tenable at: Potchefstroom University for CHE Eligibility. Full-time undergraduate and postgraduate Tenable at Any university, technikon, teacher's Eligibility: A needy and deserving undergraduate students with Transport Economics as major training college or technical college student Service contract: One year service for each year for Eligibility: Awarded on the basis of academic potential Service contract: None which the bursary was received and financial need to matriculants and undergradu- Closing date: 15 October Closing date: 15 November ates. Please note: Father of applicant must be (or have Further information: Further information: been if deceased) a subscribing member of a Masonic The Director (Financial Bureau) The Secretary body within the area contributing to the Transvaal PU for CHE Dept Transport Economics Inter-Constitutional Masonic Charity Private Bag X6001 Rand Afrikaans University Service contract: None POTCHEFSTROOM 2520 PO Box 524 Closing date: 31 October AUCKLAND PARK 2006 Further information: UBUNTU PROGRAMME STUDY FACILITATION The student must apply through relevant Masonic FUND UNIVERSITY OF DURBAN-WESTVILLE BUR- SARIES AND LOANS lodge/constitution Field of study: All disciplines except Medicine with Information not confirmed preference to scientific, technical and applied studies Field of study: Contact the University Value: Tuition, residence and book fees plus an Tenable at: University of Durban-Westville TRANSVAAL PROVINCIAL ADMINISTRATION allowance Eligibility: Awarded primarily on financial need (TPA) BURSARY Duration: 1 year, renewable with maximum of 4 years Closing date: 15 November Field of study: Primarily Medicine and ancillary Health Tenable at: All registered educational institutions Further information: Sciences Eligibility South African citizens with challenging The Head: Financial Aid Bureau Value: M.B,Ch.B: R15 600 p.a.; B.Logopedics, circumstances and involvement in the community University of Durban-Westville B.Occupational Therapy, B.Physiotherpy, B.Pharmacy Service contract: The incumbent is required to act as Private Bag X54001 and B.Dietetics: R12 900 p.a. Ubuntu 'Ambassador' on the campus of tenure and to DURBAN 4000 Duration: Duration of the course facilitate on ad hoc basis for the Ubuntu Programme Tenable at: Any university in Gauteng Province RSA. Continuation of further years depends on UNIVERSITY OF DURBAN-WESTVILLE SCHOL- Eligibility: Full-time undergraduate students as from whether incumbent has managed to initiate a viable ARSHIPS the second year of study Ubuntu Project in his/her area of choice Field of study: Contact the University 23D Bursaries Value: Depends on the merit rating of successful Further information: Further information: aplicants and the amounts donated The Registrar (Head: Bursaries & Loans) The Registrar Vista University Tenable at: University of Durban-Westville University of Stellenbosch Eligibility. Allocated stricty on merit P /Bag Xl Private Bag X634 PRETORIA 0001 Closing date: 15 November MATIELAND 7602 Further information: VKE BURSARY The Head: Financial Aid Bureau VAN EWIJCK FOUNDATION MERIT BURSARIES University of Durban-Westville Field of study: Nederlandse or Afrikaanse Kultuurges- Field of study: Civil and Electrical Engineering Private Bag X54001 kiedenis, Taal en Letterkunde Value: Tuition and residence fees plus a cash DURBAN 4000 Value: R5 000 allowance (maximum R20 000 pa.) Duration: 1 year, renewable if progress is satisfactory Duration: 1 year, renewable if progress is satisfactory UNIVERSITY OF THE NORTH BURSARIES Tenable at: University of Stellenbosch, University of Tenable at: Universities of Stellenbosch, Cape Town, Witwatersrand, Pretoria, Natal and the Rand Afrikaans Field of study: Contact the University the Western Cape Tenable at: University of the North Eligibility Awarded on the basis of academic University Eligibility: Full-time undergraduate students Eligibility Contact the University for more information achievement to undergraduate students from their Service contract: One year service for each year for Further information: second year of study as well as to postgraduate which the bursary was awarded The Registrar students Closing date: 31 July University of the North Service contract: None Further information: Private Bag Xl 106 Closing date: Contact the university concerned The Personnel Manager SOVENGA 0727 Further information: The Registrar of the university concerned VKE Engineers PO Box 1462 US-VROUEVERENIGING BEURS VENDA DEVELOPMENT CORPORATION BUR- PINEGOWRIE 2123 Field of study. Music SARY Value: R3 000 p.a. VODACOM BURSARY SCHEME Duration: 1 year Field of study: Any field of study except Education Field of study: Electronic Engineering, Information Tenable at: University of Stellenbosch Value: R7 000 maximum Eligibility: A deserving third-year music student for Duration: 1 year, renewable Services Value: All tuition fees p.a. at the Companys discretion performance in any musical instrument or singing Tenable at: Any university Duration: 1 year, renewable if progress is satisfactory Service contract: None Eligibility Venda citizens Tenable at: Any university or technikon in South Africa Closing date: 30 September Service contract: One year service for each year for Eligibility: Awarded on the basis of financial need and Further information: which the bursary was awarded academic merit to full-time students from their The Chairman: Dept of Music Closing date: Contact the university concerned second year of study University of Stellenbosch Further information: Service contract: A period of compulsory service to be P/Bag Xl The Manager (Training) negotiated MATIELAND 7602 Venda Development Corporation Ltd PO Box 9 Closing date: 30 June Further information: VAAL TRIANGLE TECHNIKON BURSARIES AND SIBASA The Bursary Office LOANS VENDA Information not confirmed Human Resources Division Field of study: Contact the Technikon Vodacom (Pty) Ltd Value: Amount varies VERENIGING VIR VOLKSANG EN MUSIEK-BEURS Private Bag X9904 Tenable at: Vaal Triangle Technikon SANDTON 2146 Eligibility: Bursaries are available in the following Field of study: Music Value: R250 categories: sport, culture and on merit. There are also VOLKSWAGEN BURSARY special bursaries for undergraduates, physically Duration: 1 year Field of study: Commerce, Computer Science, handicapped students as well as family bursaries. Tenable at: University of Stellenbosch Engineering Loans are also available to students in need Eligibility: A deserving and needy student Value: Tuition, registration and accommodation fees Closing date: 31 October and 31 May Service contract: None Closing date: 15 January plus an allowance for books Further information: Duration: Renewable annually for the duration of the The Head Further information: course if progress is satisfactory Financial Aid Bureau The Registrar (Bursaries and Loans) Tenable at: Any university or technikon Technikon Vaal Triangle University of Stellenbosch Eligibility Awarded as from the second year of study Private Bag X021 Private Bag X1 to university or technikon students who are perma- VANDERBIJLPARK 1900 MATIELAND 7602 nent residents of South Africa. Selection is based on academic merit and suitability for the intended course VAN DER SPUY SCHOLARSHIP VERWOERDBURGSE JUNIOR RAPPORTRYERS- BEURS of study Field of study B.Sc. (Survey) only Service contract: Work for one half of the number of Field of study: Any field of study. Preference given to Value: Tuition fees years that the bursary was held Communication and Theology Duration: 1 year, renewable Closing date: 31 August R4 680 Tenable at: University of Cape Town Value: R860 Further information: Duration: 1 year, renewable Eligibility. Matriculants with a B aggregate in Mathe- Corporate Education Department matics and Physical Science. SA citizens only Tenable at: Rand Afrikaans University Volkswagen of South Africa Eligibility: Full-time undergraduate students. Closing date: 15 December (Pry) Ltd Preference to Afrikaans-speaking residents of Further information: PO Box 80 Centurion The Secretary UITENHAGE 6230 Inst of Professional Land Service contract: None Information not confirmed Surveyors of Western Cape Closing date: 15 November PO Box 15873 Further information: W.K. KELLOGG FOUNDATION BURSARIES VLAEBERG 8018 The Registrar (Finance) Rand Afrikaans University Field of study: Natural Sciences, Health Sciences, Education, Commerce, Business Administration, VAN ENTER KRYNAUW BURSARY FUND PO Box 524 AUCKLAND PARK 2006 Pharmacy, Information Sciences, Economics Field of study: Social Work Value: Tuition, residence fees and book allowance Value: Variable VISTA UNIVERSITY BURSARIES AND LOANS Duration: 1 year, renewable Duration: 1 year, renewable Tenable at: University of the Witwatersrand, University Field of study: Contact the University Tenable at: University of Stellenbosch of the Western Cape Eligibility: Awarded on the basis of merit and financial Tenable at: Vista University need with preference to orphans Eligibility: Full-time students Closing date: 15 January Closing date: Contact the University 240 R irgrigt 225 Eligibility. Awarded on the basis of financial need and Duration: 1 year Duration: 1 year satisfactory academic performance to educationally Tenable at University of Stellenbosch Tenable at University of Stellenbosch disadvantaged students who should be involved in Eligibility An undergraduate female student, prefera- Eligibility. Awarded on the basis of financial need to community service bly from the Humansdorp district students who desire to be trained as missionaries or Service contract: None Service contract: None ministers Closing date: Contact the university concerned Closing date: 15 January Service contract: None Further information: Further information: Closing date: 15 January The bursaries officer of the university concerned The Registrar (Bursaries and Loans) Further information: University of Stellenbosch The Registrar (Bursaries and Loans) W.L. HECKROODT STUDY LOAN FUND Private Bag X1 University of Stellenbosch Field of study: Afrikaans History MATIELAND 7602 Private Bag X1 Value: Maximum of R6 160 p.a. MATIELAND 7602 Duration: 1 year WESTERN CAPE EDUCATION DEPARTMENT Tenable at. Rand Afrikaans University BURSARIES WILLEM DE KOCK GEOLOGY BURSARIES Eligibility. Full-time needy, merit worthy students who Field of study. Education Field of study Geology are unable to continue their studies without financial Value: Full-time: R4 500 for universities, technikons Value: Amount varies aid and colleges of education; part-time: R1 000 for Duration: 1 year Service contract: None study at universities Tenable at: University of Stellenbosch Closing date: 15 November Duration: Full duration of the course Eligibility Awarded on the basis of financial need and Further information: Tenable at Any university, technikon or college of satisfactory academic performance to white students The Registrar (Finance) education Closing date: 15 January Rand Afrikaans University Eligibility. Prospective teachers and full-time students Further information: PO Box 524 from the Westem Cape who have been selected by The Registrar (Bursaries and Loans) AUCKLAND PARK 2006 the Western Cape Education Department and who are University of Stellenbosch following approved educational courses Private Bag X1 WALTER POLLAK BURSARY Service contract: Is required MATIELAND 7602 Field of study: Law Closing date: 31 August Value: At the discretion of the University Further information: WILLEM PRETORIUS BURSARY Duration: 1 year, renewable subject to availability of The Executive Director Field of study Economics and Agricultural Economics funds Westem Cape Education Department Value: Amount varies Tenable at University of the Witwatersrand Bursary Application Section Duration: 1 year Eligibility. Awarded on the basis of financial need and Private Bag 9008 Tenable at: University of Stellenbosch satisfactory academic performance to a deserving CAPE TOWN 8000 Eligibility Awarded on the basis of financial need and student in the Faculty of Law Information not confirmed academic merit Closing date: 30 September Service contract: None Further information: WESTERN CAPE SOCIETY OF CHARTERED Closing date: 15 January The Senior Assistant Registrar ACCOUNTANTS BURSARIES Further information: Financial Aid & Scholarships Field of study. Accounting The Registrar (Bursaries and Loans) University of the Witwatersrand Value: RI 250 p.a. University of Stellenbosch Private Bag 3 Duration: 1 year Private Bag X1 WITS 2050 Tenable at UNISA or any university in the Cape MATIELAND 7602 Province WARNER LAMBERT BURSARY Eligibility: Students who are registered as trainee WILLIAM FREDERICK BENARD SCHOLARSHIP Field of study. Dentistry, Pharmacy and Science accountants and are studying part-time FUND Duration: 1 year Closing date: 31 January Field of study B.Sc. (Eng.) (Civil Engineering) Tenable at: University of the Western Cape Further information: Value: At the discretion of the University Eligibility. Full-time students The Secretary Duration: 1 year, renewable Service contract: None The Western Cape Society of Tenable at: University of the Witwatersrand Closing date: First-year students: 1 March; senior Chartered Accountants Eligibility. Awarded on the basis of financial need and students: 31 October of the previous year PO Box 4484 satisfactory academic performance Further information: CAPE TOWN 8000 Closing date: 30 September Financial Aid Office Further information: University of the Western Cape WESTONARIA BURSARY LOAN FUND The Senior Assistant Registrar Private Bag )(17 Field of study Local government related studies Financial Aid & Scholarships BELLVILLE 7535 Value: R2 000 p.a. University of the Witwatersrand Duration: Maximum of 1 year (possible re-allocation Private Bag 3 WATSON EDWARDS BURSARY on application) WITS 2050 Field of study. Mechanical and Electrical Engineering Tenable at: Any tertiary institution, registered WIMBLE, CAIRNS AND TAYLOR SCHOLARSHIP (Light and Heavy Current) according to stipulations by the Local Government Value: R12 000 Ordinance 17 of 1939 Field of study Commerce Duration: 1 year, renewable on academic merit Eligibility Full-time students whose parents are bona Value: RI 500 pa. Tenable at Any university in South Africa fide residents of Westonaria and whose service Duration: 1 year, renewable for third year of study if Eligibility. South African citizens as from their second accounts are fully paid up. Parent/guardian must be a scholarship standard is maintained year of study permanent employee of the Council and a ratepayer Tenable at University of the Witwatersrand Service contract: Minimum of two years service of property in the municipal boundary Eligibility Awarded on academic merit to a full-time, contract and vacation employment depending on the Service contract: None second-year B.Com. student duration of the bursary Closing date: 31 December Service contract: None Closing date: 30 September Further information: Closing date: 10 January Further information: The Town Secretary Further information: Human Resources Manager Westonaria Municipality Financial Aid & Scholarships Watson Edwards (Pty) Ltd PO Box 19 University of the Witwatersrand PO Box 98867 WESTONARIA 1780 Private Bag 3 SLOANE PARK 2152 Information not confirmed WITS 2050 WENTZEL BURSARY WILHELMINA DU TOIT NYBOER BURSARY WINIFRED WILSON BURSARY Field of study. B.Prim.Ed. Field of study. Theology Field of study. English Value: R250 Value: Amount varies Value: Amount varies 226 Eligibility Undergraduate students in fourth year of Duration: I year, renewable for duration of the course Eligibility Full-time female students Tenable at: Any university in South Africa Service contract: None study only Eligibility. Full-time students as from their second Closing date: 15 November Service contract: One year service year of study who intend to major in English Further information: Closing date: 30 November Further information: Service contract: None The Registrar (Finance) Closing date: Contact the university concerned Rand Afrikaans University The Manager Workmen's Accident & Rebabilitation Further information: PO Box 524 PO Box 30001 The Registrar of the university concerned AUCKLAND PARK 2006 MAYVILLE 4058 WOMEN'S AND MOTHER'S MOVEMENT ATKV WORKMEN'S ACCIDENT AND REHABILITATION (SAR & H) JOHANNESBURG BURSARY CENTRE BURSARY DURBAN Field of study: Social Work Field of study Physiotherapy, Occupational Therapy Value: Determined annually Value: R8 000 p.a. Duration: 1 year, renewable Duration: 1 year Tenable at: Rand Afrikaans University Tenable at Any university in South Africa 242 I rc atripc 227 Agricultural Engineering ATKV STUDY LOAN FOR PART-TIME STUDY, EVANGELICAL LUTHERAN CHURCH IN SA 178 BURSARY, 149 FORD BURSARY, 193 Index According AVBOB BURSARY, 144 EVE ANDERSON BURSARY, 150 JOHN DEERE BURSARY, 201 AVBOB STUDY LOAN FUND, 179 EXPO FOR YOUNG SCIENTISTS BURSARY, 150 to Field of Study SEIFSA UNIVERSITY SCHOLARSHIP, 220 AVRIL FRIEDA MALAN BURSARY, 144 F.W. KNACKE BURSARY, 150 Agricultural Management AVRIL FRIEDA MALAN STUDY LOAN FUND, 144 FAMILY BURSARY, 150 A NCORA IRRIGATION SCHEME AGRICULTURAL B.SM AND HC GOLDSTEIN BURSARY. 144 FANNY AND SHLOMO BACKEN BURSARY, 192 BURSARY. 209 B.G. HEYDENRYCH BURSARY, 179 FELIX EN CHRISTINE GUT BURSARY LOAN Accounting TRANSKEI TEA MANAGEMENT. 223 BACHE BABOO BENEVOLENT FUND, 144 (GENERAL), 150 ACCOUNTING TECHNICIANS BURSARY BANK OF TRANSKEI BURSARY. 144 FEMNET ELIZABETH LOUW BURSARY. 150 PROGRAMME. 174 Agricultural Sciences BEDFORDVIEW BURSARY SCHEME, 144 FINNISH GOVERNMENT BURSARY, 150 AGRICULTURAL RESEARCH COUNCIL (ARC) AMPLATS BURSARY SCHEME. 177 BENJAMIN AND MIRIAM DRIERAND BURSARY FIRST NATIONAL BANK OF SA LTD STUDENT ANGLO AMERICAN CORPORATION OF SA ORDINARY BURSARIES, 175 FUND, 144 LOAN, I50 AGRICULTURAL RESEARCH COUNCIL (ARC) LIMITED BRIDGING PROGRAMME BURSARY, BENNO AND LEAH MARGULIES BURSARY. 144 FIRST NATIONAL BANK UNIVERSITY AND 177 PRESTIGE BURSARIES, 175 BETHAL TOWN COUNCIL STUDY LOAN. 144 TECHNIKON SCHOLARSHIP, ISO BLUE CIRCLE BURSARY, 180 Agriculture BONA PEOPLE'S FUND, 144 FIVE OR MORE CHILDREN AT UOFS BURSARY. BOB BUTTON ACCOUNTING BURSARY, 181 ADAM BARNARD AGRICULTURAL STUDY FUND, BONA PEOPLE'S FUND BURSARY, 144 150 CALTEX CORPORATE BURSARY, 182 174 BORDER COUNCIL BURSARY SCHEME, 181 FOSCHINI BURSARY, 150 CARTER ACCOUNTING BURSARY, 183 AGRICOR BURSARY, 175 BRAKPAN TOWN COUNCIL BURSARY LOANS FOR FOURTH CHILD BURSARY, 150 CAS' EDEN TRUST BURSARY, 183 AGRIHOLD BURSARIES. 175 TERTIARY STUDY, 145 FREE STATE PROVINCIAL GOVERNMENT CHARTERED ACCOUNTANTS BURSARIES, 184 ANNA JULIANA THERON BURSARY, I 77 BREBNER BURSARY, 145 BURSARY, 194 CHARTERED ACCOUNTANTS' BURSARY, 184 BARELY WEST/KLIPDAM FARMERS' BRUCE MURRAY CRICKET BURSARY, 145 FRENCH EMBASSY IN SA BURSARIES, 150 CLOVER SA BURSARY SCHEME, 184 ASSOCIATION BURSARY, 179 BURSARIES ADMINISTERED BY THE CAPE GADRA BURSARY, 150 COOPERS AND LYBRAND BURSARY. 185 BOPHUTHATSWANA MPUDULOLE BURSARY AID TECHNIKON, 145 GAVIN COOKE CANOEING BURSARY, 151 DELOITTE AND TOUCHE BURSARY, 187 FUND, 181 BURSARIES TO DEPUTY HEADBOYS AND DEPUTY GAWIE HENDRIKSZ BURSARY, 151 DELOITTE AND TOUCHE BURSARY AND DANIE SWANEPOEL BURSARY, 186 HEADGIRLS (RAU), 145 GEORGE HOME BURSARY, 151 SCHOLARSHIP SCHEME, 187 DIOCESE OF MARIANNHILL NATIONAL BURSARIES TO HEADBOYS AND HEADGIRLS GEORGE JACOBUS PETERSEN SCHOLARSHIP, 151 DEPARTMENT OF TRADE AND INDUSTRY CATHOLIC BURSARY AND SCHOLARSHIP (RAU), 145 GERTRUIDA C. DU TOIT MEMORIAL TRUST, 151 BURSARY. 188 FUND, 188 BURSARIES TO WINNERS IN SUBJECT GIDEON ROOS BURSARY, 151 EDEN TRUST BURSARIES, 190 FIRST NATIONAL BANK AGRICULTURAL OLYMPIADS, 145 GILLETE SA LTD BURSARY. 151 ENGEN LTD BURSARY SCHEME, 191 BURSARY SCHEME, 193 BURSARY SCHEME FOR PERSONS WITH GILLETTE SA LTD BURSARY, 151 ERNST AND YOUNG BURSARY, 191 FRANS EN RYKIE THERON BURSARY. 193 DISABILITIES, 182 GODIMO BURSARY FUND, 151 FEMALE ACCOUNTANTS BURSARY SCHEME. 193 FUNDANI TRUST, 194 BURSARY SCHEME OF TRANSITIONAL LOCAL GOEDE LOAN FUND, 151 CENBEL-STUDIETRUST BURSARY LOANS FOR GORDON LE ROUX MEMORIAL BURSARY LOAN. COUNCIL OF GREATER GERMISTON, 145 GOVERNMENT BURSARIES, 151 B.COM. STUDENTS, 194 195 C.T.J. VAN DER WALT BURSARY LOAN SCHEME, GRAHAMSTOWN CITY BURSARY, 151 GENCOR BURSARY SCHEME, 194 IDB SCHOLARSHIP TRUST BURSARY LOAN, 198 145 GREATER LOUIS TRICHARDT TRANSITIONAL GOLD FIELDS OF SA LIMITED BURSARY, 195 N.J. DEAN BURSARY, 208 CALTEX BURSARY, 145 LOCAL COUNCIL BURSARY LOAN SCHEME, GREATER JOHANNESBURG TRANSITIONAL NATIONAL ECONOMIC EDUCATION TRUST CAPE TECHNIKON LOANS, 145 151 METROPOLITAN COUNCIL (GJTMQ (NEST), 209 CAPE TECHNIKON MERIT BURSARIES. 145 GREENSLADE SCHOLARSHIP, 151 BURSARY, 195 NORTHERN CAPE AGRICULTURAL UNION CAPE TIMES BURSARY FUND. 145 H.A. KOCH SCHOLARSHIP, 151 INSTITUTE OF CHARTERED ACCOUNTANTS BURSARY (VISAGIE/MORELIG TRUST), 211 CARL AND EMILY FUCHS BURSARY, 146 HARRY COLMAN MEMORIAL SCHOLARSHIP, 152 BURSARY. 198 NSB EDUCATIONAL TRUST, 21 I CARL ZIERVOGEL BURSARY, 146 HARRY LAMPERT ATHLETICS BURSARY, 152 ISCOR BURSARY LOAN, 199 OUTSPAN BURSARY, 212 CARLETONVILLE TOWN COUNCIL STUDY LOAN, HARVEY PIRIE BURSARY FUND, 152 JUTA BURSARIES. 201 PANNAR SEED (PTY) LTD BURSARY. 212 183 HEADBOY AND HEADGIRL BURSARIES KESSEL FEINSTEIN BURSARIES (CHARTERED RC DIOCESE OF KIMBERLEY BURSARY FUND, 215 CATHOLIC EDUCATIONAL AID PROGRAMME (PRETORIA?, 152 ACCOUNTANTS), 202 SA ASSOCIATION FOR CROP PRODUCTION, 216 BURSARY, 183 HELEN SUZMAN BURSARY. 152 KPMG SCHOLARSHIP (CHARTERED SA INSTITUTE OF RACE RELATIONS (SAIRR) CENTRAL OFS ADMINISTRATION BOARD HELLENIC BURSARY OF LODGE PYTHAGORAS, ACCOUNTANTS). 202 BURSARIES, 217 BURSARY FUND, 146 152 MACWA TEA CORPORATION BURSARY SCHEME. SA SUGAR INDUSTRY TRUST FUND, 218 CENTURION TOWN COUNCIL BURSARY, 183 HELPING HAND TRUST BURSARIES, 152 205 STELLENBOSCH AGRICULTURAL SOCIETY CHARLES EGAN BURSARY, 146 HERMAN LOUIS KARNOVSKY FUND, 197 MURRAY AND ROBERTS CONTRACTORS BURSARY. 222 CHRIS KOKKORIS BURSARY, 146 HERMANN OHLTHAVER BURSARY, 152 BURSARY LOAN SCHEME, 208 STUDIETRUST BURSARY, 222 CHRISTINE FERREIRA FUND, 146 HIGH SCHOOL MODEL BURSARY, 152 NAMDEB DIAMOND CORPORATION (PTV) LTD. CHT PEPLER TRUST/MOLLER BURSARIES. 146 HOSPITAL WELFARE AND MUSLIM 208 Agronomy CITRUSDAL BURSARY LOAN SCHEME. 146 EDUCATIONAL MOVEMENT BURSARY-LOAN, NATAL PROVINCIAL ADMINISTRATION BURSARY CIBA BURSARY, 184 CLAUDE HARRIS LEON FOUNDATION 152 SA ASSOCIATION FOR CROP PRODUCTION. 216 SCHEME. 209 BURSARIES. 146 IA APPEL BURSARY, 152 PALABORA MINING COMPANY LTD BURSARY. TRANSKEI TEA MANAGEMENT, 223 CLIVE ULYATE RUGBY BURSARY, 146 IAN FRASER MEMORIAL BURSARY FUND 212 Analytical Chemistry CLUB 10- 100,146 (BURSARIES FOR THE BLIND), 152 PIERRE F. THERON BURSARY, 213 AMPLATS BURSARY SCHEME, 177 COCA-COLA BURSARY, 146 IMMIGRANT CHILD BURSARY, 152 PRICE WATERHOUSE BURSARY, 214 ANGLOVAAL MINERALS TECHNIKON BURSARY COMMUNITY PRESTIGE BURSARY FUND, 147 INDEPENDENT DEVELOPMENT TRUST, 153 PRICE WATERHOUSE MEMORIAL BURSARY, 214 SCHEME, 177 COROBRIK POST-MATRICULATION BURSARY, INDIAN CENTENARY SCHOLARSHIP TRUST PROTEA BURSARY FUND, 214 CSIR BURSARY, 185 147 LOAN / BURSARY, 153 R.B.TAYLOR ACCOUNTANCY BURSARY, 214 DEPARTMENT OF WATER AFFAIRS AND CORPORATION (DUKE OF YORK) SCHOLARSHIP. ISAAC AND SARAH SCHNEIDER BURSARIES. 153 SANLAM BURSARIES (UNIVERSITIES), 219 FORESTRY BURSARY / SCHOLARSHIP. 188 147 ISAAC GREENBERG BURSARY, 153 SASOL LTD BURSARY, 220 HIGHVELD STEEL AND VANADIUM CORP LTD COUNCIL OF TECHNIKON PRETORIA BURSARY ITALIAN BURSARY, 153 SPARGS WHOLESALE BURSARY, 221 BURSARY (TECHNIKON), 197 FUND, 147 ITHAQUESIAN PHILANTHROPIC SOCIETY OF SA SPOORNET, 221 ISCOR BURSARIES FOR TECHNIKON /TECHNICAL COUNCIL OF TECHNIKON PRETORIA LOAN BURSARY. 153 STEVE ROSSOUW BURSARY, 222 COLLEGE AND UNIVERSITY STUDIES, 198 FUND, 147 J AND B BENNUM BURSARY, 153 TELKOM SA (LTD) BURSARY AND STUDY AID MINTEK BURSARY, 207 CTPA BURSARY. 147 J. TOXOPEUS BURSARY FUND. 153 SCHEME (ALL REGIONS), 223 UMGENI WATER BURSARY, 224 DAISY MOSKOW BURSARIES, 147 J.C. VAN DER MERWE BURSARY FUND, 153 TRANSNET BURSARY, 223 DARRAS HELLENIC BURSARY. 147 J.C.D. HECKROODT BURSARY, 199 TREK PETROLEUM BURSARY, 224 Animal Health DAVID FREEMAN BURSARIES. 147 J.F. HAVENGA TRUST BURSARIES, 153 UMGENI WATER BURSARY, 224 AGRICOR BURSARY, 175 DELTA MOTOR CORPORATION BURSARY. 147 J.H. HOFMEYER SCHOLARSHIP FUND, 153 WESTERN CAPE SOCIETY OF CHARTERED Any field of study DEPARTMENT OF EDUCATION BURSARY LOAN J.L.C. DU PLESSIS BURSARY, 153 ACCOUNTANTS BURSARIES, 226 1820 SETTLERS' ASSOCIATION BURSARY, 174 SCHEME, 147 J.M. HATTINGH STUDY FUND. 153 Actuarial Science A.E. ROSENZWEIG BURSARY. 142 DETTMAN TRUST BURSARY, 147 JACK ELLERT BURSARY FUND, 153 ACTUARIAL SCIENCE BURSARIES, 174 A.L. NORDEN EDUCATIONAL TRUST BURSARY. DEVELOPMENT COMMITTEE BURSARY FUND, JACK PALMER EDUCATION TRUST BURSARY. 154 JACOB AND PAULINE PERTZ SCHOLARSHIP. 154 LIBERTY LIFE BURSARY SCHEME, 204 142 147 JACOB FRANK SCHOLARSHIP, 154 OLD MUTUAL ACTUARIAL BURSARY, 211 ABELIS LEIBOVICIUS BURSARY, 142 DIOCESE OF DUNDEE BURSARY FUND, 147 SANLAM BURSARIES (UNIVERSITIES), 219 ABRAHAM AND SARAH SKAPINKER BURSARY DIOCESE OF NATAL BURSARY. 148 JACOBS FAMILY BURSARY, 154 JAMES DAVID LENNOX MEMORIAL FUND, 154 SWISS RE SA LTD BURSARY (ACTUARIAL FUND. 142 DIOCESE OF RUSTENBURG BURSARY. 148 JAMES ROBERTSON BURSARY, 154 SCIENCE). 222 ABSA RANKING GROUP (LOANS). 142 DIOCESE OF WITBANK BURSARY. 148 ACHIEVEMENT BURSARY (PROSPECTIVE DORA FALCKE TRUST LOAN. 148 JAN AND MARTIE BOOT BURSARY, 154 Administration STUDENTS), 142 DR J.H. MEYER BURSARY, 148 JANE KUMMER BURSARY. 154 NATAL PROVINCIAL ADMINISTRATION BURSARY ACHIEVEMENT BURSARY (SENIOR DR J.H. MULLER BURSARY, 148 JOAN AND LEN STARFIELD FAMILY BURSARY SCHEME, 209 UNDERGRADUATE STUDENTS), 142 DR T.E. D(TP)NGES BURSARIES, 148 FUND, 200 RICHARDS BAY COAL TERMINAL BURSARY, 215 AFRICAN EDUCATIONAL TRUST. 175 DS. J.H. NEETHLING BURSARY. 148 JOE KAMINER RUGBY BURSARY, 154 Aeronautical Engineering AFRIKAANSE SAKEKAMER PIETERSBURG- DU TOIT HUGENOTE BURSARY, 148 JOEY HANEKOM BURSARY, 154 JOHAN AND WILLIE SPIES BURSARY, 154 ARMSCOR BURSARY, 178 BEURSFONDS. 142 DUNDEE MUNICIPAL BURSARY, 189 AGAR HAMILTON TRUST BURSARY. 142 DURBAN HIGH SCHOOL AND OLD BOYS' JOHAN VAN RENSBURG STUDY FUND, 154 Afrikaans AGGREY FUND, 142 MEMORIAL TRUST BURSARIES. 148 JOHANNESBURG CITY COUNCIL BURSARIES - CRADOCK'S AFRIKAANS LANGUAGE FESTIVAL AKASIA CITY COUNCIL BURSARY, 142 DURBANVILLE MEN'S FORUM BURSARY, 148 UNIVERSITY-ADMINISTERED, 154 BURSARY, 185 ALFRED BEIT SCHOLARSHIP, 142 DUTCH REFORMED CHURCH OF AFRICA JOHN BRUNTON WHITE BURSARY, 155 MAX AND LOUISE ACKERMANN BURSARIES FOR ALIGARH OLD BOYS SCHOLARSHIP TRUST, 142 BURSARY, 148 JOHN HURWITZ BURSARY, 155 AFRIKAANS. 206 ALLAN AND GERRY SIMPSON MEMORIAL E BELLAIRS TRUST BURSARY. 148 JOHN SAVOPOULOS BURSARIES, 155 Afrikaans en Nederlands BURSARY, 142 E. GLUCKMAN WILL TRUST LOANS. 189 JOHNSON AND JOHNSON BURSARY, 201 JOSEPH VAN PRAAGH TRUST BURSARY, 155 1. DU P. SCHOLTZ BURSARY, 199 ALLIED BANK STUDENT LOANS, 143 E.G. PELZER BURSARY FUND. 148 ALUMNI FUND BURSARY, 143 E.J. LOMBARDI BURSARY TRUST, 149 JUNIOR RAPPORTRYERSKORPS Afrikaans History ALUMNI SPORT BURSARIES, 143 E.J.A. LOERINCZ SCHOLARSHIP, 149 DEBATSKOMPETISIE-BEURSE. 155 W.L. HECKROODT STUDY LOAN FUND. 226 AMATIE MEMORIAL SCHOLARSHIP, 143 EAST LONDON MUNICIPAL BURSARY. 190 JUTA BURSARY FUND, 155 Afrikaanse en Nederlandse AMRIT BHOWAN MEMORIAL SCHOLARSHIP EASTERN CAPE TECHNIKON BURSARIES, 190 KANGWANE BURSARY, 155 FUND. 143 EBEN AND FREDA VAN ZYL STUDY LOAN FUND, KEMPTON PARK CITY COUNCIL - PRESTIGE Kultuurgeskiedenis ANALENE DU PLESSIS MEMORIAL TRUST, 143 149 BURSARY. 155 NEDERLANDSE STUDIEFONDS-BEURS. 210 ANDRIES OLIVIER BURSARIES (ANDRIES OLIVIER EDENVALE JUBILEE BURSARY FUND. 149 KEMPTON PARK CITY COUNCIL BURSARY Afrikaanse Kultuurgeskiedenis YSTERKOPPE. VICTORIA-WES FONDS). 143 EDWARD WALKER BUCHANAN BURSARY. 190 SCHEME. 155 KENNETH B. GLOAG BURSARY, 155 VAN EWIJCK FOUNDATION MERIT BURSARIES. ANGLO AMERICAN CORPORATION OPEN EIKENHOF-MOULTON BURSARY. 149 KIMBERLEY AND KURUMAN DIOCESAN BURSARY 22S SCHOLARSHIP, 143 ELAINE FORSYTH MEMORIAL TRUST BURSARY, APOSTOLIC FAITH MISSION OF SA BURSARY, 149 FUND. 155 Afrikaanse Taal en Letterkunde 143 ELISE VISSER BURSARY, 149 KIMBERLEY CITY COUNCIL BURSARY, 155 VAN EWIJCK FOUNDATION MERIT BURSARIES. ARTHUR AIKEN SCHOLARSHIP, 143 ELIZABETH MARAIS BURSARY, 149 KING SOLOMON MAPHUMZANA BURSARY FUND, 225 ASICS SOCCER BURSARIES, 143 ELIZABETH VILIOEN TRUST BURSARY. 149 155 Afrikaans-Nederlands ASSOCIATION OF HELENES FROM EGYPT AND ERNEST OPPENHEIMER MEMORIAL TRUST KLERKSDORP ROTARY CLUB LOAN FUND, 156 KLERKSDORPSE AFRIKAANSE SAKEKAMER RAPPORTRYERSKORPS PIKETBERG-BEURS, 214 SUDAN BURSARY FUND. 143 BURSARY. 149 ATHLETICS BURSARY FUND. 143 ESTCOURT INDIAN ONE CENT BURSARY, 149 MERIETEBEURS, 156 Agricultural Economics ATKB REDENAARSKOMPETISIE-BEURS. 144 ESTHER AND DAVID NORWICH SCHOLARSHIPS, KOBUS VERSTER STUDY FUND. 156 GEORGE COATES SCHOLARSHIP, 195 ATKV STUDY LOAN, 144 149 KOOS DU TOIT AND LOWISA GRIEBENOW STUDY WILLEM PRETORIUS BURSARY. 226 ETHEL MARY SMITH BEQUEST BURSARY, 149 LOAN FUND, 156 BEST COPY AVAILABLE 243 Bursaries VENDA DEVELOPMENT CORPORATION PHILIP AND ISAAC ALBOW SCHOLARSHIP A & B, SOLOMON RABINOWITZ OF pAARL KRUGERSDORP KRUGER FESTIVAL STUDY LOAN BURSARY, 225 161 SCHOLARSHIP, 166 FUND, 156 SOLOMON REUBEN AND ANN WINER BURSARY, VEREENICING KOpANONG CITY COUNCIL STUDY KRUGERSDORP TOWN COUNCIL BURSARY LOAN. PHILIP AND RACHEL LEVY DONATION BURSARY, 166 LOAN SCHEME, 170 156 161 SONIA SCHWAB SCHOLARSHIP, 166 VERULAM HIGH EX-STUDENTS' BURSARY TRUST. KUSHLICK /KAPLAN BURSARY SCHEME, 156 PHILIP NEL MEMORIAL FUND BURSARY, 161 SOUTH AFRICAN POLICE ACADEMY BURSARY, 170 KWA- DUKUZA! STANGER TRANSITIONAL LOCAL PIET NEETHL1NG EDUCATIONAL TRUST VERWOERDBURGSE JUNIOR RAPPORTRYERS- BURSARY/LOAN. 161 166 COUNCIL. 203 BEURS, 225 PIETER AND FLORRIE DU PREEZ BURSARY, 161 SPIRO PLOMARITIS BURSARY, 166 L.M.C. BENDIKS-BEURS, 156 SPORTS DEVELOPMENT BURSARIES, 166 VETERANS BURSARY FUND, 170 LADYSMITH CITY COUNCIL BURSARY, 156 PIETERSBURG/pOLOKWANE TRANSITIONAL SPRINGS CITY COUNCIL BURSARY LOANS. 166 VINUCHI TIES BURSARIES, 171 LAKOFSKI BURSARIES, 156 LOCAL COUNCIL, 161 viSSER-NESER BURSARY FUND, 171 ST LEGER SCHOLARSHIP TRUST, 166 LANGENHOVEN CENTENARY BURSARY. 156 PLATINUM MINES BURSARY, 161 STANDARD BANK GROUP BURSARY AND VISTA UNIVERSITY BURSARIES AND LOANS. 225 LEADERSHIP (CATEGORY WINNERS US DEBATING PORT ELIZABETH TECHNIKON ADMINISTERED EDUCATIONAL ASSISTANCE SCHEME, 221 VOLKSKAS STUDENT LOANS, 171 COMPETITION) BURSARIES, 156 BURSARIES AND STUDY LOANS, 161 STANDARD BANK LOAN. 166 VOR(SLTEARNVSLVAN MERWE EDUCATION FUND LEADERSHIP (HEADPREFECTS) BURSARY. 156 PREMIER FOOD INDUSTRIES LTD BURSARY. 161 STANDARD BANK LOANS FOR TECHNIKON 171 LEADERSHIP (PRESIDENT SCOUTS) BURSARY, PRETORIA CITY COUNCIL FULL-TIME BURSARY 15,0. HENDRICKS MEMORIAL BURSARY FUND. SCHEME, 213 PRETORIA. 167 156 171 PRINSLOO-WOLMARANS STUDY FUND (LOAN), STANDARD BANK SCHOLARSHIP. 167 LEADERSHIP (US HONORARY AWARD AND W.M. RICHARDSON BURSARY, 171 162 STANLEY.I.O. NOOME BURSARY, 157 JUNIOR RAPPORTRYERS DEBATING STATE STUDY LOAN FUND, 222 WAR MEMORIAL SCHOLARSHIP, 171 COMPETITION) BURSARY. I57 PRIVATE SECTOR BURSARY FUND OF THE STELLENBOSCH FARMERS' WINERY BURSARY, WESLEY FRANCIS MEMORIAL MASONIC LEADERSHIP (WINNER ATKB ORATOR PREMIER OF THE MPUMALANGA PROVINCE. 167 EDUCATION FUND (SCHOLARSHIP), I 71 COMPETITION) BURSARY, 157 162 WESTONARIA BURSARY LOAN FUND, 226 PROF J.H. NEETHLING BURSARY, 162 STUDENT GOVERNMENT BURSARIES, 167 LEADERSHIP BURSARIES, 157 STUDENT SERVICES CENTRE BURSARIES. 222 WiLF ROSENBERG RUGBY BURSARY, 171 LESLIE HILL HIGHER EDUCATION TRUST, 203 PU FOR CHE BURSARIES FOR HANDICAPPED TAAIBOS MERIT BURSARY, (67 WILFRED METJE BURSARY, 171 LETTIE FOUCHE TRUSTFUND LOAN. 157 STUDENTS. 162 WILFRED ORR BURSARY FUND. 171 PO FOR CHE BURSARIES FOR NEEDY STUDENTS, TAFELRONDE 47, POTCHEFSTROOM, 167 LEWIS COWAN BURSARY, 157 TECHNIKON FREE STATE BURSARIES. 223 WILLIAM PESCOD ELLEN CARTER FUND, 171 LO MING -YUAN SCHOLARSHIP, 157 162 WILLIE DU TOIT (QUAGGASFONTEIN) PU FOR CHE CULTURAL PERFORMANCE TECHNIKON NATAL BURSARIES / LOUIS LANDAU SCHOLARSHIP, 157 SCHOLARSHIPS, 167 EDUCATIONAL FUND, 171 LOUIS OSTROWIAK MEMORIAL BURSARY. 157 BURSARIES. 162 TECHNIKON NORTH WEST ACADEMIC WILLIE SCHEEPERS BURSARY. 172 LOUISE AND NELLIE HERMAN BURSARY, 157 PU FOR CHE FAMILY BURSARY. 162 WITS CRICKET CLUB BURSARY, 172 PU FOR CHE SCHOLARSHIPS FOR BEGINNERS ACHIEVEMENT FUND (PROSPECTIVE LUKIN BURSARY, 204 STUDENTS). (67 WITS HOCKEY CLUB BURSARIES, I 72 M.L. SULTAN TECHNIKON BURSARIES. 205 (ACADEMIC), 162 WITS RUGBY CLUB BURSARIES. 172 PU FOR CHE SPORTS BURSARIES, 162 TECHNIKON NORTH WEST ACADEMIC M.M. HATTINGH STUDY BURSARY, 157 WITS SPORTS COUNCIL BURSARIES, 172 PU FOR CHE STUDENT LOAN SCHEME, 162 ACHIEVEMENT FUND (SENIOR STUDENTS), M.M. ROBERTSON BURSARY, 157 WITS SQUASH CLUB BURSARY, 172 PU FOR CHE STUDY LOAN FUNDS, 162 (67 M.S.B. KRITZINGER BURSARY, 157 TECHNIKON NORTH WEST PRESTIGE BURSARY, WITS TENNIS CLUB BURSARIES, 17Z MAKRO SA IPTYI LIMITED BURSARY, 157 PU FOR CHE TRAVEL BURSARIES. 162 WITS UNIVERSITY COUNCIL BURSARIES, 172 PU FOR CHE UNDERGRADUATE SCHOLARSHIPS 167 MALAN BURSARY, 157 TECHNIKON NORTHERN TRANSVAAL WITS UNIVERSITY COUNCIL LOANS, 172 MANGOSUTHU TECHNIKON ACADEMIC (ACADEMIC), 162 BURSARIES/LOANS, 223 WITS WOMEN'S CLUB BURSARIES, 172 ACHIEVEMENT AWARDS, 205 PUBLIC SERVICE BURSARY SCHEME, 214 TECHNIKON SA BURSARIES AND LOANS, 167 WITWATERSRAND WOMEN'S AGRICULTURAL MANGOSUTHU TECHNIKON SPORTS AWARDS. PUK ONDERSTEUNINGSKEMA, 162 TECHNIKON WITWATERSRAND ADMINISTERED UNION BURSARY, (72 205 QUEEN ELIZABETH II CORONATION UNIVERSITY WOMEN'S AND MOTHER'S MOVEMENT (RENON)) SCHOLARSHIP, 162 BURSARIES AND SCHOLARSHIPS, 167 MARIA CILLIE BURSARY. 157 TECHNIKON WITWATERSRAND ADMINISTERED BURSARY, 172 MARIA MALAN CLUB BURSARY, 158 QUEENSBURGH MUNICIPAL BURSARY, 163 SPORTS BURSARIES, (67 YVONNE PARFITT BURSARIES TRUST. 172 MARIA VAN RIEBEECK CLUB BURSARY. 158 R.B. HAGART TRUST, 163 ZER1LDA STEYN LOAN FUND, 173 RAG BURSARIES (RAUI, 163 TED AND MABEL EVERITT BURSARY, 168 MARITZ JOHN PLEN BURSARY, 158 TERTIARY EDUCATION FUND OF SA (TEFSA) Z1ERVOGEL LOAN, 173 RANDBURG SOUTH DUTCH REFORMED MARJORIE HOCKEN BURSARY. 205 LOAN SCHEME, 168 MAUERBERGER FOUNDATION BURSARY, 158 COMMUNITY, 163 Applied Chemistry THE COMPUTER SCHOOL BURSARIES, 168 PRECIOUS METALS REFINERS BURSARY AWARD. MERIT BURSARIES FOR HEADBOY AND RANOFONTEIN TOWN COUNCIL BURSARY LOANS, 163 THOMAS ROBERTSON BURSARY, 168 213 HEADGIRL (PU FOR CHE), 158 TRANSNET BURSARY LOAN SCHEME, 168 RAPPORTRYERSKORPS EIKESTAD- MERIT BURSARY OF THE DEAN OF STUDENT TRANSVAAL HELPMEKAAR STUDY FUND ILOAN Applied Mathematics MERIETEBEURS. 163 AFFAIRS fTECHNIKON PRETORIA), 158 FOR TECHNIKON AND UNIVERSITY STUDY). ARMSCOR BURSARY, 178 ,METHODIST BURSARY FUND, 158 RAU ALUMNI ASSOCIATION BURSARY, 163 168 CSIR BURSARY (UNIVERSITY STUDY), 185 METHODIST CHURCH OF SOUTHERN AFRICA - RAU BURSARY LOAN FUND, 163 TRANSVAAL INTER-CONSTITUTIONAL MASONIC DEPARTMENT OF WATER AFFAIRS AND BOARD OF EDUCATION BURSARY, 158 RAU LADIES CIRCLE BURSARY, 163 FORESTRY BURSARY / SCHOLARSHIP, 188 RAU MERIT BURSARIES (UNDERGRADUATE). 163 CHARITY LOAN. 224 MICHAEL ZARCHI BURSARY, 158 TRANSVAAL PROVINCIAL ADMINISTRATION MOBIL FOUNDATION BURSARIES. 158 RAU STUDY LOAN FUND. 163 Architecture (TPA) BURSARIES. 168 MPUMALANGA PREMIER PRIVATE SECTOR RAY SPILKIN MEMORIAL SCHOLARSHIP, 163 B.S. PRYCE MEMORIAL BURSARY, 179 TRANSVAALSE ONDERWYSERSVERENIGING (SA CAPE TOWN CITY BURSARY LOAN SCHEME, 183 BURSARY FUND, 208 RECTOR'S BURSARY FOR OUTSTANDING ONTWIKKELINGSTIGTING BEURS- EN DEPARTMENT OF PUBLIC WORKS AND LAND MUNICIPAL UNIVERSITY SCHOLARSHIP. 158 PERFORMANCE (TECHNIKON PRETORIA), LENINGSFONDS), 168 AFFAIRS BURSARY. 188 N.F. PATTERSON BURSARY, 158 163 REIGER PARK BURSARY LOAN FUND. 163 TREVOR SALES MEMORIAL BURSARY, 168 EDWARD H. wAUGH MEMORIAL SCHOLARSHIP, NAFCOC MASEKELA-MAVIMBELA MEMORIAL TRUST BANK STUDENT LOANS. 168 SCHOLARSHIP FUND, 208 REMBRANDT BURSARY FUND, 164 190 TRUST FOR CHRISTIAN OUTREACH AND GARDEN CITIES BURSARY, 194 NATAL COLOURED BURSARY FUND, 158 RENIER VAN ROOYEN BURSARY FUND, 164 EDUCATION (ZINGISA BURSARY), 168 GREATER JOHANNESBURG TRANSITIONAL NATIONAL BEVERAGE SERVICES (COCA-COLA) REYERSBACH BURSARY. 164 TSHEZ1 EDUCATION TRUST BURSARY, 168 METROPOLITAN COUNCIL (G.JTMC) BURSARY, 158 RHODES UNIVERSITY ENTRANCE SCHOLARSHIPS. 164 URUNTU PROGRAMME STUDY FACILITATION BURSARY. 195 NATIONAL BEVERAGES BURSARY, 159 FUND, 224 NATIONAL EXPO-COMPETITION BURSARY. 159 RHODES UNIVERSITY RESIDENCE BURSARIES, J.C. EUTCON FOUNDATION BURSARIES, 199 UCT BURSARIES. 168 NATIONAL OLYMPIAD BURSARIES, 159 164 KAGISO TRUST BURSARIES, 202 UCT SPORTS BURSARIES, 168 NATIONAL READJUSTMENT COMMITTEE AND RHODES UNIVERSITY SPORTS BURSARIES AND KIRKNESS SCHOLARSHIP, 202 UCT STUDENT LOAN FUND, 169 VOCATIONAL BOARD BURSARY FUND, 209 SCHOLARSHIPS, 164 LIGHT HOUSE CLUB BURSARY. 204 UNITED BANK STUDENT LOANS, 169 MARGARET THOMSEN SCHOLARSHIP, 205 NATIONAL STUDENT FINANCIAL AID SCHEME RHODES UNIVERSITY STUDENT STUDY LOANS. UNITED NATIONS EDUCATIONAL AND TRAINING MARLEY BURSARY, 205 (NSFAS), 159 164 PROGRAMME FOR SOUTHERN AFRICA NURCOMBE SUMMERLEY RINCROSE AND TODD NATIONAL UNION OF COMMERCIAL ROODEPOORT MUNICIPALITY BURSARY LOAN. (UNETPSA) BURSARIES, 224 TRAVELLERS BURSARY, 159 216 BURSARY, 211 UNIVERSITY COUNCIL SPORTS SCHOLARSHIPS, RICHARD NIEBUHR SCHOLARSHIP, 215 NEDBANK STUDENT LOAN SCHEME, 210 ROSA DE MUNNIK-ELOFF STUDY LOAN FUND, 164 169 ROBERT HULME BURSARY, 2) 5 .NEDERDUITSCH HERVORMDE UNIVERSITY OF DURBAN-WESTVILLE BURSARIES SUSTERSVERENIGING (NHSV) STUDY LOAN, ROSS BRESLER SCHOLARSHIP, 164 SA NATIONAL COMMITTEE ON ILLUMINATION AND LOANS, 224 BURSARY, 218 159 ROTARY CLUB - NELSPRUIT BURSARY. 216 ROTARY CLUB OF BELLVILLE BURSARY, 164 UNIVERSITY OF DURBAN-WESTVILLE SIR HENRY STRAKOSCH MEMORIAL NEIL SYMONS ATHLETIC BURSARY, 159 SCHOLARSHIPS, 224 NELSPRUIT TOWN COUNCIL BURSARY, 159 ROTARY CLUB OF KYALAml BURSARY, 164 SCHOLARSHIP, 220 RUDOLPH GINSBERG MEMORIAL BURSARIES, 164 UNIVERSITY OF PRETORIA LOANS, 169 TETJE PATTISON BURSARIES, 223 NG GEMEENTE EILOEMFONTEIN-WES-BEURSE, S.F. AND V.R. DU TOIT BURSARY. 2 6 UNIVERSITY OF PRETORIA SPORTS BURSARY, 159 169 Arts NG KERK (VRYSTAAT) BEURSE. 159 5A BLIND WORKERS ORGANISATION BURSARY, LILITHEA SINGER ART FORUM BURSARY, 204 164 UNIVERSITY OF PRETORIA WINNERS AND NORMAN BAXTER UNIVERSITY LOAN FUND, 159 RUNNERS-UP OF SUBJECT OLYMPIADS MAUDE CATHERINE BIRD MEMORIAL NORTH WEST GOVERNMENT BURSARIES, 211 SA FOOTPLATE PERSONNEL ASSOCIATION SCHOLARSHIPS, 206 BURSARY, 164 BURSARY, 169 NORTH WEST PROVINCIAL SERVICE UNIVERSITY OF STELLENBOSCH BURSARY LOAN OvERBEEK TRUST, 212 COMMISSION BURSARY, 211 SA JEWISH BOARD OF DEPUTIES BURSARY CO- SCHEME, 169 NORTHWOOD JUBILEE SCHOLARSHIP. 159 ORDINATING COMMITTEE BURSARY. 165 Audiology UNIVERSITY OF STELLENBOSCH MERIT DORINDA KOK BURSARY. 188 OK BAZAARS BURSARY, 159 SA LEGION AND WOMEN'S AUXILIARY (GRAHAMSTOWN BRANCH) BURSARY, 165 BURSARIES FOR FIRST YEAR STUDENTS, 169 MYRTLE L. ARON BURSARY, 208 OLD MUTUAL LOAN FUND. 159 UNIVERSITY OF STELLENBOSCH SPECIAL OLD RHOD1AN UNION BURSARIES AND GRANTS. SA NATIONAL COUNCIL FOR THE BLIND BURSARIES, 169 Auditing 160 BURSARY FUND. 165 NSBEDUCATIONAL TRUST, 211 SA ORT BURSARY TRUST, 218 UNIVERSITY OF THE NORTH BURSARIES, 225 OLLEY AND MEYER BURSARY, 160 UNIVERSITY OF THE NORTH WEST LOANS, 169 OPEN SOCIETY SCHOLARS FUND BURSARIES, SA PERMANENT BUILDING SOCIETY BURSARY, B 165 UNIVERSITY OF THE WESTERN CAPE MERIT 160 Bankingn i SA SCHOLARSHIP PROGRAMME. 218 AWARDS, 169 OPERATION EDUCATION AME CHURCH CALTEX OIL (SA) BURSARY. 182 SA STUDENTS EDUCATION TRUST BURSARY UNIVERSITY OF TRANSKEI LOANS, 169 BURSARY. 160 UNIVERSITY OF VENDA ADMINISTERED ORANJEBOND BURSARY, 160 (SASET), 218 Biblical and Religious Studies BURSARIES, 169 ORKNEYSE AFR1KAANSE SAKEKAMER-BEURS. SA WOMEN'S CULTURAL ORGANISATION ALBERT GEYSER BURSARY FUND, 176 BURSARY. 165 UNIVERSITY OF VENDA VICE CHANCELLOR'S TETJE PATTISON BURSARIES, 223 160 MERIT BURSARY, 169 OUD-MATIE GHOLFKLUB (SUIDE). 160 SAAMBOU BURSARY FUND, 165 SACTWU BURSARY FUND. 165 UOFS SCHOLARSHIP FOR CULTURE AND Biochemistry OUD-MATIE GHOLFKLUB (TRANSVAAL) BEURS, BARNEY BLIEDEN BURSARIES, 179 SAKMET BURSARY. 165 LEADERSHIP (SENIOR STUDENTS). 170 160 UOFS SCHOLARSHIPS FOR CULTURE AND DEPARTMENT OF WATER AFFAIRS AND OUD-STUDENTELENINGSFONDS, 160 SALES HOUSE CLUB BURSARY. 165 FORESTRY BURSARY / SCHOLARSHIP. (SE SANDERS AND HAvENGA BURSARIES. 165 LEADERSHIP, 170 P.M. ANDERSON EDUCATIONAL TRUST, 160 NATBEV /COCA-COLA BOTTLERS' TERTIARY SAUL ALBOW SCHOLARSHIP, 165 UOFS SPECIAL SCHOLARSHIPS FOR SPORTS, 170 P.W. BOTHA BURSARY, 160 EDUCATION, 209 SAWAS MEMORIAL SCHOLARSHIP, 165 UOFS UNIVERSITY LOANS, 170 PAM GREGORY MEMORIAL BURSARY, 2I2 NATIONAL CHEMICAL PRODUCTS SEA PLANT WELFARE TRUST BURSARY. 165 UPE ALUMNI AND FANIE DU PREEZ BURSARIES, PARKHURST DUTCH REFORMED COMMUNITY SCHOLARSHIP, 209 SENEKAL (ROOIKRANS) EDUCATION FUND, 165 170 BURSARY, 160 SA BREWERIES BEER DIVISION BURSARY SCHEME. SIMON BEKKER MEMORIAL FUND (LOANS). 166 UPE BONUSES BURSARY, 170 PATRICK FLANAGAN AND WILE ISAACS CRICKET 217 SIMON KUPER MEMORIAL BURSARIES, 166 UPE CONVERTIBLE LOAN/BURSARY, 170 BURSARY. 160 UPE FINANCIAL ASSISTANCE, 170 PAUL ROOS GYMNASIUM (PK) BURSARY, 160, SKYE RUGBY BURSARIES. 166 Botany SOCCER ASSOCIATION OF SA EDUCATION UPE LOANS. 170 161 CIBA BURSARY, 184 TRUST (SASA). (66 UPE SCHOLAR MERIT AWARD. I 70 CSIR BURSARY (UNIVERSITY STUDY), 185 PAULINE CUZEN BURSARY, 161 UPE SPORT BURSARY. I 70 PELOPONNESIAN SOCIETY OF SA BURSARY. 161 SOLLY CINWALA MEMORIAL TRUST BURSARY, DEPARTMENT OF WATER AFFAIRS AND VAAL TRIANGLE TECHNIKON BURSARIES AND FORESTRY BURSARY / SCHOLARSHIP, 188 PERCY FOX FOUNDATION BURSARIES, 161 221 LOANS, 225 pETRUSA VAN ZIJL BURSARY, 161 SOLOMON AND ANN WINER BURSARIES, 221 E.J. LOMBARDI BURSARIES, 190 244 BEST COPY AVAILABLE 1:1' r;rAo, 229 Building PRETORIA PORTLAND CEMENT BURSARY SANLAM PROPERTIES BURSARY, 219 NATAL PROVINCIAL ADMINISTRATION BURSARY SCHEME (MEMBER BARLOWS), 213 SEIFSA UNIVERSITY SCHOLARSHIP, 220 SCHEME, 209 GMSA BURSARY, 195 RAND CARBIDE UNITED BURSARY, 214 SOUTHERN AFRICAN INSTITUTE FOR STEEL LIGHT HOUSE CLUB BURSARY, 204 Computer Science SA BREWERIES BEER DIVISION BURSARY SCHEME. CONSTRUCTION BURSARIES, 221 MURRAY AND ROBERTS BURSARY (TECHNIKON AFRICON BURSARY. 1 75 217 STEWART SCOTT BURSARY. 222 STUDY), 208 ARMSCOR BURSARY, 178 SAFRIPOL BURSARY. 218 TRANSNET BURSARY. 223 STANDARD BANK SCHOLARSHIP SCHEME. 221 CALTEX BURSARY FUND, 182 SAPPI BURSARY. 219 UMGENI WATER BURSARY, 224 CALTE( CORPORATE BURSARY, 182 Building Management SAPREF ENGINEERING SCHOLARSHIP, 219 VKE BURSARY. 225 CAPE TOWN CITY BURSARY LOAN SCHEME, 183 8IA BURSARY, 180 SASOL CHEMICAL INDUSTRIES BURSARIES FOR WILLIAM FREDERICK BENARD SCHOLARSHIP CLOVER SA BURSARY SCHEME. 184 TECHNIKON STUDIES, 220 FUND, 226 J.C. BITCON SCHOLARSHIP, 199 COMPUTER SOCIETY OF SA BURSARY, 185 MURRAY AND ROBERTS (BUILDINGS) BURSARY, SASOL LTD BURSARY. 220 Classical Languages CSIR BURSARY (UNIVERSITY STUDY), 185 208 SEIFSA UNIVERSITY SCHOLARSHIP, 220 ADRIAAN ELFERINK BURSARY, 175 DE BEERS INDUSTRIAL DIAMOND DIVISION (FTY) NDF STUDY BURSARY (NATIONAL UMGENI WATER BURSARY, 224 LTD BURSARY (UNIVERSMES), 187 DEVELOPMENT FUND), 210 Clinical Psychology Chemical Plant Operation DEPARTMENT OF CORRECTIONAL SERVICES SANLAM PROPERTIES BURSARY, 219 DEPARTMENT OF CORRECTIONAL SERVICES ISCOR BURSARIES FOR TECHNIKON/TECHNICAL PUBUC BURSARY SCHEME, 187 SHOREDITS BURSARY, 220 PUBLIC BURSARY SCHEME. 187 COLLEGE AND UNIVERSITY STUDIES. 198 DEPARTMENT OF WATER AFFAIRS AND STOCKS AND STOCKS MANAGEMENT HELEN SUZMAN /BRITISH GOVERNMENT FORESTRY BURSARY / SCHOLARSHIP, 188 UNIVERSITY BURSARY, 222 Chemical Technology AWARDS. 197 ENGEN LTD BURSARY SCHEME, 191 DURBAN CITY COUNCIL LOANS, 189 Building Science Commerce ESKOM UNIVERSITY BURSARY, 191 BARROW CONSTRUCTION BURSARY, 180 Chemistry ANDREW DICKSON SCHOLARSHIP, 177 FIRST NATIONAL BANK SCHOLARSHIP FOR BRMSH AWARD SCHEME. 181 AKTOL UNDERGRADUATE BURSARY, 176 ANGLO AMERICAN ASSURANCE BURSARY, I 77 INFORMATION TECHNOLOGY, 193 CONCOR CONSTRUCTION BURSARY, 185 ARMSCOR BURSARY, 178 AUBREY FALKSON BURSARY, 178 CENCOR BURSARY SCHEME, 194 GARDEN CITIES BURSARY, 194 ATOMIC ENERGY CORPORATION BURSARIES BATEMAN SCHOLARSHIP FUND, 180 GOLD FIELDS OF SA UNITED BURSARY. 195 GOLD FIELDS OF SA UNITED BURSARY, 195 FOR UNIVERSITY STUDIES. 178 BOPHUTHATSWANA MPUDULOLE BURSARY AID GREATER JOHANNESBURG TRANSMONAL BITCON FOUNDATION BURSARIES, 199 COUNCIL FOR MINERAL TECHNOLOGY FUND, 181 METROPOLITAN COUNCIL (G.ITMC) KIRKNESS SCHOLARSHIP, 202 UNDERGRADUATE BURSARY, 185 BRITISH AWARD SCHEME, 181 BURSARY, 195 L COHEN BURSARY, 203 CSIR BURSARY (UNIVERSITY STUDY). 185 CALTEX BURSARY. 182 HIGHVELD STEEL AND VANADIUM CORP LTD Building Surveying DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) CALTEX BURSARY FUND, 182 BURSARY (TECHNIKON), 197 LTD BURSARY (UNIVERSITIES). 187 CALTEX CORPORATE BURSARY, 182 HNR COMPUTERS BURSARY FUND, 197 MURRAY AND ROBERTS BURSARY (TECHNIKON DEPARTMENT OF WATER AFFAIRS AND CAPE CHAMBER OF COMMERCE, 182 IBM BURSARY, 198 STUDY). 208 FORESTRY BURSARY / SCHOLARSHIP. 188 CAPE OF GOOD HOPE BANK BURSARY, 182 IDS SCHOLARSHIP TRUST BURSARY LOAN, 198 Business GENCOR BURSARY SCHEME, 194 CAPE TOWN CITY BURSARY LOAN SCHEME. 183 ISCOR BURSARY LOAN. 199 CALTEX CORPORATE BURSARY, 182 ISCOR BURSARY LOAN. 199 CAS' EDEN TRUST BURSARY, 183 LIBERTY UFE BURSARY SCHEME, 204 Business Administration JOHANNESBURG CONSOLIDATED INVESTMENT CHARTERED ACCOUNTANTS BURSARIES, 184 PALABORA MINING COMPANY LTD BURSARY. CO LTD OCI) CATEGORY B BURSARY, 200 CHARTERED ACCOUNTANTS' BURSARY, 1 84 212 W.K. KELLOGG FOUNDATION BURSARIES, 225 KARBOCHEM BURSARY, 202 CLOVER BURSARY, 184 RICHARDS BAY COAL TERMINAL BURSARY, 215 Business Economics KM UNDERGRADUATE BURSARY, 203 CLOVER SA BURSARY SCHEME, 184 SANLAM BURSARIES (UNIVERSMES), 219 DEPARTMENT OF TRADE AND INDUSTRY MAX AND WINNIE SALOMON MEMORIAL DEPARTMENT OF TRADE AND INDUSTRY SASOL LTD BURSARY, 220 BURSARY. 188 BURSARY, 206 BURSARY. 188 SPOORNET, 221 ISCOR BURSARY LOAN, 199 NATBEV/COCA-COLA BOTTLERS' TERTIARY DIOCESE OF MARIANNHILL NATIONAL TELKOM SA (LTD) BURSARY AND STUDY AID TRANSNET BURSARY, 223 EDUCATION, 209 CATHOUC BURSARY AND SCHOLARSHIP SCHEME (ALL REGIONS), 223 TUPPERWARE BURSARY, 224 NATIONAL CHEMICAL PRODUCTS FUND, 188 TRANSNET BURSARY, 223 Business Information Systems SCHOLARSHIP, 209 EJ. LOMBARDI TRUST BURSARY, 190 VOLKSWAGEN BURSARY, 225 NATIONAL CHEMISTRY BURSARY. 209 ESTEE LAUDER GROUP OF COMPANIES COMPUTER SOCIETY OF SA BURSARY, 185 Computer Systems Engineering PRETORIA PORTLAND CEMENT BURSARY BURSARY, 192 FIRST NATIONAL BANK SCHOLARSHIP FOR TECHNICARE BURSARY, 223 SCHEME (MEMBER BARLOWS), 213 FAR NORTH EDUCATION AND TRAINING TRUST INFORMATION TECHNOLOGY, 193 RAND CARBIDE UNITED BURSARY. 214 LOAN, 192 Construction Business Management RICHARDS BAY MINERALS BURSARIES (FOR FIRST NATIONAL BANK SCHOLARSHIP FOR LIGHT HOUSE CLUB BURSARY. 204 GENBEL-STUDIETRUST BURSARY LOANS FOR UNIVERSITY STUDY). 215 INFORMATION TECHNOLOGY, 193 Construction Management GENBEL-STUDIETRUST BURSARY LOANS FOR B.COM. STUDENTS. 194 SA BREWERIES BEER DIVISION BURSARY SCHEME. NDF STUDY BURSARY (NATIONAL SANTAM BURSARIES, 219 217 B.COM. STUDENTS, 194 DEVELOPMENT FUND). 210 GOLD FIELDS OF SA UNITED BURSARY. 195 Business Science SAPPI BURSARY, 219 NDF STUDY LOAN/BURSARY, 210 SASOL LTD BURSARY, 220 GUY SUTTON MEMORIAL BURSARY, 196 CHARTERED ACCOUNTANTS BURSARIES, 184 TRANSNET BURSARY, 223 HELEN SUZMAN/BRMSH GOVERNMENT Cost Accounting GOLD FIELDS OF SA LIMITED BURSARY. 195 TUPPERWARE BURSARY, 224 AWARDS, 197 DEPARTMENT OF TRADE AND INDUSTRY ISCOR BURSARY LOAN, 199 Civil and Structural Engineering HEXAGON TRUST BURSARY. 197 BURSARY, 188 Business Studies ISCOR BURSARY LOAN, 199 ISCOR BURSARIES FOR TECHNIKON/TECHNICAL Cost and Management HAGGIE BURSARY, 196 JOHANNESBURG TRANSPORT DIVISION UTD) COLLEGE AND UNIVERSITY STUDIES. 198 STANDARD BANK SCHOLARSHIP SCHEME, 221 JOHANNESBURG MUNICIPALITY BURSARY, Accounting Civil Engineering 201 ACCOUNTING TECHNICIANS BURSARY C AFRICON BURSARY, 175 JUTA BURSARIES, 201 PROGRAMME, 174 Cartography AFRICON ENGINEERING INTERNATIONAL KAGISO TRUST BURSARIES, 202 BLUE CIRCLE BURSARY. 180 DEPARTMENT OF WATER AFFAIRS AND BURSARIES (TECHNIKON). 175 LION MATCH COMPANY BURSARY, 204 CALTEX OIL (SA) BURSARY, 182 FORESTRY BURSARY / SCHOLARSHIP, 188 ALBERT ELLMER BURSARY. 176 MAGV/A TEA CORPORATION BURSARY SCHEME, D ARMSCOR BURSARY FOR TECHNIKON STUDY, 205 Ceramic Technology 178 MPUMALANGA PREMIER PRIVATE SECTOR Dentistry ISCOR BURSARIES FOR TECHNIKON/TECHNICAL ARTHUR E. HILL BURSARY, 178 BURSARY FUND, 208 3M SA BURSARY, 174 COLLEGE AND UNIVERSITY STUDIES. 198 B.S. PRICE MEMORIAL BURSARY, 179 MURRAY AND ROBERTS ENGINEERING UNITED CHAPPIE BLACK TRUST BURSARY, 183 Chemical Engineering B.SC. CIVIL ENGINEERING BURSARIES, 179 BURSARY, 208 CHRIS SNUMAN LOAN, 184 AECI LTD BURSARY. 175 BKS BURSARY, 180 NATAL BUILDING SOCIETY BURSARY. 209 DAVID MORRISON BURSARY. 186 AKTOL UNDERGRADUATE BURSARY, 176 BLUE CIRCLE BURSARY. 180 NATAL PROVINCIAL ADMINISTRATION BURSARY DENTAL ASSOCIATION OF SA LOAN, 187 AMPLATS BURSARY SCHEME, 177 CALTEX CORPORATE BURSARY, 182 SCHEME, 209 DRP.G.JANSEN BURSARY, 189 ANGLO AMERICAN CORPORATION GROUP CALTEX OIL (SA) BURSARY, 182 NATBEV/COCA-COLA BOTTLERS' TERTIARY EJ. LOMBARDI TRUST BURSARY, 190 VOCATIONAL SCHOLARSHIPS. 177 CAPE TOWN CITY BURSARY LOAN SCHEME, 183 EDUCATION. 209 IDS SCHOLARSHIP TRUST BURSARY LOAN, 198 ANGLO AMERICAN CORPORATION OF SA CONCOR CONSTRUCTION BURSARY. 185 NATIONAL ECONOMIC EDUCATION TRUST J.W. DU PREEZ BURSARY, 199 UNITED BRIDGING PROGRAMME BURSARY, CSIR BURSARY, 18S (NEET). 209 MARY AND LOUIS COLDFOOT SCHOLARSHIPS. 177 CSIR BURSARY (UNIVERSITY STUDY). 185 NORTH WEST TRANSPORT INVESTMENTS 205 ANGLOVAAL MINERALS BURSARY SCHEME, 177 DEPARTMENT OF WATER AFFAIRS AND BURSARY. 211 MAUERBERGER BURSARY, 206 ARMSCOR BURSARY, 178 FORESTRY BURSARY / SCHOLARSHIP, 188 OLD MUTUAL ACTUARIAL BURSARY, 211 MEDICAL. EDUCATION FOR SA BLACKS (MESABI ATOMIC ENERGY CORPORATION BURSARIES DURBAN CITY COUNCIL LOANS. 189 'PRETORIA CHAMBER OF COMMERCE BURSARY, BURSARY, 207 FOR UNIVERSITY STUDIES. 178 GARDEN CITIES BURSARY. 194 213 MILLNERS DENTAL SUPPLIERS BURSARY, 207 CALTD( CORPORATE BURSARY, 182 GENREC CONSTRUCTION BURSARY SCHEME. RANDCOAL SERVICES BURSARY. 214 NJ. DEAN BURSARY, 208 CALTEX OIL (SA) BURSARY. 182 194 RC DIOCESE OF KIMBERLEY BURSARY FUND, 215 ORAL-B BURSARY, 211 CLOVER SA BURSARY SCHEME, 184 GREATER JOHANNESBURG TRANSMONAL REX POYNTON AND BEN COHEN BURSARY, 215 PROVINCIAL ADMINISTRATION WESTERN CAPE COLUMBUS STAINLESS STEEL BURSARY, 185 METROPOLITAN COUNCIL (EJTMC) RICHARDS HAY COAL TERMINAL BURSARY, 215 BURSARY SCHEME. 214 COUNCIL FOR MINERAL TECHNOLOGY BURSARY, 195 SA INSTITUTE OF RACE RELATIONS (SAIRR) RED CROSS CALEDONIAN MARKET UNDERGRADUATE BURSARY, 185 GROUP FIVE ROADS SAVAGE AND LOVEMORE BURSARIES, 217 SCHOLARSHIPS, 215 CSIR BURSARY, 185 (EASTERN CAPE) (PTY) LTD BURSARY. 196 SA RESERVE BANK BURSARY. 218 REEVE SHAPIRO MEMORIAL BURSARY, 215 CSIR BURSARY (UNIVERSITY STUDY). 185 GROUP FIVE ROADS SAVAGE AND LOVEMORE SABELO MAGWENTSHU MEMORIAL RUBY REEVES BURSARY. 216 CYANAMID BURSARY SCHEME. 186 BURSARY FOR TECHNIKON STUDY, 196 SCHOLARSHIP FUND. 218 SAMST BURSARY/LOAN, 219 DE BEERS GROUP VOCATIONAL SCHOLARSHIP. GROUP FIVE ROADS, SAVAGE AND LOVEMORE SASOL LTD BURSARY, 220 WARNER LAMBERT BURSARY, 226 187 (WESTERN CAPE) (PTV) LTD BURSARY, 196 SPOORNET, 221 Dietetics ISCOR BURSARY LOAN, 199 STELLENBOSCH CHAMBER OF COMMERCE DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) EFAMED PERFORMANCE BURSARY, 190 JEFFARES AND GREEN, CONSULTING ENGINEERS BURSARY. 222 LTD BURSARY (UNIVERSMES). 187 GAUTENG PROVINCIAL GOVERNMENT BURSARY, BURSARY SCHEME. 200 STUDIETRUST BURSARY, 222 DEPARTMENT OF CHEMICAL ENGINEERING 194 KANTEY AND TEMPLER BURSARY, 202 SWISS RE SA, 222 BURSARY LOAN SCHEME. 187 HOME ECONOMICS ASSOCIATION OF KEN STEPHENS CONSTRUCTION BURSARY. 202 TRANSKEI INSURANCE BROKERS BURSARY, 223 ENGEN LTD BURSARY SCHEME. 191 SOUTHERN AFRICA BURSARY (HEASA). 198 KIRKNESS SCHOLARSHIP, 202 TRANSKEI NATIONAL BURSARY, 223 GENCOR BURSARY SCHEME, 194 PROVINCIAL ADMINISTRATION WESTERN CAPE LIEBENBERG AND STANDER WESTERN CAPE PTY TREK PETROLEUM BURSARY, 224 GENREF LIMITED BURSARY, 194 BURSARY SCHEME, 214 LTD BURSARY, 204 VOLKSWAGEN BURSARY, 225 GOLD FIELDS OF SA LIMITED BURSARY. 195 TRANSVAAL PROVINCIAL ADMINISTRATION LIGHT HOUSE CLUB BURSARY, 204 W.K. KELLOGG FOUNDATION BURSARIES, 225 ISCOR BURSARY LOAN, 199 (TPA) BURSARY, 224 JCI LIMITED BURSARY, 200 LTA LTD BURSARY SCHEME, 204 WIMBLE CAIRNS AND TAYLOR SCHOLARSHIP, JOHANNESBURG CONSOUDATED INVESTMENT MURRAY AND ROBERTS CONTRACTORS 226 Drama CO LTD (ICI) CATEGORY B BURSARY, 200 BURSARY LOAN SCHEME. 208 Commercial Education ANNA PRETORIUS BURSARY, 177 MURRAY AND ROBERTS GILLIS-MASON KAT BURSARY, 202 JOHANNESBURG CONSOLIDATED INVESTMENT CALTEX OIL (SA) BURSARY, 182 CO LTD *JOHNNIES' CATEGORY C BURSARY, BURSARY. 208 Dramatic Art NATAL PROVINCIAL ADMINISTRATION BURSARY Communication 200 BREYTENBACH BURSARY, 181 SCHEME. 209 JUNIOR RAPPORTRYERSKORPS KLERKSDORP- MINTEK BURSARY. 207 BRONWEN WALKER BURSARY, 181 NSB EDUCATIONAL TRUST, 211 BEURSE. 201 MOBIL OIL REFINING DIVISION STUDY GRANT, HAROLD AND DORIS TOTHILL FUND (BURSARY OVE ARUP INCORPORATED SCHOLARSHIP, 212 KAGISO TRUST BURSARIES. 202 207 FOR TUMON FEES), 197 PORT ELIZABETH CITY COUNCIL BURSARIES, NASIONALE MEDIA BPI( BURSARY, 209 NATIONAL CHEMICAL PRODUCTS JOHANNESBURG REPERTORY PLAYERS BURSARY 213 NORAH TAYLOR BURSARY, 210 SCHOLARSHIP, 209 FOR DRAMATIC ART, 201 ROBERT HULME BURSARY. 215 PERSKOR BURSARY, 212 NSB EDUCATIONAL TRUST, 211 LEONTINE SAGAN SCHOLARSHIP, 203 ROY BEAMISH BURSARY, 216 SPOORNET, 221 PALABORA MINING COMPANY LTD BURSARY, RAPS TRUST BURSARIES, 214 212 SA NATIONAL COMMITTEE ON ILLUMINATION Computer Data Processing BURSARY. 218 POLIFIN BURSARY SCHEME, 213 COMPUTER SOCIETY OF SA BURSARY. 185 SA ROADS BOARD (SARB) BURSARIES, 218 ARMSCOR BURSARY FOR TECHNIKON STUDY. TRANSNET BURSARY. 223 Explosives Technology E 178 Electronic Engineering ARMSCOR BURSARY FOR TECHNIKON STUDY, ASSOCIATION OF MUNICIPAL ELECTRICITY ARMSCOR BURSARY. 178 178 Earth Science UNDERTAKINGS (SA) BURSARY, 178 GENCOR BURSARY SCHEME, 194 ATOMIC ENERGY CORPORATION BURSARIES FOR Extractive Metallurgy ATOMIC ENERGY CORPORATION BURSARIES UNIVERSITY STUDIES. 178 ANGLOVAAL MINERALS TECHNIKON BURSARY FOR UNIVERSITY STUDIES, 178 Ecology CSIR BURSARY (UNIVERSITY STUDY), 185 SCHEME, 177 BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 BKS BURSARY. 180 ISCOR BURSARIES FOR TECHNIKON /TECHNICAL DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) FRED BOUSFIELD MOSS BLUNDELL MEMORIAL BLUE CIRCLE BURSARY. 180 COLLEGE AND UNIVERSITY STUDIES. 198 LTD BURSARY (TECHNIKONS), 187 SCHOLARSHIP. 194 CAPE TOWN CITY BURSARY LOAN SCHEME. 183 KIRKNESS SCHOLARSHIP, 202 DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) COLUMBUS STAINLESS STEEL BURSARY, 185 Economic and Management MINTEK BURSARY, 207 LTD BURSARY (UNIVERSITIES), 187 CSIR BURSARY. 185 RICHTER BURSARY, 215 GENCOR BURSARY SCHEME. 194 Sciences CSIR BURSARY (UNIVERSITY STUDY), 185 SA INSTITUTE OF ELECTRICAL ENGINEERS MINTEK BURSARY, 207 BANK OF LISBON BURSARY. 179 DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) BURSARY SCHEME, 217 BUTTERWORTHS BURSARY. 182 LTD BURSARY (TECHNIKONS). 187 SAPREF ENGINEERING SCHOLARSHIP. 219 F DANIE SWANEPOEL BURSARY. 186 ENGEN LTD BURSARY SCHEME, 191 SASOL LTD BURSARY, 220 DIPPENAAR BURSARY. 188 GENCOR BURSARY SCHEME, 194 Farming SEIFSA UNIVERSITY SCHOLARSHIP, 220 NATIONAL ECONOMIC EDUCATION TRUST FEDERALE VOLKSBELEGGINGS BEURS. 192 GENREF LIMITED BURSARY, 194 SIEMENS BURSARY, 220 (NEET), 209 REPFIN FINANCE BURSARY, 215 GOLD FIELDS OF SA LIMITED BURSARY, 195 TELKOM SA (LTD) BURSARY AND STUDY AID SCHUMANN-WENGEL BURSARY, 220 GREATER JOHANNESBURG TRANSITIONAL SCHEME (ALL REGIONS). 223 Finance TEACHERS' ASSOCIATION OF TRANSVAAL METROPOLITAN COUNCIL (GJTMC) TRANSNET BURSARY. 223 ESTEE LAUDER GROUP OF COMPANIES SECONDARY SCHOOLS BURSARY. 223 BURSARY. 195 BURSARY, 192 HIGHVELD STEEL AND VANADIUM CORP LTD Electronics NATAL PROVINCIAL ADMINISTRATION BURSARY Economic Sciences BARCOM ELECTRONICS (PTY) LIMITED BURSARY. BURSARY, 197 SCHEME. 209 AHI POTCHEFSTROOM BEURS. 176 179 HIGHVELD STEEL AND VANADIUM CORP LTD NSB EDUCATIONAL TRUST, 211 CRINAKER BURSARIES. 196 Economics BURSARY (TECHNIKON). 197 SA DRIED FRUIT CO-OPERATION (EMPLOYEES' CALTEX CORPORATE BURSARY, 182 I.M.K. DE VILLIERS BURSARY. 198 Engineering BURSARIES), 217 CAPE OF GOOD HOPE BANK BURSARY, 182 ISCOR BURSARY LOAN, 199 ALEC BROOK BURSARY, I 76 Financial Information Systems CAPE TOWN CITY BURSARY LOAN SCHEME. 183 (CI LIMITED BURSARY, 200 BATEMAN SCHOLARSHIP FUND. 180 CALTEX OIL (SA) BURSARY, 182 DEPARTMENT OF TRADE AND INDUSTRY JOHANNESBURG CONSOLIDATED INVESTMENT BRITISH AWARD SCHEME, 181 BURSARY, 188 CO LTD (JCI) CATEGORY B BURSARY. 200 CALTEX BURSARY FUND. 182 Financial Management E.J. LOMBARDI TRUST BURSARY. 190 JOHANNESBURG CONSOLIDATED INVESTMENT CONSANI BURSARY. 185 CENBEL-STUDIETRUST BURSARY LOANS FOR ISCOR BURSARY LOAN, 199 CO LTD 'JOHNNIES' CATEGORY C BURSARY. D.G. MURRAY TRUST BURSARY FUND (EASTERN B.COM. STUDENTS, 194 J.F. OOSTHUIZEN MEMORIAL FUND. 199 200 CAPE), 186 SANTAM BURSARIES, 219 JOHANNESBURG TRANSPORT DIVISION (ITO) M.E.I. CONSTRUCTION TRAINEE TECHNICIAN D.G. MURRAY TRUST BURSARY FUND (WESTERN TELKOM SA (LTD) BURSARY AND STUDY AID JOHANNESBURG MUNICIPALITY BURSARY, SCHEME, 205 CAPE), 186 SCHEME (ALL REGIONS), 223 201 MINTEK BURSARY, 207 DEPARTMENT OF TRADE AND INDUSTRY Fine Arts JOSEPH JOWELL BURSARY, 201 MOBIL OIL REFINING DIVISION STUDY GRANT, BURSARY, 188 FINE ARTS MERIT BURSARY. 193 MUSHET BURSARY. 208 207 DEPARTMENT OF WATER AFFAIRS AND G.P. CANITZ BURSARY, 194 N.J. DEAN BURSARY, 208 MURRAY AND ROBERTS CONTRACTORS FORESTRY BURSARY / SCHOLARSHIP, 188 MAGGIE LAUBSER LOCAL BURSARY, 205 NATAL PROVINCIAL ADMINISTRATION BURSARY BURSARY LOAN SCHEME, 208 DUNVEGAN AND GLENDOWER RESIDENTS AND OLIVE TAYLOR BURSARIES, 211 SCHEME. 209 MURRAY AND ROBERTS ENGINEERING LIMITED RATEPAYERS ASSOCIATION BURSARY, I89 OSMOND LANGE ARCHITECTS BURSARY, 212 OLD TRUST BANK BURSARY, 211 BURSARY. 208 EDKINS BURSARY FUND. 190 RAU DEPARTMENT OF TRANSPORT ECONOMICS NSB EDUCATIONAL TRUST, 211 FEOERALE VOLKSBELEGGINGS BEURS, 192 Fisheries Science BURSARY, 215 POLIFIN BURSARY SCHEME, 213 GEORGE BLAKE BURSARY, 194 lin SCHOLARSHIP TRUST BURSARY LOAN, 198 TRANSKEI TEA MANAGEMENT, 223 PRETORIA PORTLAND CEMENT BURSARY HAGGIE BURSARY. 196 TRANSNET BURSARY, 223 SCHEME (MEMBER BARLOWS). 213 Food Science HELEN SUZMAN/BRITISH GOVERNMENT IRVIN AND JOHNSON BURSARY, 198 TRANSPORT TECHNICAL INDUSTRIES (PTY) LTD R.E. PRETORIUS BURSARY, 214 AWARDS, 197 SA ASSOCIATION FOR FOOD SCIENCE AND (TTO BURSARY, 224 RAND CARBIDE LIMITED BURSARY, 214 HENDRIK EN ANNATJIE VISAGE BURSARY. 197 TECHNOLOGY (SAVVOT) UNDERGRADUATE TREK PETROLEUM BURSARY. 224 RICHARDS BAY COAL TERMINAL BURSARY. 215 HNR COMPUTERS BURSARY FUND. 197 BURSARY, 217 UNITRANS LTD BURSARY. 224 RICHARDS BAY MINERALS BURSARIES (FOR 'DB SCHOLARSHIP TRUST BURSARY LOAN. 198 W.K. KELLOGG FOUNDATION BURSARIES, 225 UNIVERSITY STUDY), 215 SA DRIED FRUIT CO-OPERATION (JAN BOSMAN) J.B. COLLINS LOAN FUND. 199 BURSARY, 217 WILLEM PRETORIUS BURSARY. 226 ROBERT JUNG SCHOLARSHIP, 216 JOHANN G. LEIPOLDT MEMORIAL TRUST Education SA BREWERIES BEER DIVISION BURSARY SCHEME. BURSARY. 200 Food Service Management 217 PROVINCIAL ADMINISTRATION WESTERN CAPE AKTOL UNDERGRADUATE BURSARY. 176 LANGELER SCHOLARSHIP. 203 SA DRIED FRUIT CO-OPERATION (EMPLOYEES' BURSARY SCHEME, 214 BRITISH AWARD SCHEME. 181 LOEKIE ODENDAAL BURSARY. 204 BURSARIES). 217 CAPE TOWN HEBREW CONGREGATION BURSARY. MILTON ALUMNI ENGINEERING SPORTS SA INSTITUTE OF ELECTRICAL ENGINEERS Food Technology 183 BURSARY, 207 CLOVER SA BURSARY SCHEME, 184 BURSARY SCHEME, 217 D.G. MURRAY TRUST BURSARY FUND (WESTERN MPUMALANGA PREMIER PRIVATE SECTOR SA NATIONAL COMMITTEE ON ILLUMINATION CSIR BURSARY, 185 CAPE), 186 BURSARY FUND, 208 SA BREWERIES BEER DIVISION BURSARY SCHEME. BURSARY, 218 DEPARTMENT OF EDUCATION BURSARY. 187 MUSHET BURSARY, 208 217 SAPPI BURSARY, 219 DIOCESE OF MARIANNHILL NATIONAL NAMDEB DIAMOND CORPORATION (PTY) LTD, SAPREF ENGINEERING SCHOLARSHIP, 219 SA DRIED FRUIT CO-OPERATION (EMPLOYEES' CATHOLIC BURSARY AND SCHOLARSHIP 208 BURSARIES). 217 SASOL LTD BURSARY, 220 FUND, 188 NATBEV/COCA-COLA BOTTLERS' TERTIARY SEIFSA UNIVERSITY SCHOLARSHIP, 220 ETHEL JOYCE CHARLTON BURSARY. 192 EDUCATION, 209 Forest Management SIEMENS BURSARY. 220 FAR NORTH EDUCATION AND TRAINING TRUST ODA BURSARY/LOAN SCHEME, 211 SOL MOSHAL BURSARY, 221 STEWART SCOTT BURSARY, 222 LOAN, 192 PLATO DEVELOPMENT FUND BURSARY, 213 TRANSNET BURSARY, 223 Forestry HAROLD AND DORIS TOTHILL FUND (BURSARY RANDCOAL SERVICES BURSARY, 214 A.C. TINGLE MEMORIAL BURSARY, 174 VKE BURSARY, 225 FOR TUITION FEES), 197 SA GE EDUCATIONAL TRUST BURSARY, 217 BOB BLUNDELL MEMORIAL BURSARY, 180 WATSON EDWARDS BURSARY, 226 HELEN SUZMAN/BRITISH GOVERNMENT SA INSTITUTE OF RACE RELATIONS (SAiRR) CLIFFORD-GLOSSOP BURSARY, 184 AWARDS, 197 Electrical Engineering (Heavy BURSARIES, 217 COLIN COM. SCHOLARSHIP FUND, 185 SA SUGAR INDUSTRY TRUST FUND. 2)8 JOHANN G. LEIPOLDT MEMORIAL TRUST Current) CSIR BURSARY (UNIVERSITY STUDY). 185 BURSARY. 200 SEIFSA TECHNIKON BURSARY. 220 DANIE SWANEPOEL BURSARY, 186 ANGLO AMERICAN CORPORATION GROUP JOHN DEERE BURSARIES. 201 SIR HENRY STRAKOSCH MEMORIAL DEPARTMENT OF WATER AFFAIRS AND VOCATIONAL SCHOLARSHIPS, 177 KAPLAN CENTRE AWARD IN JEWISH EDUCATION, SCHOLARSHIP, 220 FORESTRY BURSARY / SCHOLARSHIP, 188 ANGLOVAAL MINERALS BURSARY SCHEME, 177 202 SPOORNET, 221 ELSIE CECILIA MCDERMID BURSARY, 191 ANGLOVAAL MINERALS TECHNIKON BURSARY MAVIS WAKEFORD BURSARY, 206 STANDARD BANK SCHOLARSHIP SCHEME. 221 SCHEME, 177 FOREST OWNERS BURSARY, 193 NATIONAL STATE/INDEPENDENT STATE STANWAY EDWARDS NGOMANE GROUP HANS MERENSKY BURSARY, 196 DE BEERS GROUP VOCATIONAL SCHOLARSHIP, BURSARY LOANS, 209 BURSARY, 221 IDB SCHOLARSHIP TRUST BURSARY LOAN, 198 187 NEW SETTLERS' FOUNDATION BURSARY. 210 STELLA AND PAUL LOEWENSTEIN CHARITABLE DEPARTMENT OF WATER AFFAIRS AND SABIE BOSFEESKOMITEE-BEURS, 218 NORAH TAYLOR BURSARY. 210 AND EDUCATIONAL TRUST BURSARIES. 222 FORESTRY BURSARY / SCHOLARSHIP. 188 SAPPI BURSARY, 219 OFS DEPARTMENT OF EDUCATION BURSARIES, STEWART SCOTT BURSARY, 222 DURBAN CITY COUNCIL LOANS, 189 SOL MOSHAL BURSARY, 221 211 STUDIETRUST BURSARY, 222 ESKOM TECHNIKON BURSARY, 191 OVERBEEK TRUST, 212 TRANSKEI TEA MANAGEMENT, 223 French ESKOM UNIVERSITY BURSARY, 191 RICHARDS BAY COAL TERMINAL BURSARY. 215 VODACOM BURSARY SCHEME. 225 ADRIAAN ELFERINK BURSARY, 175 GENREC CONSTRUCTION BURSARY SCHEME, FRENCH GOVERNMENT BURSARIES, 194 ROTARY CLUB OF CAPE TOWN BURSARY. 216 VOLKSWAGEN BURSARY. 225 194 ROUND TABLE BURSARY FUND (UNIVERSITY OF INSTITUTION OF CERTIFICATED MECHANICAL Engineering Design G THE WESTERN CAPE), 216 AND ELECTRICAL ENGINEERS BURSARY, 198 ISCOR BURSARIES FOR TECHNIKON/TECHNICAL SA INSTITUTE OF RACE RELATIONS (SAIRR) Geological Engineering ISCOR BURSARIES FOR TECHNIKON /TECHNICAL COLLEGE AND UNIVERSITY STUDIES. 198 BURSARIES, 217 GOLD FIELDS OF SA LIMITED BURSARY. 19S COLLEGE AND UNIVERSITY STUDIES, 198 SATS 'GENERAL BOTHA' OLD BOYS' Engineering Drawing PORT ELIZABETH CITY COUNCIL BURSARIES. Geology ASSOCIATION WAR MEMORIAL FUND ISCOR BURSARIES FOR TECHNIKON /TECHNICAL 213 ANGLO AMERICAN CORPORATION GROUP BURSARY, 220 COLLEGE AND UNIVERSITY STUDIES. 198 SASOL CHEMICAL INDUSTRIES BURSARIES FOR VOCATIONAL SCHOLARSHIPS. 177 TEACHERS' ASSOCIATION OF TRANSVAAL TECHNIKON STUDIES, 220 English ANGLO AMERICAN CORPORATION OF SA SECONDARY SCHOOLS BURSARY. 223 ARGUS CENTENERY BURSARY, 178 LIMITED BRIDGING PROGRAMME BURSARY. TILLY STAPPER TRUST (BURSARY). 223 Electrical Engineering (Light BABETTE TAUTE BURSARIES. 179 177 TRANSVAAL ASSOCIATION OF TEACHERS Current) BASIL LE MAY BURSARY, 180 ANCLOVAAL MINERALS BURSARY SCHEME. 177 LOAN /BURSARY, 224 COUNCIL FOR MINERAL TECHNOLOGY FRANK CONNOCK UNIVERSITY TRUST BERNARD THOMAS BOURKE BURSARY, 180 W.K. KELLOGG FOUNDATION BURSARIES, 225 UNDERGRADUATE BURSARY, 185 BURSARIES, 193 COUNCIL FOR MINERAL TECHNOLOGY WENTZEL BURSARY, 226 DE BEERS INDUSTRIAL DIAMOND DIVISION )PTY) GERALD WRIGHT SCHOLARSHIP. 195 UNDERGRADUATE BURSARY, 185 WESTERN CAPE EDUCATION DEPARTMENT LTD BURSARY (UNIVERSITIES). 187 H.A. WHITECROSS SCHOLARSHIPS, 196 CSIR BURSARY (UNIVERSITY STUDY), 185 BURSARIES, 226 DEPARTMENT OF WATER AFFAIRS AND HAROLD AND DORIS TOTHILL FUND (BURSARY DE BEERS GROUP VOCATIONAL SCHOLARSHIP, Electrical Engineering FORESTRY BURSARY / SCHOLARSHIP. 188 FOR TUITION FEES). 197 187 A. TREVOR WILLIAMS SCHOLARSHIP, 174 ESKOM TECHNIKON BURSARY, 191 MARILYN LOUW SCHOLARSHIPS, 205 DEPARTMENT OF WATER AFFAIRS AND AECI LTD BURSARY, 175 ESKOM UNIVERSITY BURSARY, 191 NANCY LITTLE BURSARY. 209 FORESTRY BURSARY / SCHOLARSHIP. 188 AFRICON BURSARY, 175 GENREC CONSTRUCTION BURSARY SCHEME, WINIFRED WILSON BURSARY, 226 CENCOR BURSARY SCHEME. 194 AFRICON ENGINEERING INTERNATIONAL 194 ISCOR BURSARY LOAN, 199 Entomology (CI LIMITED BURSARY, 200 BURSARIES (TECHNIKON), 175 SASOL CHEMICAL INDUSTRIES BURSARIES FOR ACRIHOLD BURSARIES. 175 ALBERT HOSSACK SCHOLARSHIP. 176 TECHNIKON STUDIES. 220 JOHANNESBURG CONSOLIDATED INVESTMENT CIBA BURSARY, 184 CO LTD UCI) CATEGORY B BURSARY, 200 AMEU (ASSOCIATION OF MUNICIPAL TELKOM SA (LTD) BURSARY AND STUDY AID OUTSPAN BURSARY. 212 ELECTRICITY UNDERTAKINGS OF SA) SCHEME (ALL REGIONS), 223 MINTEK BURSARY, 207 STUDENT ASSISTANCE SCHEME. 177 Environmental Health NAMDEB DIAMOND CORPORATION (PTY) LTD. AMPLATS BURSARY SCHEME. I 77 Electro-Mechanical Engineering DEPARTMENT OF WELFARE AND POPULATION 208 AECI LTD BURSARY, 175 ANGLO AMERICAN CORPORATION OF SA DEVELOPMENT BURSARIES, 188 SIR HENRY STRAKOSCH MEMORIAL ESKOM UNIVERSITY BURSARY, 191 LIMITED BRIDGING PROGRAMME BURSARY. SCHOLARSHIP, 220 POLIFIN BURSARY SCHEME. 213 Exploration Geophysics I 77 WILLEM DE KOCK GEOLOGY BURSARIES, 226 SAFRIPOL BURSARY, 218 DEPARTMENT OF WATER AFFAIRS AND ARMSCOR BURSARY, 178 SCHOLARSHIP. 188 SAPPI BURSARY. 219 FORESTRY BURSARY Geophysics 246 Riorcarepc 231 GENCOR BURSARY SCHEME. 194 W.K. KELLOGG FOUNDATION BURSARIES, 225 Life Sciences GENREC CONSTRUCTION BURSARY SCHEME, 194 Information Systems ALAN WIGODER MEMORIAL FUND. 176 Geotechnology GENREF LIMITED BURSARY. 194 DEPARTMENT OF CORRECTIONAL SERVICES DEPARTMENT OF WATER AFFAIRS AND Local Government GOLD FIELDS OF SA UMITED BURSARY, 195 FORESTRY BURSARY / SCHOLARSHIP, 188 PUBUC BURSARY SCHEME, 187 DUNVEGAN AND GLENDOWER RESIDENTS AND GREATER JOHANNESBURG TRANSMONAL ENGEN LTD BURSARY SCHEME, 191 RATEPAYERS ASSOCIATION BURSARY. 189 METROPOLITAN COUNCIL (GJTMC) German IDEI SCHOLARSHIP TRUST BURSARY LOAN. 198 DAAD UNDERGRADUATE BURSARIES (GERMAN KEMPTON PARK CITY COUNCIL BURSARY BURSARY, 195 ISCOR BURSARY LOAN, 199 SCHEME (LOCAL GOVERNMENT), 202 HIGHVELD STEEL AND VANADIUM CORP LTD ACADEMIC EXCHANGE SERVICE), 186 RICHARDS BAY COAL TERMINAL BURSARY, 215 BURSARY, 197 H UMGENI WATER BURSARY, 224 Logopaedics TRANSVAAL PROVINCIAL ADMINISTRATION HIGHVELD STEEL AND VANADIUM CORP LTD Information Technology BURSARY (TECHNIKON). 197 Harp (TPA) BURSARY, 224 KATHLEEN ALISTER HARP SCHOLARSHIP. 202 CALTEX OIL (SA) BURSARY, 182 INSTITUTION OF CERTIFICATED MECHANICAL CSIR BURSARY, 185 M AND ELECTRICAL ENGINEERS BURSARY. 198 Health Care DENEL INFOPLAN BURSARY. 187 ISCOR BURSARIES FOR TECHNIKON/TECHNICAL RICHARDS BAY COAL TERMINAL BURSARY, 21 S HNR COMPUTERS BURSARY FUND, 197 Management COLLEGE AND UNIVERSITY STUDIES, 198 SANLAM BURSARY FOR TECHNIKON STUDENTS. N.J. DEAN BURSARY, 208 ISCOR BURSARY LOAN. 199 Health Sciences NATIONAL ECONOMIC EDUCATION TRUST KAGISO TRUST BURSARIES, 202 219 ICI LIMITED BURSARY, 200 SEIFSA TECHNIKON BURSARY. 220 (NEET), 209 JOHANNESBURG CONSOLIDATED INVESTMENT STANDARD BANK SCHOLARSHIP SCHEME, 221 NSB EDUCATIONAL TRUST, 211 W.K. KELLOGG FOUNDATION BURSARIES, 225 TRANSNET BURSARY. 223 CO LTD (JCI) CATEGORY B BURSARY, 200 Inorganic Chemistry OLD TRUST BANK BURSARY, 211 JOHANNESBURG CONSOLIDATED INVESTMENT Hebrew TREK PETROLEUM BURSARY, 224 CO LTD 'JOHNNIES' CATEGORY C BURSARY, JOHANNESBURG CONSOLIDATED INVESTMENT B'NAI B'RITH JOHANNESBURG LODGE AND 200 CO LTD 'JOHNNIES' CATEGORY C BURSARY, Marketing CHAPTER LILLIENFIELD BURSARY, 179 JOHN DEERE BURSARIES, 201 200 BLUE CIRCLE BURSARY. 180 KIRKNESS SCHOLARSHIP, 202 History MINTEK BURSARY, 207 CLOVER SA BURSARY SCHEME. (84 DR JJ. VAN TONDER BURSARY (HISTORY DEPARTMENT OF TRADE AND INDUSTRY M.E.I. CONSTRUCTION TRAINEE TECHNICIAN BURSARY FUND), 189 Instrumentation BURSARY, 188 SCHEME. 205 H.A. WHITECROSS SCHOLARSHIPS. 196 ISCOR BURSARIES FOR TECHNIKON /TECHNICAL ESTEE LAUDER GROUP OF COMPANIES MAGWA TEA CORPORATION BURSARY SCHEME. RAPPORTRYERSKORPS PIKETBERG-BEURS, 214 COLLEGE AND UNIVERSITY STUDIES, 198 BURSARY, 192 205 Instrumentation and Control SA BREWERIES BEER DIVISION BURSARY SCHEME, MECHANICAL ENGINEERING (ANONYMOUS History of Art 217 DONOR). 206 ADIE FUHRMANN BURSARY, 175 ESKOM TECHNIKON BURSARY, 191 SA DRIED FRUIT CO-OPERATION (EMPLOYEES' MOBIL OIL REFINING DIVISION STUDY GRANT, Home Economics Internal Auditing BURSARIES), 217 207 BOKOMO BURSARY, 181 CALTEX OIL (SA) BURSARY, 182 SANTAM BURSARIES, 219 MURRAY AND ROBERTS CONTRACTORS HOME ECONOMICS ASSOCIATION OF TELKOM SA (LTD) BURSARY AND STUDY AID TELKOM SA (LTD) BURSARY AND STUDY AID BURSARY LOAN SCHEME. 208 SOUTHERN AFRICA BURSARY (HEASA), 198 SCHEME (ALL REGIONS), 223 SCHEME (ALL REGIONS). 223 MURRAY AND ROBERTS ENGINEERING LIMITED JOSSIE ACKERMANN LOAN. 201 Italian Studies Marketing Management BURSARY, 208 MAX AND LOUISE ACKERMANN BURSARIES FOR NATAL PROVINCIAL ADMINISTRATION BURSARY ALVISE PISANO SCHOLARSHIPS. 176 TRANSNET BURSARY, 223 HOME ECONOMICS, 206 SCHEME. 209 STELLENBOSCH AGRICULTURAL SOCIETY J Materials Engineering NSB EDUCATIONAL TRUST, 211 BURSARY, 222 Jewish Studies COUNCIL FOR MINERAL TECHNOLOGY POLIFIN BURSARY SCHEME. 213 UNDERGRADUATE BURSARY, 185 PRETORIA PORTLAND CEMENT BURSARY CAPE TOWN HEBREW CONGREGATION BURSARY, Horticulture MINTEK BURSARY, 207 SCHEME (MEMBER BARLOWS), 213 183 ALAN STARKE COMMEMORATION FUND (LOAN). MURRAY AND ROBERTS ENGINEERING LIMITED RICHARDS BAY COAL TERMINAL BURSARY, 215 CECIL-LYONS TRUST SCHOLARSHIP, 183 176 BURSARY, 208 RICHARDS BAY MINERALS BURSARIES (FOR CIBA BURSARY. 184 KAPLAN CENTRE AWARD IN JEWISH EDUCATION. UNIVERSITY STUDY), 215 COLIN GOHL SCHOLARSHIP FUND. 185 202 Materials Science SA BREWERIES BEER DIVISION BURSARY SCHEME, GREATER JOHANNESBURG TRANSITIONAL Journalism ATOMIC ENERGY CORPORATION BURSARIES 217 METROPOLITAN COUNCIL (GJTMC) FOR UNIVERSITY STUDIES, 178 CAPITAL RADIO/RHODES MUSIC RADIO SA DRIED FRUIT CO-OPERATION (EMPLOYEES' BURSARY, 195 SEIFSA UNIVERSITY SCHOLARSHIP. 220 BURSARY. 183 BURSARIES), 217 MOLTENO BROTHERS BURSARY. 207 CAR MAGAZINE BURSARY. 183 Mathematical Sciences SA INSTITUTION OF MECHANICAL ENGINEERING OUTSPAN BURSARY, 212 NASIONALE MEDIA BPK BURSARY. 209 GOLD FIELDS OF SA LIMITED BURSARY, 195 MERIT AWARDS, 217 SA DRIED FRUIT CO-OPERATION (EMPLOYEES' NASIONALE PERS BPK BEURS, 209 SAFRIPOL BURSARY. 218 BURSARIES), 217 Mathematical Statistics SALMA BURSARIES (FOR UNIVERSITY STUDY). SA DRIED FRUIT CO-OPERATION SAN BOSMAN) L ARMSCOR BURSARY. 178 219 BURSARY. 217 Laboratory Medicine DEPARTMENT OF WATER AFFAIRS AND SAPPI BURSARY, 219 SA NURSERY ASSOCIATION BURSARY, 218 FORESTRY BURSARY / SCHOLARSHIP, 188 SAPREF ENGINEERING SCHOLARSHIP, 219 MEDICAL GRADUATES' ASSOCIATION BURSARY, TRANSKEI TEA MANAGEMENT, 223 GENCOR BURSARY SCHEME, 194 SASOL CHEMICAL INDUSTRIES BURSARIES FOR 207 Human Movement Science Mathematics TECHNIKON STUDIES, 220 CALLIE HUMAN GYMNASTIC BURSARIES, 182 Land Surveying A.W. SCHUMANN BURSARY. 174 SASOL LTD BURSARY, 220 Human Resources AIR SURVEY COMPANY OF AFRICA LOAN. 176 ARMSCOR BURSARY, 178 SEIFSA UNIVERSITY SCHOLARSHIP. 220 AUBREY SIMPSON BURSARY, 178 BONA MAGAZINE BURSARY, 181 STEWART SCOTT BURSARY, 222 PALABORA MINING COMPANY LTD BURSARY. CAPE TOWN CITY BURSARY LOAN SCHEME, 183 CALTEX BURSARY FUND. 182 TELKOM SA (LTD) BURSARY AND STUDY AID 212 CENTRAL COUNCIL OF LAND SURVEYORS CHARLES PELTERET EDUCATIONAL TRUST, 184 SCHEME (ALL REGIONS), 223 Human Resources Management BURSARY (COLS), I83 CSIR BURSARY (UNIVERSITY STUDY), 185 TRANSNET BURSARY, 223 GREATER JOHANNESBURG TRANSITIONAL COUNCIL UNIVERSITY BURSARY, 185 D.G. MURRAY TRUST BURSARY FUND (EASTERN UMGENI WATER BURSARY, 224 METROPOLITAN COUNCIL (GJTMC) GREATER JOHANNESBURG TRANSITIONAL CAPE), 186 WATSON EDWARDS BURSARY, 226 BURSARY, 195 METROPOLITAN COUNCIL (GJTMC) D.C. MURRAY TRUST BURSARY FUND (WESTERN Medical Biochemistry BURSARY, 195 TRANSNET BURSARY, 223 CAPE), 186 BARNEY BLIEDEN BURSARIES, 179 Human Sciences INSTITUTE OF PROFESSIONAL LAND SURVEYORS DEPARTMENT OF WATER AFFAIRS AND BURSARY, 198 FORESTRY BURSARY / SCHOLARSHIP, 188 Medical related fields ANNEMARIE BASSON BURSARY, 177 MIG SULTER MEMORIAL FUND BURSARY, 207 GENCOR BURSARY SCHEME. 194 OVERBEEK TRUST. 212 AUBREY FALKSON BURSARY, 178 SA COUNCIL FOR PROFESSIONAL LAND JOHANN G. LEIPOLDT MEMORIAL TRUST Medical Science ETHEL JOYCE CHARLTON BURSARY. 192 SURVEYORS AND TECHNICAL SURVEYORS BURSARY, 200 SA DRUGGIST BURSARY. 217 LILITHEA SINGER ART FORUM BURSARY, 204 BURSARY, 217 MAUDE CATHERINE BIRD MEMORIAL TRANSNET BURSARY, 223 Mechanical Engineering Medicine SCHOLARSHIPS. 206 VAN DER SPUY SCHOLARSHIP. 225 AECI LTD BURSARY, 175 A.J.M. STEPHANSEN BURSARY LOAN SCHEME. MIMI COERTZE BURSARY. 207 Law AMPLATS BURSARY SCHEME, 177 174 NATAL PROVINCIAL ADMINISTRATION BURSARY ANGLO AMERICAN CORPORATION GROUP ALEC BROOK BURSARY, 176 ADAMS AND ADAMS BURSARY, 174, 175 SCHEME, 209 VOCATIONAL SCHOLARSHIPS, 177 ALWYN ZOUTENDYK BURSARIES, 176 ADAMS AND ADAMS BURSARY FUND, 175 ANGLO AMERICAN CORPORATION OF SA B000 KOCH BOOK BURSARY, 181 Hydrology ANGLO AMERICAN ASSURANCE BURSARY, 177 LIMITED BRIDGING PROGRAMME BURSARY. BPP (BEPERKTE PRIVAATPRAKTYK) STUDIEBEURS, DEPARTMENT OF WATER AFFAIRS AND AUBREY FALKSON BURSARY. 178 177 181 FORESTRY BURSARY / SCHOLARSHIP. 188 COMMITTEE OF UNIVERSITY PRINCIPALS, 185 ANGLOVAAL MINERALS BURSARY SCHEME, 177 BRITISH AWARD SCHEME, 181 DOROTHY ADELINE JOOSTE FUND, 188 1 ANGLOVAAL MINERALS TECHNIKON BURSARY C.J. LATEGAN AND PARTNERS LOAN FUND. I82 DPS BURSARY, 189 SCHEME, 177 CHARLES HURWITZ BURSARY, 184 ERNIE WENTZEL SCHOLARSHIP. 191 Industrial Engineering ARMSCOR BURSARY, 178 CHARLES PELTERET EDUCATIONAL TRUST. 184 AECI LTD BURSARY, 175 FACULTY OF LAW PERSONNEL BURSARY FUND, ARMSCOR BURSARY FOR TECHNIKON STUDY, CIBA BURSARY. 184 ATOMIC ENERGY CORPORATION BURSARIES 192 178 D.R. MCINTOSH TRUST, 186 FOR UNIVERSITY STUDIES, 178 FAR NORTH EDUCATION AND TRAINING TRUST ARTHUR E. HILL BURSARY, I 78 D.R. MEIRING MEMORIAL BURSARY. 186 CLOVER SA BURSARY SCHEME, 184 LOAN, 192 ATOMIC ENERGY CORPORATION BURSARIES DOROTHY AND MENDEL SPITZ STUDY BURSARY, COLUMBUS STAINLESS STEEL BURSARY, 18S FEDERALE VOLKSBELEGGINGS BEURS, 192 FOR UNIVERSITY STUDIES, 178 189 CSIR BURSARY (UNIVERSITY STUDY), 185 FIDELITY FUND STUDENT LOAN SCHEME, 193 BKS BURSARY, 180 OR J.P. MEYER AND W.A. JOHNSEN BURSARY DORBYL LIGHT AND GENERAL ENGINEERING, GROVE. VAN DER HEEVER AND MAY BLUE CIRCLE BURSARY. 180 LOAN, 189 188 SCHOLARSHIP, 196 BOART LONGYEAR BURSARY (BRIDGING DR ZUURDEEG MEMORIAL BURSARIES, 189 DORBYL LIGHT AND GENERAL ENGINEERING JOSEPH SINGER BURSARY, 201 SCHEME). 180 DURBAN RADIOLOGICAL SERVICES (TECHNIKONI, 188 JUTA BURSARIES, 201 CALTEX CORPORATE BURSARY. 182 EDUCATIONAL TRUST BURSARY, 189 HIGHVELD STEEL AND VANADIUM CORP LTD KAGISO TRUST BURSARIES. 202 CALTEX OIL (SA) BURSARY, 182 E.W. TURTON STUDY LOAN. 190 BURSARY (TECHNIKON), 197 LEZA LEGALWISE BURSARY, 204 CLOVER SA BURSARY SCHEME, 184 EASTERN METROPOLITAN SUBSTRUCTURE. 190 ISCOR BURSARIES FOR TECHNIKON/TECHNICAL N.J. DEAN BURSARY, 208 COLUMBUS STAINLESS STEEL BURSARY, 18S ELI LILLY (SA) (PTY) LTD BURSARY, 191 COLLEGE AND UNIVERSITY STUDIES. 198 NORMAN E. ROSENBERG BURSARY, 210 CSIR BURSARY, 185 EVANGELICAL PRESBYTERIAN CHURCH IN SA JOHN DEERE BURSARIES. 201 PATRIC OWENS BURSARIES, 212 CSIR BURSARY (UNIVERSITY STUDY), 185 BURSARY/LOAN, 192 MURRAY AND ROBERTS CONTRACTORS PROFESSIONAL EXAMINATION BURSARY, 214 CYANAMID BURSARY SCHEME, 186 FAR NORTH EDUCATION AND TRAINING TRUST BURSARY LOAN SCHEME. 208 ROOTH & WESSELS SCHOLARSHIP. 216 DE BEERS GROUP VOCATIONAL SCHOLARSHIP. LOAN. (92 POLIFIN BURSARY SCHEME. 213 SCHUMANN-WENGEL BURSARY. 220 187 FELIX AND CHRISTINE GUT BURSARY LOAN. 193 SA BREWERIES BEER DIVISION BURSARY SCHEME, SOUTH EASTERN CAPE ATTORNEYS DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) FUNDANI TRUST. 194 217 ASSOCIATION BRUSARY, 221 LTD BURSARY (TECHNIKONS), 187 GAUTENG PROVINCIAL GOVERNMENT BURSARY, SASOL LTD BURSARY, 220 STEVE LOUW SCHOLARSHIPS, 222 DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) 194 SEIFSA UNIVERSITY SCHOLARSHIP, 220 WALTER POLLAK BURSARY, 226 LTD BURSARY (UNIVERSITIES), 187 GOLD FIELDS OF SA LIMITED BURSARY, 195 TRANSNET BURSARY. 223 Library and Information Science DEPARTMENT OF WATER AFFAIRS AND GROUP CAPTAIN 'SAILOR' MALAN MEMORIAL Industrial Psychology SAKKIE GEYSER BURSARY, 219 FORESTRY BURSARY / SCHOLARSHIP, 188 BURSARIES, 196 GREATER JOHANNESBURG TRANSITIONAL Library Science DORBYL LIGHT AND GENERAL ENGINEERING. HELMUT HUSSERL BURSARY, 197 METROPOLITAN COUNCIL IGJTMC) 188 IDB SCHOLARSHIP TRUST BURSARY LOAN, 198 CAPE TOWN CITY BURSARY LOAN SCHEME. 183 BURSARY. 195 DORBYL LIGHT AND GENERAL ENGINEERING J.B. COLLINS LOAN FUND, 199 SA INSTITUTE FOR LIBRARIANSHIP AND TRANSNET BURSARY, 223 (TECHNIKON), 188 J.W. DU PREEZ BURSARY. 199 INFORMATION SCIENCE (SAIL'S) (WESTERN ESKOM TECHNIKON BURSARY. 191 JAMES MAY DUTHIE BURSARY, 200 Information CAPE BRANCH) STUDY GRANT, 217 ESKOM UNIVERSITY BURSARY. 191 JAN DRECHMEIER MEDICAL BURSARY. 200 VODACOM BURSARY SCHEME. 225 SA LIBRARY ASSOCIATION (WEST. CAPE GENCOR BURSARY SCHEME, 194 Information Sciences BRANCH) STUDENT BURSARY, 218 232 JO BROWNE TRUST FUND FOR MEDICAL CLOVER SA BURSARY SCHEME. 184 Musical Recitation 0 STUDENTS. 200 DEPARTMENT OF WATER AFFAIRS AND ANNA PRETORIUS BURSARY, 177 Occupational Therapy JOHANN G. LEIPOLDT MEMORIAL TRUST FORESTRY BURSARY / SCHOLARSHIP, 188 NATIONAL CHEMICAL PRODUCTS N GAUTENG PROVINCIAL GOVERNMENT BURSARY. BURSARY, 200 (94 JOHANNES C. PIETERSE STUDY BURSARY. 200 SCHOLARSHIP, 209 Natural Science HELEN SUZMAN/BRITISH GOVERNMENT JOHN MICHAEL HANSEN BURSARY, 201 SA BREWERIES BEER DIVISION BURSARY SCHEME, OVERBEEK TRUST. 212 AWARDS, (97 JOHNSON AND JOHNSON 'PROFESSIONAL 217 UMGENI WATER BURSARY. 224 Natural Sciences J.E. CONRADIE LOAN, 199 PRODUCTS' BURSARY. 201 MEDICAL EDUCATION FOR SA BLACKS (MESABI JOSEPH GRANELLI BURSARY, 201 A.J.M. STEPHANSEN BURSARY LOAN SCHEME, Microsoft Systems Engineering BURSARY 207 JUTA BURSARIES, 201 I 74 MICROSOFT APPRENTICESHIP PROGRAMME MEDICAL GRADUATES' ASSOCIATION BURSARY. KANCWANE MEDICAL BURSARIES, 202 AGRICULTURAL RESEARCH COUNCIL (ARC) EDUCATIONAL TRUST (MAPET), 207 207 KHOLVAD MADRESSA FUND. 202 ORDINARY BURSARIES, 175 Mine Surveying AGRICULTURAL RESEARCH COUNCIL (ARC) OCCUPATIONAL THERAPY BURSARY. 211 KWAZULU-NATAL PROVINCIAL PROVINCIAL ADMINISTRATION WESTERN CAPE ADMINISTRATION BURSARY SCHEME. 203 AMPLATS BURSARY SCHEME. 177 PRESTIGE BURSARIES, 175 BURSARY SCHEME, 214 LAURENCE DAVID ADLER BURSARY, 203 ANGLO AMERICAN ASSURANCE BURSARY, 177 Mineralogy ANTON RUPERT BURSARY, 178 SAMST BURSARY/LOAN, 219 LAZAR RAVID MEMORIAL SCHOLARSHIP, 203 MINTEK BURSARY, 207 ATZO NICOLAI MEMORIAL SCIENCE BURSARIES, TRANSVAAL PROVINCIAL ADMINISTRATION LEO AND SARA BUCHEN SCHOLARSHIPS. 203 (TPA) BURSARY. 224 LESOTHO GOVERNMENT BURSARY. 203 Minerals Processing 178 WORKMEN'S ACCIDENT AND REHABILITATION LIBERO PATTI MEDICAL BURSARY FUND, 204 ANGLO AMERICAN CORPORATION OF SA AUBREY FALKSON BURSARY, 178 CENTRE BURSARY - DURBAN, 227 M.F. ESMONDE-WHITE BURSARIES. 205 LIMITED BRIDGING PROGRAMME BURSARY. BATEMAN SCHOLARSHIP FUND. 180 MARGARET GIBSON BURSARY FUND. 205 177 BEREND KOLK BURSARY. 180 Oenology MARY AND LOUIS GOLDFOOT SCHOLARSHIPS, DE BEERS GROUP VOCATIONAL SCHOLARSHIP, BONA MAGAZINE BURSARY, 181 D.P. PONGRACZ SCHOLARSHIP TRUST, 186 BOPHUTHATSWANA MPUDULOLE BURSARY AID 205 187 KWV UNDERGRADUATE BURSARY. 203 MARY GORDON BURSARY, 206 DEPARTMENT OF CHEMICAL ENGINEERING FUND. 181 PEROLD-STEINER BURSARY LOAN SCHMEME, MAX AND LOUISE ACKERMANN LOANS FOR BURSARY LOAN SCHEME, 187 BRITISH AWARD SCHEME, 181 212 MEDICINE. 206 CALTEX BURSARY FUND, 182 Mining COUNCIL FOR MINERAL TECHNOLOGY Optometry MAX FELDMAN BURSARY. 206 NAMDEB DIAMOND CORPORATION (PTY) LTD. UNDERGRADUATE BURSARY. 185 SA VISION CARE PTY (LTD) BURSARY. 21 8 MEDICAL ASSOCIATION OF SA (TYGERBERG - 208 BOLAND) BURSARY, 206 D.G. MURRAY TRUST BURSARY FUND (WESTERN Organ MEDICAL ASSOCIATION OF SA BURSARY, 206 Mining Engineering CAPE), 186 NG KERK (00S-KAAPI BEURSE. 210 MEDICAL ASSOCIATION OF SA LOWVELD AMPLATS BURSARY SCHEME, 177 DEPARTMENT OF TRADE AND INDUSTRY ANGLO AMERICAN CORPORATION GROUP BURSARY, 188 Organisation and Work Study BRANCH MEDICAL BURSARY. 206 NATAL PROVINCIAL ADMINISTRATION BURSARY MEDICAL EDUCATION FOR SA BLACKS (MESABI VOCATIONAL SCHOLARSHIPS, 177 DEPARTMENT OF WATER AFFAIRS AND FORESTRY BURSARY / SCHOLARSHIP. 188 SCHEME. 209 BURSARY, 207 ANGLO AMERICAN CORPORATION OF SA MEDICAL GRADUATES' ASSOCIATION BURSARY, LIMITED BRIDGING PROGRAMME BURSARY. DIOCESE OF MARIANNHILL NATIONAL P 207 177 CATHOLIC BURSARY AND SCHOLARSHIP MER-NATIONAL BURSARY, 207 CSIR BURSARY (UNIVERSITY STUDY), 185 FUND, 188 Packaging PACKAGING INSTITUTE OF SA, 212 MIKE AND HANNAH AMOILS MEDICAL BURSARY DE BEERS GROUP VOCATIONAL SCHOLARSHIP, E.). LOMBARDI TRUST BURSARY. 190 FUND. 207 187 ELI LILLY BURSARY AND LOAN SCHEME. 191 Packaging and Printing MUSHET BURSARY, 208 EMANUEL JACOBSON BURSARY, 191 ESTHER TAYLOR AWARD, 192 FAR NORTH EDUCATION AND TRAINING TRUST N.J. DEAN BURSARY, 208 GENCOR BURSARY SCHEME. 194 Technology INSTITUTE OF PACKAGING BURSARY, 198 NATAL PROVINCIAL ADMINISTRATION BURSARY GOLD FIELDS OF SA LIMITED BURSARY, 195 LOAN, 192 FEDERALE VOLKSBELEGGINGS BEURS, 192 SCHEME, 209 ISCOR BURSARY LOAN, 199 Packaging Management GUY SUTTON MEMORIAL BURSARY. 196 NORISTAN BURSARY, 210 ICI LIMITED BURSARY, 200 SA BREWERIES BEER DIVISION BURSARY SCHEME. NORISTAN MEDICAL STUDY LOAN, 210 JOHANNESBURG CONSOLIDATED INVESTMENT HELEN SUZMAN/BRITISH GOVERNMENT 217 PETER AND SYDNEY DICKSON TRUST BURSARY, CO LTD au CATEGORY B BURSARY, 200 AWARDS, 197 HEXAGON TRUST BURSARY. 197 Painting 212 JOHANNESBURG CONSOLIDATED INVESTMENT PROVINCIAL ADMINISTRATION WESTERN CAPE CO LTD 'JOHNNIES' CATEGORY C BURSARY, ISCOR BURSARY LOAN, 199 G.P. CANITZ BURSARY, 194 MAGGIE LAUBSER LOCAL BURSARY, 205 BURSARY SCHEME, 214 200 J.W. DU PREEZ BURSARY. 199 RC DIOCESE OF KIMBERLEY BURSARY FUND, 21 5 PALABORA MINING COMPANY LTD BURSARY, JAN LEENDEROT ACHTERBERG BURSARY, 200 Parks and Recreation JOHANN C. LEIPOLDT MEMORIAL TRUST RED CROSS CALEDONIAN MARKET 212 SCHOLARSHIPS, 215 REX RUSHWORH LENNOX MEMORIAL FUND. 215 BURSARY, 200 Administration JOHANNES C. PIETERSE STUDY BURSARY. 200 COLIN GOHL SCHOLARSHIP FUND. 185 ROY BEAMISH BURSARY, 216 SASOL LTD BURSARY, 220 RUBY REEVES BURSARY, 216 KAGISO TRUST BURSARIES, 202 Performing Arts Mining Geology LEVI AND BESSIE JONES BURSARIES, 204 SERVIER BURSARY, 220 AMPLATS BURSARY SCHEME. 177 BASIL LE MAY BURSARY, 180 LION MATCH COMPANY BURSARY, 204 SMITH AND NEPHEW EDUCATIONAL TRUST ANGLOVAAL MINERALS BURSARY SCHEME, 177 MARGARET GIBSON BURSARY FUND. 205 Personnel Administration BURSARY. 221 RANDCOAL SERVICES BURSARY, 214 DEPARTMENT OF PUBLIC WORKS AND LAND STIGLINGH MEMORIAL BURSARY, 222 MAUDE CATHERINE BIRD MEMORIAL AFFAIRS BURSARY. 188 TETJE PATTISON BURSARIES. 223 Missionary Work SCHOLARSHIPS, 206 MAX AND WINNIE SALOMON MEMORIAL TILLY STAPPER TRUST (BURSARY). 223 NG KERK VAN GAUTENG-LENINGS/BEURSE, 210 Personnel Management TRANSVAAL PROVINCIAL ADMINISTRATION BURSARY. 206 DEPARTMENT OF PUBLIC WORKS AND LAND Municipal Administration MONSANTO BURSARY. 208 (TPA) BURSARY. 224 GREATER JOHANNESBURG TRANSITIONAL AFFAIRS BURSARY, 188 N.J. DEAN BURSARY. 208 METROPOLITAN COUNCIL (GJTMQ Metallurgical Engineering NATAL BUILDING SOCIETY BURSARY, 209 Pharmacy AMPLATS BURSARY SCHEME. I 77 BURSARY, 19S NATBEV/COCA-COLA BOTTLERS' TERTIARY BRUNEL BURSARY. 181 ANGLO AMERICAN CORPORATION GROUP Municipal fields of study EDUCATION, 209 DEANS BURSARY, 187 VOCATIONAL SCHOLARSHIPS, 177 ERMELO TOWN COUNCIL STUDY LOAN, 191 NATIONAL ECONOMIC EDUCATION TRUST DEPARTMENT OF CORRECTIONAL SERVICES ANGLO AMERICAN CORPORATION OF SA GREATER POTGIETERSRUS TRANSITIONAL MEET), 209 PUBLIC BURSARY SCHEME. 187 LIMITED BRIDGING PROGRAMME BURSARY, LOCAL COUNCIL STUDY LOAN, 195 ODA BURSARY/LOAN SCHEME. 211 ELI LILLY BURSARY AND LOAN SCHEME. 191 177 PHALABORWA TOWN COUNCIL BURSARY, 212 OLD MUTUAL ACTUARIAL BURSARY. 21 ELI LILY BURSARY, 191 ANGLOVAAL MINERALS BURSARY SCHEME, 177 RANDCOAL SERVICES BURSARY, 214 FOUNDATION FOR PHARMACEUTICAL ANGLOVAAL MINERALS TECHNIKON BURSARY Music SA DRIED FRUIT CO-OPERATION (EMPLOYEES' EDUCATION, 193 ABRAHAM AND OLGA LIPMAN FUND BURSARIES, SCHEME, 177 BURSARIES), 217 GAUTENG PROVINCIAL GOVERNMENT BURSARY. ARMSCOR BURSARY, 178 1 74 SA RESERVE BANK BURSARY, 218 194 ABRAHAM AND OLGA LIPMAN FUND ATOMIC ENERGY CORPORATION BURSARIES SA SUGAR INDUSTRY TRUST FUND, 218 GLAXO BURSARY, 195 SCHOLARSHIPS, 174 FOR UNIVERSITY STUDIES. I 78 SANDER AND LAURIE OSTROWIAK HELEN SUZMAN/BRITISH GOVERNMENT AFRIKAANSE MUSIEKKLUB - BEURS VIR BOART LONGYEAR BURSARY (BRIDGING SCHOLARSHIP. 219 AWARDS. 197 SCHEME), 180 KOMPOSISIE, 175 SCHUMANN-WENGEL BURSARY. 220 IDB SCHOLARSHIP TRUST BURSARY LOAN, 198 ANNA PRETORIUS BURSARY, 177 COLUMBUS STAINLESS STEEL BURSARY, IBS STELLA AND PAUL LOEWENSTEIN CHARITABLE JOHNSON AND JOHNSON 'PROFESSIONAL CSIR BURSARY (UNIVERSITY STUDY), 185 ANTON HARTMAN BURSARY. 177 AND EDUCATIONAL TRUST BURSARIES, 222 PRODUCTS' BURSARY, 201 ANTON HARTMAN TRUST BURSARIES, 178 GOLD FIELDS OF SA LIMITED BURSARY. 195 STIGLINGH MEMORIAL BURSARY, 222 LAURENCE DAVID ADLER BURSARY, 203 CHRISTMAS STUDY BURSARY, 184 HIGHVELD STEEL AND VANADIUM CORP LTD TEACHERS' ASSOCIATION OF TRANSVAAL MEDICAL EDUCATION FOR SA BLACKS (MESABI BURSARY, 197 EDDIE LEVITZ BURSARY. 190 SECONDARY SCHOOLS BURSARY, 223 BURSARY, 207 ELLEN DANIELL BURSARY, 191 HIGHVELD STEEL AND VANADIUM CORP LTD W.K. KELLOGG FOUNDATION BURSARIES, 225 MEDICAL GRADUATES' ASSOCIATION BURSARY. BURSARY (TECHNIKON), 197 ESTER MENTZ BURSARY, 192 WARNER LAMBERT BURSARY. 226 207 ISCOR BURSARY LOAN, 199 FAR BEURS, 192 NATAL PROVINCIAL ADMINISTRATION BURSARY /CI LIMITED BURSARY, 200 FAX MUSIEKBEURSE. 192 Nature Conservation SCHEME. 209 JOHANNESBURG CONSOLIDATED INVESTMENT FAK UNIVERSITEIT VAN DIE OVS-MUSIEKBEURS, BOB BLUNDELL MEMORIAL BURSARY, 180 PHARMACEUTICAL SOCIETY BURSARIES, 213 CO LTD OCI) CATEGORY B BURSARY, 200 192 BOB BLUNDELL MEMORIAL SCHOLARSHIP. 180 PROVINCIAL ADMINISTRATION WESTERN CAPE JOHANNESBURG CONSOLIDATED INVESTMENT FAK UNIVERSITEIT VAN PRETORIA-BEURSE, 192 COLIN GOHL SCHOLARSHIP FUND. 185 BURSARY SCHEME, 214 CO LTD 'JOHNNIES' CATEGORY C BURSARY, FLORENCE VAN DER BIJL MUSIC BURSARY (IN FRED BOUSFIELD MOSS BLUNDELL MEMORIAL SAMST BURSARY/LOAN, 2)9 200 CORPORATION WITH THE MARTHA SCHOLARSHIP, 194 SERVIER BURSARY, 220 MINTEK BURSARY, 207 WASHINGTON CLUB), 193 Nederlandse Kultuurgeskiedenis TRANSFARM BURSARY, 223 SA INSTITUTE OF FOUNDRYMEN SPONSORSHIP, J.C. COETZEE BURSARY FOR ECCLESIASTICAL VAN EWIJCK FOUNDATION MERIT BURSARIES. TRANSVAAL PROVINCIAL ADMINISTRATION ORGAN MUSIC, 199 217 225 (TPA) BURSARY. 224 SASOL LTD BURSARY, 220 J.L.M. FRANKEN BURSARY, 199 Nederlandse Taal en Letterkunde W.K. KELLOGG FOUNDATION BURSARIES. 225 SEIFSA UNIVERSITY SCHOLARSHIP, 220 KATHLEEN ALISTER HARP SCHOLARSHIP, 202 WARNER LAMBERT BURSARY, 226 LEOPOLD PREMYSLAV BURSARY, 203 VAN EWIJCK FOUNDATION MERIT BURSARIES. Metallurgy MABEL QUICK BURSARY, 20S 225 Philosophy ARMSCOR BURSARY FOR TECHNIKON STUDY, MYRA CHAPMAN EDUCATIONAL TRUST ANNEMARIE BASSON BURSARY, 177 178 Nuclear Medicine (BURSARY). 208 BARNEY BLIEDEN BURSARIES. 179 Physical Chemistry CSIR BURSARY. 185 NG KERK (00S-KAAP) BEURSE. 210 MINTEK BURSARY, 207 CYANAMID BURSARY SCHEME. 186 OLIVE TAYLOR BURSARIES, 211 Nursing OE BEERS GROUP VOCATIONAL SCHOLARSHIP, PRETORIUM TRUST BURSARY, 213 ELI LILLY BURSARY AND LOAN SCHEME. 191 Physical Metallurgy 187 PU VIR CHO FAK MUSIEKBEURS. 214 HELEN SUZMAN/FIFOTISH GOVERNMENT DE BEERS INDUSTRIAL DIAMOND DIVISION )PTY) DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) SAMRO BURSARIES FOR GENERAL MUSIC STUDY AWARDS. 197 LTD BURSARY (UNIVERSITIES). 187 LTD BURSARY (UNIVERSITIES). 187 IN SOUTHERN AFRICA, 219 LAURENCE DAVID ADLER BURSARY. 203 GENCOR BURSARY SCHEME, 194 HAGGIE BURSARY, 196 SAMRO BURSARIES FOR SCHOOL MUSIC MEDICAL EDUCATION FOR SA BLACKS (MESABI MINTEK BURSARY. 207 ISCOR BURSARIES FOR TECHNIKONITECHNICAL TEACHING IN SOUTHERN AFRICA, 219 BURSARY. 207 Physics COLLEGE AND UNIVERSITY STUDIES, 198 SAMRO'S INTERMEDIATE BURSARIES FOR MEDICAL GRADUATES' ASSOCIATION BURSARY, A. TREVOR WILLIAMS SCHOLARSHIP, 174 NAMDEB DIAMOND CORPORATION (PTY) LTD. COMPOSITION STUDY IN SOUTHERN 207 A.W. SCHUMANN BURSARY. 174 208 AFRICA. 219 ROTARY CLUB OF CAPE TOWN BURSARY. 216 ARMSCOR BURSARY. I 78 PALABORA MINING COMPANY LTD BURSARY. SHULTON MUSIC BURSARY, 220 ATOMIC ENERGY CORPORATION BURSARIES 212 Nutrition STELLENBOSCH BOERE-ORKES-BEURS. 222 MEDICAL EDUCATION FOR SA BLACKS (MESABI FOR UNIVERSITY STUDIES. 178 RICHARDS BAY MINERALS BURSARIES (FOR US-VROUEVERENIGING BEURS, 225 BURSARY. 207 CHARLES PELTERET EDUCATIONAL TRUST, 184 UNIVERSITY STUDY). 25 VERENIGING VIR VOLKSANG EN MUSIEK-BEURS. COUNCIL FOR MINERAL TECHNOLOGY SEIFSA TECHNIKON BURSARY, 220 225 UNDERGRADUATE BURSARY, 185 Microbiology BEST COPY AVAILABLE 248 233 larcriot% CSIR BURSARY (UNIVERSITY STUDY), 185 J.C. BITCON FOUNDATION BURSARIES, 199 NORAH TAYLOR BURSARY, 210 SAREL AND GERTIE VISSER TRUST FUND D.G. MURRAY TRUST BURSARY FUND (EASTERN ROBT. B. VILJOEN LOAN, 216 Structural Engineering (BURSARIES AND LOANS). 220 CAPE), 186 SIDNEY JACOBZ BURSARY FUND, 220 SANLAM PROPERTIES BURSARY, 219 D.C. MURRAY TRUST BURSARY FUND (WESTERN R SMITH EDUCATION FUND, 221 CAPE). 186 Radio Work Surveying THEOLOGICAL STUDENTS PROVIDENT FUND DAVID KIBBEY TAYLOR MEMORIAL BURSARY, NORAH.TAYLOR BURSARY. 210 DEPARTMENT OF WATER AFFAIRS AND (LOAN), 223 186 FORESTRY BURSARY / SCHOLARSHIP, 188 THEOLOGICAL TRAINING FUND (NEDERDUITCH DE BEERS INDUSTRIAL DIAMOND DIVISION (PTY) Radiography ITESSA BURSARY, 199 HERVORMDE KERK VAN AFRIKA), 223 LTD BURSARY (UNIVERSITIES), 187 NATAL PROVINCIAL ADMINISTRATION BURSARY NAMDEB DIAMOND CORPORATION (PTV) LTD, WILHELMINA DU TOIT NYBOER BURSARY, 226 DEPARTMENT OF WATER AFFAIRS AND SCHEME, 209 208 Town and Regional Planning PLATO DEVELOPMENT FUND BURSARY, 213 FORESTRY BURSARY / SCHOLARSHIP, 188 Retail Business Management CAPE TOWN CITY BURSARY LOAN SCHEME, 183 SA COUNCIL FOR PROFESSIONAL LAND GENCOR BURSARY SCHEME, 194 CALTEX OIL (SA) BURSARY, 182 DURBAN CITY COUNCIL LOANS, 189 SURVEYORS AND TECHNICAL SURVEYORS ISCOR BURSARY LOAN, 199 GREATER JOHANNESBURG TRANSITIONAL MINTEK BURSARY. 207 Roman Languages (BURSARIES FOR TECHNIKON STUDY), 217 ADRIAAN ELFERINK BURSARY. 175 METROPOLITAN COUNCIL (GJTMC) RAND CARBIDE LIMITED BURSARY, 214 T BURSARY, 195 S Physiotherapy Taxation J.C. BITCON FOUNDATION BURSARIES, 199 GAUTENG PROVINCIAL GOVERNMENT BURSARY. School Music KIRKNESS SCHOLARSHIP. 202 194 GENBEL-STUDIETRUST BURSARY LOANS FOR PORT ELIZABETH CITY COUNCIL BURSARIES, SAMRO BURSARIES FOR SCHOOL MUSIC B.COM. STUDENTS. 194 213 GEORGE HIBBERT SCHOLARSHIP IN TEACHING IN SOUTHERN AFRICA. 219 PHYSIOTHERAPY, 195 Teacher Training Science Town Planning GOLD FIELDS OF SA LIMITED BURSARY, 195 KAGISO TRUST BURSARIES, 202 GARDEN CITIES BURSARY. 194 HELEN SUZMAN/BRITISH GOVERNMENT JOHANN G. LEIPOLDT MEMORIAL TRUST AWARDS, 197 BURSARY, 200 Teaching Traffic Engineering NORAH TAYLOR BURSARY, 210 JEANETTE GOLDMAN TRUST BURSARY, 200 Sciences CAPE TOWN CITY BURSARY LOAN SCHEME. 183 MEDICAL EDUCATION FOR SA BLACKS (MESAB) ROUND TABLE BURSARY FUND (UNIVERSITY OF FUNDANI TRUST, 194 THE WESTERN CAPE), 216 Transport Economics BURSARY, 207 RC DIOCESE OF KIMBERLEY BURSARY FUND. 215 TRANSVAAL ASSOCIATION OF TEACHERS BOPHUTHATSWANA TRANSPORT HOLDINGS MEDICAL GRADUATES' ASSOCIATION BURSARY, SA INSTITUTE OF RACE RELATIONS (SAIRR) LOAN/BURSARY, 224 (8TH) BURSARY, 181 207 BURSARIES, 217 CLOVER SA BURSARY SCHEME, 184 NATAL PROVINCIAL ADMINISTRATION BURSARY Technical JOHANNESBURG TRANSPORT DIVISION UM) SCHEME, 209 Secretarial Studies BOPHUTHATSWANA MPUDULOLE BURSARY AID JOHANNESBURG MUNICIPALITY BURSARY, NSB EDUCATIONAL TRUST. 211 PROVINCIAL ADMINISTRATION WESTERN CAPE FUND, 181 201 BURSARY SCHEME, 214 Singing D.G. MURRAY TRUST BURSARY FUND (EASTERN JOSEPH JOWELL BURSARY. 201 SAMST BURSARY/LOAN. 219 ESTER MENU BURSARY, 192 CAPE), 186 RAU DEPARTMENT OF TRANSPORT ECONOMICS TRANSVAAL PROVINCIAL ADMINISTRATION HILDA HENDRIKZ BURSARY, 197 DIOCESE OF MARIANNHILL NATIONAL BURSARY, 215 (TPA) BURSARY. 224 MABEL QUICK BURSARY, 205 CATHOLIC BURSARY AND SCHOLARSHIP TRANSNET BURSARY, 223 WORKMEN'S ACCIDENT AND REHABILITATION MIEN HAMMERSMA BURSARY FOR SINGING, 207 FUND, 188 TRANSPORT TECHNICAL INDUSTRIES (PTY) LTD CENTRE BURSARY - DURBAN, 227 Social Science FUNDANI TRUST, 194 (TTI) BURSARY, 224 Plant Pathology HEXAGON TRUST BURSARY, 197 UNITRANS LTD BURSARY, 224 OVERBEEK TRUST, 212 RC DIOCESE OF KIMBERLEY BURSARY FUND, 215 AGRIHOLD BURSARIES, 175 RANDCOAL SERVICES BURSARY, 214 SA INSTITUTE OF RACE RELATIONS (SAIRR) Transport Engineering CIBA BURSARY. 184 BURSARIES, 217 STANWAY EDWARDS NCOMANE GROUP OUTSPAN BURSARY. 212 Social Work BURSARY, 221 Plastics Technology A.P. LUBBE BURSARY, 174 Technical Education AGRICOR BURSARY, 175 NATIONAL ECONOMIC EDUCATION TRUST Transport Logistics PLASTICS INDUSTRY TRAINING BOARD AV808 MUTUAL INSURANCE SOCIETY BURSARY, (NEET), 209 TRANSNET BURSARY, 223 BURSARY, 213 179 V Polimer Science BENADE/WOMAN'S ASSOCIATION BURSARY, 180 Theology A.H. HESSEL BURSARY FUND, 174 POLIFIN BURSARY SCHEME. 213 B'NAI B'RITH JOHANNESBURG LODGE AND Veterinary Science A.J.M. STEPHANSEN BURSARY LOAN SCHEME, CHAPTER LILLIENFIELD BURSARY, 179 AGRICOR BURSARY, 175 Production I 74 CHILDREN'S FOUNDATION BURSARY, 184 BOB BLUNDELL TRUST (SIR ARNOLD THEILER ISCOR BURSARIES FOR TECHNIKON/TECHNICAL ALETTA VORSTER BURSARY, 176 DEPARTMENT OF CORRECTIONAL SERVICES MEMORIAL BURSARY), 181 COLLEGE AND UNIVERSITY STUDIES, 198 BARS BEYLEVELD BURSARY, 179 PUBLIC BURSARY SCHEME, 187 DUNCAN HUTCHEON BURSARY, 189 BEURSFONDS TEOLOGIESE STUDIE VAN DIE NG Production Engineering DEPARTMENT OF HEALTH BURSARY, 188 HELENA JOOSTE UNDERGRADUATE BURSARY, KERK VAN DIE OVS, 180 DENYS S. WAUGH BURSARY. 187 DORFLING BURSARY, 188 197 BURSARY FUND FOR THEOLOGICAL STUDENTS, DON TILLEY BURSARY. 188 DUNVEGAN AND GLENDOWER RESIDENTS AND IDB SCHOLARSHIP TRUST BURSARY LOAN, 198 182 Production Management RATEPAYERS ASSOCIATION BURSARY, 189 LATE G.A. NIVEN TRUST VETERINARY BURSARY, E.O. BAXTER BURSARY, 190 C.H.E. BURSARY. 182 203 SA BREWERIES BEER DIVISION BURSARY SCHEME. CHARL ERASMUS BURSARY, 184 GOLDSMITH AND PAPENFUS BURSARY, 195 LUTHER FIELD VETERINARY TRUST (BURSARY). 217 HELEN SUZMAN/BRITISH GOVERNMENT CORNELIUS AND LEA GROBLER THEOLOGICAL 204 Psychology AWARDS, 197 FUND. 185 D.N.G. KOTZE BURSARY FOR THEOLOGY. 186 Viticulture GREATER JOHANNESBURG TRANSITIONAL HOFMEYR AND DE VOS BURSARY, 197 D.P. PONGRACZ SCHOLARSHIP TRUST, 186 METROPOLITAN COUNCIL (GJTMC) JACK MINCER BURSARY, 199 DARN MARAIS BURSARY, 186 DR AND MRS N. SIEBERHAGEN BURSARY, 189 KWV UNDERGRADUATE BURSARY, 203 BURSARY, 195 JOHANN G. LEIPOLDT MEMORIAL TRUST PEROLD-STEINER BURSARY LOAN SCHMEME, HERMAN KRIGE BURSARY. 197 BURSARY, 200 EMIL KOYANIC BURSARY, 191 KACISO TRUST BURSARIES, 202 F.S. AND R.E. MALAN BURSARY, 192 212 Public Administration MUSHET BURSARY, 208 FELIX AND CHRISTINE GUT BURSARY LOAN. 193 GREATER JOHANNESBURG TRANSITIONAL w NEDERDUITSCH HERVORMDE FRANS EN RYKIE THERON BURSARY. 193 METROPOLITAN COUNCIL (GJTMC) SUSTERVERENIGING (NHSV) STUDY LOAN GERT AND CATHARINA SWANEPOEL Water Care BURSARY, 195 FOR SOCIAL WORK, 210 THEOLOGICAL FUND, 195 DEPARTMENT OF WATER AFFAIRS AND SA INSTITUTE OF RACE RELATIONS ISAIRR) NG KERK VAN GAUTENG - LENINGS /BEURSE, 210 GRAHAMSTOWN TRAINING COLLEGE FORESTRY BURSARY / SCHOLARSHIP, 188 BURSARIES, 217 ROTARY CLUB OF CAPE TOWN BURSARY, 216 SCHOLARSHIP, 195 Water Environment Studies Public Health ROTARY STUDENT FUND, 216 H.J. BRUWER BURSARY, 196 HAMEL BURSARY, 196 DEPARTMENT OF WATER AFFAIRS AND AGRICOR BURSARY. 175 SOCIAL WORK BURSARY, 221 HANSIE BOTHA STUDY BURSARY FUND (LOAN), FORESTRY BURSARY / SCHOLARSHIP, 188 GREATER JOHANNESBURG TRANSITIONAL TURKSTRA BURSARY, 224 METROPOLITAN COUNCIL (GJTMC) VAN ENTER KRYNAUW BURSARY FUND, 225 196 Weed Science HOFMEYR AND DE VOS BURSARY, 197 BURSARY, 195 WOMEN'S AND MOTHER'S MOVEMENT ATKV AGRIHOLD BURSARIES, 175 (SAR & H) JOHANNESBURG BURSARY, 227 HOPEFIELD AND KUILSRIVER CONGREGATIONS Pulp and Paper Science BURSARY, 198 Wildlife Management SABIE BOSFEESKOMITEE-BEURS, 218 Sociology IMMANUEL BURSARY, 198 BOB BLUNDELL MEMORIAL SCHOLARSHIP. 180 Purchasing Management B.L. STEYN, 179 J.G. MEIRING BURSARY FUND, 199 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL FENELLA LEVY MEMORIAL BURSARY. 193 JAN THOMAS MARTENS BURSARY, 200 SCHOLARSHIP. 194 GENCOR BURSARY SCHEME, 194 MUSHET BURSARY, 208 JOHANN C. LEIPOLDT MEMORIAL TRUST TRANSNET BURSARY. 223 Wood Science Soil and Water Conservation BURSARY, 200 A.C. TINGLE MEMORIAL BURSARY. 174 Q ALBERT ELLMER BURSARY, 176 JOHANNES C. PIETERSE STUDY BURSARY, 200 SABIE BOSFEESKOMITEE - BEURS, 218 Quantity Surveying KAS VIR TEOLOGIESE STUDENTE-BEURSE, 202 SALMA BURSARIES (FOR UNIVERSITY STUDY), Speech and Hearing Therapy KWEEKSKOOL BEURSE EN LENINGS, 203 219 ASSOCIATION OF SA QUANTITY SURVEYORS ALAN B. CLEMONS BURSARY, 176 LUKAS HAVENGA BURSARY, 204 SOL MOSHAL BURSARY, 221 STUDENT LOAN SCHEME. 178 HELEN SUZMAN/BRITISH GOVERNMENT MAGDALENA GRUNDLINC TRUST, 205 C.P. DE LEEUW BURSARY, 182 AWARDS, 197 NED GEREF GEMEENTE KUILSRIVIER BEURS, 210 Wood Technology CAPE TOWN CITY BURSARY LOAN SCHEME. 183 RED CROSS CALEDONIAN MARKET NG KERK VAN GAUTENG-LENINGS/BEURSE. 210 SABIE BOSFEESKOMITEE-BEURS, 218 CONCOR CONSTRUCTION BURSARY, 185 SCHOLARSHIPS. 215 NG KERK-BEURS, 210 z DEPARTMENT OF PUBLIC WORKS AND LAND Speech Therapy PETRUSBURG THEOLOGICAL STUDY FUND, 212 AFFAIRS BURSARY, 188 Zoology DORINDA KOK BURSARY, 188 PRESBYTERIAN CHURCH OF SOUTHERN AFRICA. GARDEN CITIES BURSARY, 194 BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 GAUTENG PROVINCIAL GOVERNMENT BURSARY, 213 GENREC CONSTRUCTION BURSARY SCHEME. DEPARTMENT OF WATER AFFAIRS AND 194 RANDU DURAND THEOLOGY BURSARY, 214 194 FORESTRY BURSARY / SCHOLARSHIP, 188 MYRTLE L. ARON BURSARY, 208 REGINALD N. DRYDEN BURSARIES. 215 COLD FIELDS OF SA LIMITED BURSARY, 195 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL PROVINCIAL ADMINISTRATION WESTERN CAPE ROTARY SEA POINT BURSARY, 216 GREATER JOHANNESBURG TRANSITIONAL SCHOLARSHIP. 194 BURSARY SCHEME, 214 CILLIERS BURSARY, 216 METROPOLITAN COUNCIL (GJTMC) SAADAKKER BURSARY, 218 S.P. GREEN BURSARY, 216 BURSARY, 195 Speech Training 249 Bursaries AGRICULTURAL RESEARCH COUNCIL (ARC) NECMANK STUDENT LOAN SCHEME, 210 NORTH WEST GOVERNMENT BURSARIES. 211 PRESTIGE BURSARIES, 175 NUB EDUCATIONAL TRUST, 211 NORTHERN CAPE AGRICULTURAL UNION BURSARY (VISAGIE/mORELIG TRUST). 211 Index According ALEC BROOK BURSARY, 176 PALABORA MINING COMPANY LTD BURSARY, ALUED BANK STUDENT LOANS, 143 212 OK BAZAARS BURSARY, 159 ANGLOVAAL MINERALS TECHNIKON BURSARY PIETERSBURG /POLOKWANE TRANSITIONAL PAUL ROOS GYMNASIUM (PRG) BURSARY. 160. to Institution SCHEME. 177 LOCAL COUNCIL, 161 161 PHALABORWA TOWN COUNCIL BURSARY, 212 A ARMSCOR BURSARY FOR TECHNIKON STUDY, PORT ELIZABETH CITY COUNCIL BURSARIES, 178 213 PHILIP NEL MEMORIAL FUND BURSARY, 161 PRESBYTERIAN CHURCH OF SOUTHERN AFRICA, Any agricultural college ASSOCIATION OF MUNICIPAL ELECTRICITY PREMIER FOOD INDUSTRIES LTD BURSARY, 161 ADAM BARNARD AGRICULTURAL STUDY FUND. UNDERTAKINGS (SA) BURSARY, 178 PRETORIA CITY COUNCIL FULL-TIME BURSARY 213 174 B.G. HEYDENRYCH BURSARY. 179 SCHEME, 213 CRIEENSBURGH MUNICIPAL BURSARY, 163 KIMBERLEY AND KURUMAN DIOCESAN BURSARY BASIL LE MAY BURSARY, 180 PRINSLOO- WOLMARANS STUDY FUND (LOAN). RENIER VAN ROOYEN BURSARY FUND, 164 FUND. 155 BETHAL TOWN COUNCIL STUDY LOAN, 144 162 SA JEWISH BOARD OF DEPUTIES BURSARY CO- NATIONAL ECONOMIC EDUCATION TRUST BURSARY SCHEME FOR PERSONS WITH PUBLIC SERVICE BURSARY SCHEME. 214 ORDINATING COMMITTEE BURSARY, 165 SA NATIONAL COUNCIL FOR THE BLIND (NEET), 209 DISABILITIES, 182 RANDFONTEIN TOWN COUNCIL BURSARY BURSARY FUND, 165 STANDARD BANK LOAN, 166 BURSARY SCHEME OF TRANSITIONAL LOCAL LOANS, 163 Any college COUNCIL OF GREATER GERMISTON, 145 RC DIOCESE OF KIMBERLEY BURSARY FUND. 215 SA RESERVE HANK BURSARY. 218 CALTEX OIL (SA) BURSARY, 182 ROODEPOORT MUNICIPALITY BURSARY LOAN, SA SUGAR INDUSTRY TRUST FUND, 218 ALLIED BANK STUDENT LOANS. 143 SACTwu BURSARY FUND, 165 BASIL LE MAY BURSARY, 180 CAPE TIMES BURSARY FUND. 145 216 ROTARY CLUB OF BELLVILLE BURSARY, 164 SAMRO BURSARIES FOR GENERAL MUSIC STUDY BURSARY SCHEME FOR PERSONS WITH CAPE TOWN CITY BURSARY LOAN SCHEME. 183 CENTRAL COUNCIL OF LAND SURVEYORS SA BLIND WORKERS ORGANISATION BURSARy, IN SOUTHERN AFRICA. 219 DISABILITIES, 182 SAMRO BURSARIES FOR SCHOOL MUSIC COMMUNITY PRESTIGE BURSARY FUND. 147 BURSARY (CCLS). 183 164 SA BREWERIES BEER DIVISION BURSARY SCHEME, TEACHING IN SOUTHERN AFRICA, 219 DIOCESE OF WITBANK BURSARY. 148 CLOVER SA BURSARY SCHEME. 184 217 SATS 'GENERAL BOTHA' OLD BOYS' EAST LONDON MUNICIPAL BURSARY. 190 COCA-COLA BURSARY, 146 SA INSTITUTE OF ELECTRICAL ENGINEERS ASSOCIATION WAR MEMORIAL FUND EDENVALE JUBILEE BURSARY FUND, 149 COROBRIK POST-MATRICULATION BURSARY, 147 BURSARY SCHEME, 217 BURSARY, 220 GRAHAMSTOwN CITY BURSARY, 151 SIMON BEKKER MEMORIAL FUND (LOANS). 166 CSIR BURSARY, 185 SA INSTITUTE OF FOUNDRYMEN SPONSORSHIP, GREATER LOUIS TRICHARDT TRANSITIONAL SPRINGS CITY COUNCIL BURSARY LOANS, 166 LOCAL COUNCIL BURSARY LOAN SCHEME. D.G. MURRAY TRUST BURSARY FUND (EASTERN 217 SA INSTITUTE OF RACE RELATIONS (SAIRR) STANDARD BANK GROUP BURSARY AND 151 CAPE), 186 BURSARIES. 217 EDUCATIONAL ASSISTANCE SCHEME, 221 HOME ECONOMICS ASSOCIATION OF D.G. MURRAY TRUST BURSARY FUND (WESTERN SA INSTITUTION OF MECHANICAL ENGINEERING STANWAY EDWARDS NGOMANE GROUP SOUTHERN AFRICA BURSARY (HEASA), 198 CAPE). 186 BURSARY, 221 KwA-OUKUZA/STANGER TRANSITIONAL LOCAL DE BEERS INDUSTRIAL DIAMOND DIVISION (wry) MERIT AWARDS, 217 SA ORT BURSARY TRUST, 218 TED AND MABEL EVERITT BLIRSARy, 168 COUNCIL, 203 LTD BURSAR), (TECHNIKONS). 187 SA SCHOLARSHIP PROGRAMME, 218 TERTIARY EDUCATION FUND OF SA (TEFSA) mAviS WAKEFORD BURSARY. 206 DENEL INFOPLAN BURSARY, 187 DEPARTMENT OF WATER AFFAIRS AND SA STUDENTS EDUCATION TRUST BURSARY LOAN SCHEME, 168 NATIONAL STATE/INDEPENDENT STATE TRANSVAAL% ONDERWYSERSVERENIGING (SA FORESTRY BURSARY / SCHOLARSHIP. 188 (SASET), 218 BURSARY LOANS, 209 ONTWIKKELINGSTIGTING BEURS- EN DIOCESE OF RUSTENBURG BURSARY, 148 SAAmBOU BURSARY FUND, 165 RANDFONTEIN TOWN COUNCIL BURSARY LENINGSFONDS), 168 DIOCESE OF WITBANK BURSARY, 148 SANLAM BURSARY FOR TECHNIKON STUDENTS. LOANS, 163 UBUNTU PROGRAMME STUDY FACILITATION RC DIOCESE OF KIMBERLEY BURSARY FUND, 215 DORBYL LIGHT AND GENERAL ENGINEERING 219 SANLAM PROPERTIES BURSARY. 219 FUND, 224 ROTARY CLUB OF BELLVILLE BURSARY, 164 (TECHNIKON). 188 SEA PLANT WELFARE TRUST BURSARY. 165 VORSTER VAN DER MERWE EDUCATION FUND SEA PLANT WELFARE TRUST BURSARY, 165 DR T.E. DIT(4)NGES BURSARIES, 148 DUNVEGAN AND GLENDOWER RESIDENTS AND SEIFSA TECHNIKON BURSARY. 220 (LOANS), 171 SOLLY GINWALA MEMORIAL TRUST BURSARY, WESLEY FRANCIS MEMORIAL MASONIC RATEPAYERS ASSOCIATION BURSARY, 189 SPOORNET, 221 221 EDUCATION FUND (SCHOLARSHIP), 171 EAST LONDON MUNICIPAL BURSARY, 190 STANDARD BANK LOAN, 166 WESTONARIA BURSARY LOAN FUND, 226 Any college of education EDENVALE JUBILEE BURSARY FUND. 149 STANDARD BANK SCHOLARSHIP SCHEME. 221 WILLIAM PESCOD ELLEN CARTER FUND, 171 1820 SETTLERS' ASSOCIATION BURSARY, 174 ESKOM TECHNIKON BURSARY, 191 STEWART SCOTT BURSARY, 222 ZERROA STEYN LOAN FUND, 173 BEDFORDVIEW BURSARY SCHEME, 144 EVANGELICAL LUTHERAN CHURCH IN SA STUDIETRUST BURSARY, 222 CAPE TIMES BURSARY FUND, 145 BURSARY, 149 TELKOM SA (LTD) BURSARY AND STUDY AID Any university DIOCESE OF RUSTENBURG BURSARY, 148 FIRST NATIONAL BANK UNIVERSITY AND SCHEME (ALL REGIONS). 223 1820SETTLERS' ASSOCIATION BURSARY, 174 GERALD WRIGHT SCHOLARSHIP, 195 TECHNIKON SCHOLARSHIP, 150 THE COMPUTER SCHOOL BURSARIES. 168 ACTUARIAL SCIENCE BURSARIES. 174 KING SOLOMON MAPHUMZANA BURSARY FUND. FREE STATE PROVINCIAL GOVERNMENT TRANSNET BURSARY. 223 ADAM BARNARD AGRICULTURAL STUDY FUND. 155 BURSARY, 194 TRANSVAAL HELPMEKAAR STUDY FUND (LOAN 174 REiGER PARK BURSARY LOAN FUND, 163 FUNDANI TRUST. 194 FOR TECHNIKON AND UNIVERSITY STUDY). AEC! LTD BURSARY, 175 SA INSTITUTE OF RACE RELATIONS (SAIRR) CENCOR BURSARY SCHEME, 194 168 AFRICON BURSARY, 175 BURSARIES. 217 GENREC CONSTRUCTION BURSARY SCHEME, TRANSVAAL INTER-CONSTITUTIONAL MASONIC AGRICULTURAL RESEARCH COUNCIL (ARC) vEREENIGING KOPANONG CITY COUNCIL STUDY 194 CHARITY LOAN, 224 ORDINARY BURSARIES. 175 LOAN SCHEME, I 70 GILLETE SA LTD BURSARY, 151 TRUST BANK STUDENT LOANS, 168 AGRICULTURAL RESEARCH COUNCIL (ARC) WESTERN CAPE EDUCATION DEPARTMENT GRAHAMSTOWN CITY BURSARY, 151 UNITED BANK STUDENT LOANS, 159 PRESTIGE BURSARIES, 175 BURSARIES, 226 GREATER JOHANNESBURG TRANSITIONAL VEREENIGING KOPANONG CITY COUNCIL STUDY AGRIHOLD BURSARIES, 175 Any medical institution METROPOLITAN COUNCIL (OITMC) LOAN SCHEME. 170 ALEC BROOK BURSARY, 176 VETERANS BURSARY FUND. 170 EVANGELICAL PRESBYTERIAN CHURCH IN SA BURSARY. 195 ALLIED BANK STUDENT LOANS, 143 VODACOM BURSARY SCHEME, 225 BURSARY/LOAN, 192 GREATER LOUIS TRICHARDT TRANSITIONAL AMEU (ASSOCIATION OF MUNICIPAL LOCAL COUNCIL BURSARY LOAN SCHEME. VOLKSKAS STUDENT LOANS. I 71 ELECTRICITY UNDERTAKINGS OF SA) Any nursing college 151 VOLKSWAGEN BURSARY, 225 STUDENT ASSISTANCE SCHEME. I77 KIMBERLEY AND KURUMAN DIOCESAN BURSARY GROUP FIVE ROADS SAVAGE AND LOVEMORE WESTERN CAPE EDUCATION DEPARTMENT ANGLO AMERICAN CORPORATION GROUP FuND, 155 BURSARY FOR TECHNIKON STUDY, 196 BURSARIES, 226 VOCATIONAL SCHOLARSHIPS, I 77 Any pharmacy training institution HAGGLE BURSARY. 196 YVONNE PARFITT BURSARIES TRUST, I 72 ANGLO AMERICAN CORPORATION OPEN FOUNDATION FOR PHARMACEUTICAL HEXAGON TRUST BURSARY, 197 Any tertiary institution SCHOLARSHIP, 143 177 EDUCATION. 193 HNR COMPUTERS BURSARY FuND, 197 ABSA BANKING GROUP (LOANS), 142 ANGLOVAAL MINERALS BURSARY SCHEME, HOME ECONOMICS ASSOCIATION OF AGAR HAMILTON TRUST BURSARY, 142 ARMSCOR BURSARY,178 Any teachers training college SOUTHERN AFRICA BURSARY (HEASA), 198 ASSOCIATION OF MUNICIPAL ELECTRICITY D.G. MURRAY TRUST BURSARY FUND (EASTERN AGGREY FUND, 142 IAN FRASER MEMORIAL BURSARY FUND AGRICOR BURSARY, 175 UNDERTAKINGS (SA) BURSARY, 178 CAPE). 186 (BURSARIES FOR THE BLIND), 152 ALIGARH OLD BOYS SCHOLARSHIP TRUST, 142 ATOMIC ENERGY CORPORATION BURSARIES KIMBERLEY AND KURUMAN DIOCESAN BURSARY INDIAN CENTENARY SCHOLARSHIP TRUST AMPLATS BURSARY SCHEME. 1 77 FOR UNIVERSITY STUDIES.178 FUND. 155 LOAN/BURSARY, 153 B.SM AND HC GOLDSTEIN BURSARY, 144 KRUGERSDORP TOWN COUNCIL BURSARY LOAN. ATKV STUDY LOAN, 144 INSTITUTION OF CERTIFICATED MECHANICAL ATKV STUDY LOAN FOR PART-TIME STUDY, B.G. HEYDENRYCH BURSARY, 179 156 AND ELECTRICAL ENGINEERS BURSARY, 198 178 B.SC. CIVIL ENGINEERING BURSARIES, 179 LESLIE HILL HIGHER EDUCATION TRUST, 203 ISCOR BURSARIES FOR TECHNIKON/TECHNICAL BRAKPAN TOWN COUNCIL BURSARY LOANS FOR BABETTE TAUTE BURSARIES. 179 STUDIETRUST BURSARY, 222 COLLEGE AND UNIVERSITY STUDIES. 198 TERTIARY STUDY. 145 BASIL LE MAY BURSARY,ISO TRANSVAAL INTER-CONSTITUTIONAL MASONIC ISCOR BURSARY LOAN, 199 CALTEX CORPORATE BURSARY, 182 BEDFORDVIEW BURSARY SCHEME.144 CHARITY LOAN, 224 J.E. CONRADIE LOAN, 199 CARLETONVILLE TOWN COUNCIL STUDY LOAN, BETHAL TOWN COUNCIL STUDY LOAN. 144 TRUST BANK STUDENT LOANS, 168 JACK PALMER EDUCATION TRUST BURSARY. 154 BONA PEOPLE'S FUND, 144 UNITED BANK STUDENT LOANS. 169 183 (CI LIMITED BURSARY. 200 CATHOLIC EDUCATIONAL AID PROGRAMME BURSARY SCHEME FOR PERSONS WITH VETERANS BURSARY FUND, 170 JEFFARES AND GREEN. CONSULTING ENGINEERS BURSARY. 183 DISABILITIES, 182 VOLKSKAS STUDENT LOANS. 171 BURSARY SCHEME, 200 CENTURION TOWN COUNCIL BURSARY, 183 BURSARY SCHEME OF TRANSITIONAL LOCAL Any technical college JOHANN G. LEIPOLDT MEMORIAL TRUST CHT PEPLER TRUST/MOLLER BURSARIES, 146 COUNCIL OF GREATER GERMISTON, (45 BURSARY SCHEME OF TRANSITIONAL LOCAL BURSARY, 200 DENYS S. WAUGH BURSARY, 187 CAPE TIMES BURSARY FUND, 145 COUNCIL OF GREATER GERMISTON. 145 JOHNSON AND JOHNSON BURSARY. 201 DEPARTMENT OF EDUCATION BURSARY, 187 CAPE TOWN CITY BURSARY LOAN SCHEME, 183 D.G. MURRAY TRUST BURSARY FUND (EASTERN JOSSIE ACKERMANN LOAN. 201 DIOCESE OF DUNDEE BURSARY FUND, 147 CAS' EDEN TRUST BURSARY, 183 CAPE), 186 KAGISO TRUST BURSARIES, 202 DIOCESE OF MARIANNHILL NATIONAL CECIL-LYONS TRUST SCHOLARSHIP, 183 ISCOR BURSARIES FOR TECHNIKON /TECHNICAL KARBOCHEM BURSARY. 202 CATHOLIC BURSARY AND SCHOLARSHIP CENTRAL COUNCIL OF LAND SURVEYORS COLLEGE AND UNIVERSITY STUDIES, 198 KEMPTON PARK CITY COUNCIL BURSARY FUND. 188 BURSARY (CCLS), 183 KIMBERLEY AND KURUMAN DIOCESAN BURSARY SCHEME, 155 DIOCESE OF NATAL BURSARY, 148 CHAPPIE BLACK TRUST BURSARY, 183 FUND. 155 KEMPTON PARK CITY COUNCIL BURSARY DON TILLEY BURSARY. 188 CHARTERED ACCOUNTANTS BURSARIES, 184 LESLIE HILL HIGHER EDUCATION TRUST. 203 SCHEME (LOCAL GOVERNMENT), 202 DORA FALCKE TRUST LOAN. 148 CLOVER SA BURSARY SCHEME.184 NATIONAL ECONOMIC EDUCATION TRUST KIMBERLEY AND KURUMAN DIOCESAN BURSARY DUNDEE MUNICIPAL BURSARY, 189 COLUMBUS STAINLESS STEEL BURSARY, 185 (NEET), 209 FUND, 155 ELAINE FORSYTH MEMORIAL TRUST BURSARY, COMMITTEE OF UNIVERSITY PRINCIPALS, 185 PIETERSBURG/POLOKwANE TRANSITIONAL KING SOLOMON mAPHumZANA BURSARY FUND. 149 COMMUNITY PRESTIGE BURSARY FUND, 147 LOCAL COUNCIL. 161 155 FIRST NATIONAL BANK OF SA LTD STUDENT CONCOR CONSTRUCTION BURSARY. 185 PRETORIA CITY COUNCIL FULL-TIME BURSARY KRUGERSDORP TOWN COUNCIL BURSARY LOAN, LOAN, ISO COOPERS AND LYBRAND BURSARY, 185 SCHEME, 213 156 GADRA BURSARY. 150 COROBRIK POST-MATRICULATION BURSARY, SA INSTITUTE OF ELECTRICAL ENGINEERS KWA-DUKUZA/STANGER TRANSITIONAL LOCAL GREATER POTGIETEftSRUS TRANSITIONAL 147 BURSARY SCHEME. 217 COUNCIL, 203 LOCAL COUNCIL STUDY LOAN. 195 CRADOCK'S AFRIKAANS LANGUAGE FESTIVAL SAAmBOU BURSARY FUND. 165 LESLIE HILL HIGHER EDUCATION TRUST, 203 H.A. KOCH SCHOLARSHIP. 151 BURSARY. 185 TELKOM SA (LTD) BURSARY AND STUDY AID MINTEK BURSARY. 207 JOSEPH VAN PRAAGH TRUST BURSARY. 1S5 CSIR BURSARY (UNIVERSITY STUDY). 185 SCHEME (ALL REGIONS), 223 NAFCOC MASEKELA- MAVIMBELA MEMORIAL KIRKNESS SCHOLARSHIP, 202 D.C. MURRAY TRUST BURSARY FUND (EASTERN TRANSVAAL INTER-CONSTITUTIONAL MASONIC SCHOLARSHIP FUND, 208 KuSHLICK /KAPLAN BURSARY SCHEME, 156 CAPE), 186 CHARITY LOAN, 224 NAMDEB DIAMOND CORPORATION (PTY) LTD, LADYSMITH CITY COUNCIL BURSARY, 156 D.G. MURRAY TRUST BURSARY FUND (WESTERN VETERANS BURSARY FUND. 170 208 LEWIS COWAN BURSARY. 157 CAPE). 186 Any technikon NATAL PROVINCIAL ADMINISTRATION BURSARY LION MATCH COMPANY BURSARY, 204 D.R. MCINTOSH TRUST. 186 SCHEME, 209 LTA LTD BURSARY SCHEME, 204 DE BEERS GROUP VOCATIONAL SCHOLARSHIP. 1820 SETTLERS' ASSOCIATION BURSARY, I 74 NATIONAL CHEMICAL PRODUCTS METHODIST BURSARY FUND, 158 187 ACCOUNTING TECHNICIANS BURSARY SCHOLARSHIP, 209 METHODIST CHURCH OF SOUTHERN AFRICA - DE BEERS INDUSTRIAL DIAMOND DIVISION (Pry) PROGRAMME. 174 NATIONAL ECONOMIC EDUCATION TRUST BOARD OF EDUCATION BURSARY. 158 LTD BURSARY (UNIVERSITIES), 187 AFRICON ENGINEERING INTERNATIONAL (NEST), 209 NELSPRUIT TOWN COUNCIL BURSARY. 159 DELOITTE AND TOUCHE BURSARY, 187 BURSARIES (TECHNIKONI. I 75 NATIONAL STUDENT FINANCIAL AID SCHEME NG KERK (VRYSTAAT) BEURSE. 159 DELOITTE AND TOUCHE BURSARY AND AGRICULTURAL RESEARCH COUNCIL (ARC) (NSFAS), 159 NORMAN BAXTER UNIVERSITY LOAN FUND, 159 SCHOLARSHIP SCHEME. 187 ORDINARY BURSARIES. 175 250 BEST COPY AVAILABLE Bursaries 235 DEPARTMENT OF CORRECTIONAL SERVICES KRUGERSDORP TOWN COUNCIL BURSARY LOAN, SIEMENS BURSARY, 220 EASTERN METROPOLITAN SUBSTRUCTURE, 190 PUBLIC BURSARY SCHEME, 187 156 SOCCER ASSOCIATION OF SA EDUCATION GAUTENG PROVINCIAL GOVERNMENT BURSARY, DEPARTMENT OF TRADE AND INDUSTRY KWA-DUKUZA/STANGER TRANSITIONAL LOCAL TRUST (SASH), 166 194 BURSARY, 188 COUNCIL, 203 SOLLY GINWALA MEMORIAL TRUST BURSARY, DEPARTMENT OF WATER AFFAIRS AND LESLIE HILL HIGHER EDUCATION TRUST, 203 221 N FORESTRY BURSARY / SCHOLARSHIP, 188 LIEBENBERG AND STANDER WESTERN CAPE PTV SOUTHERN AFRICAN INSTITUTE FOR STEEL Natal Technikon DIOCESE OF WITBANK BURSARY, 148 LTD BURSARY, 204 CONSTRUCTION BURSARIES, 221 SABIE BOSFEESKOMITEE-BEURS, 218 DORBYL LIGHT AND GENERAL ENGINEERING, LO MING-YUAN SCHOLARSHIP, I 57 SPOORNET, 221 188 LOUISE AND NELLIE HERMAN BURSARY, 157 ST LEGER SCHOLARSHIP TRUST, 166 Nelspruit Technikon DOROTHY AND MENDEL SPITZ STUDY BURSARY. MAKRO SA (PTY) LIMITED BURSARY, 157 STANDARD BANK LOAN, 166 ROTARY CLUB - NEISPRUIT BURSARY, 216 189 MAVIS WAKEFORD BURSARY, 206 STEWART SCOTT BURSARY, 222 DPS BURSARY, 189 MEDICAL ASSOCIATION OF SA BURSARY, 206 STIGLINGH MEMORIAL BURSARY, 222 DR T.E. DCMNGES BURSARIES, 148 MINTEK BURSARY, 207 STOCKS AND STOCKS MANAGEMENT Peninsula Technikon DUNVEGAN AND GLENDOWER RESIDENTS AND MOBIL OIL REFINING DIVISION STUDY GRANT. UNIVERSITY BURSARY, 222 AMATIE MEMORIAL SCHOLARSHIP, 143 RATEPAYERS ASSOCIATION BURSARY, 189 207 STUDIETRUST BURSARY, 222 AMRIT BHOWAN MEMORIAL SCHOLARSHIP DURBAN CITY COUNCIL LOANS, 189 MURRAY AND ROBERTS CONTRACTORS TELKOM SA (LTD) BURSARY AND STUDY AID FUND, 143 DURBAN HIGH SCHOOL AND OLD BOYS' BURSARY LOAN SCHEME. 208 SCHEME (ALL REGIONS), 223 ANGLO AMERICAN ASSURANCE BURSARY, 177 MEMORIAL TRUST BURSARIES, 148 MURRAY AND ROBERTS ENGINEERING LIMITED THE COMPUTER SCHOOL BURSARIES, 168 BACHE BABOO BENEVOLENT FUND, 144 DURBAN RADIOLOGICAL SERVICES BURSARY, 208 TRANSNET BURSARY, 223 CENTRAL OFS ADMINISTRATION BOARD EDUCATIONAL TRUST BURSARY, 189 MURRAY AND ROBERTS GILLIS-MASON TRANSVAAL HELPMEKAAR STUDY FUND (LOAN BURSARY FUND, 146 E.W. TURTON STUDY LOAN, 190 BURSARY, 208 FOR TECHNIKON AND UNIVERSITY STUDY), COLIN GOHL SCHOLARSHIP FUND, 185 EAST LONDON MUNICIPAL BURSARY, 190 MYRTLE L. ARON BURSARY, 208 168 COUNCIL FOR MINERAL TECHNOLOGY EDEN TRUST BURSARIES, 190 NAFCOC MASEKELA-MAVIMBELA MEMORIAL TRANSVAAL INTER-CONSTITUTIONAL MASONIC UNDERGRADUATE BURSARY, 185 EDENVALE JUBILEE BURSARY FUND. 149 SCHOLARSHIP FUND, 208 CHARITY LOAN, 224 CTPA BURSARY, 147 ERMELO TOWN COUNCIL STUDY LOAN, 191 NAMDEB DIAMOND CORPORATION (PTY) LTD. TRANSVAAL PROVINCIAL ADMINISTRATION DELTA MOTOR CORPORATION BURSARY, 147 ERNST AND YOUNG BURSARY, 191 208 (TPA) BURSARY, 224 DEPARTMENT OF PUBLIC WORKS AND LAND ESKOM UNIVERSITY BURSARY, 191 NASIONALE MEDIA BPK BURSARY, 209 TRUST BANK STUDENT LOANS, 168 AFFAIRS BURSARY, 188 ESTCOURT INDIAN ONE CENT BURSARY, 149 NASIONALE PERS BPI( BEURS, 209 TSHEZI EDUCATION TRUST BURSARY, 168 DURBANVILLE MEN'S FORUM BURSARY, 148 EVANGELICAL LUTHERAN CHURCH IN SA NATAL PROVINCIAL ADMINISTRATION BURSARY UNITED BANK STUDENT LOANS, 169 E.J.LOMBARDI BURSARY TRUST, 149 BURSARY, 149 SCHEME, 209 VENDA DEVELOPMENT CORPORATION ENGEN LTD BURSARY SCHEME, 191 FANNY AND SHLOMO BACKEN BURSARY, 192 NATIONAL CHEMICAL PRODUCTS BURSARY, 225 GARDEN CITIES BURSARY, 194 FAR NORTH EDUCATION AND TRAINING TRUST SCHOLARSHIP, 209 VEREENIGING KOPANONG CITY COUNCIL STUDY HOSPITAL WELFARE AND MUSLIM LOAN, 192 NATIONAL ECONOMIC EDUCATION TRUST LOAN SCHEME, 1 70 EDUCATIONAL MOVEMENT BURSARY-LOAN, FEMALE ACCOUNTANTS BURSARY SCHEME, 193 (NEET), 209 VETERANS BURSARY FUND, 170 152 FIRST NATIONAL BANK SCHOLARSHIP FOR NATIONAL STATE/INDEPENDENT STATE VODACOM BURSARY SCHEME, 225 KEN STEPHENS CONSTRUCTION BURSARY, 202 INFORMATION TECHNOLOGY, 193 BURSARY LOANS, 209 VOLKSKAS STUDENT LOANS, 171 OPERATION EDUCATION AME CHURCH FIRST NATIONAL BANK UNIVERSITY AND NATIONAL STUDENT FINANCIAL AID SCHEME VOLKSWAGEN BURSARY, 225 BURSARY, 160 TECHNIKON SCHOLARSHIP, 150 (NSFAS), 159 WATSON EDWARDS BURSARY, 226 PHILIP AND ISAAC ALBOW SCHOLARSHIP A & B. FREE STATE PROVINCIAL GOVERNMENT NATIONAL UNION OF COMMERCIAL WESTERN CAPE EDUCATION DEPARTMENT 161 BURSARY, 194 TRAVELLERS BURSARY, 159 BURSARIES, 226 SA INSTITUTE FOR LIBRARIANSHIP AND FRENCH GOVERNMENT BURSARIES, 194 NEDBANK STUDENT LOAN SCHEME, 210 WESTERN CAPE SOCIETY OF CHARTERED INFORMATION SCIENCE (SAIUS) (WESTERN FUNDANI TRUST, 194 NEDERDUITSCH HERVORMDE ACCOUNTANTS BURSARIES, 226 CAPE BRANCH) STUDY GRANT, 217 GARDEN CITIES BURSARY, 194 SUSTERSVERENIGING (NHSV) STUDY LOAN, WINIFRED WILSON BURSARY, 226 SA NURSERY ASSOCIATION BURSARY, 218 GENBEL-STUDIETRUST BURSARY LOANS FOR 159 WORKMEN'S ACCIDENT AND REHABILITATION SAUL ALBOW SCHOLARSHIP, 165 B.COM. STUDENTS, 194 NEDERDUITSCH HERVORMDE CENTRE BURSARY - DURBAN, 227 TREK PETROLEUM BURSARY, 224 GENCOR BURSARY SCHEME, 194 SUSTERVERENIGING (NHSV) STUDY LOAN YVONNE PARFETT BURSARIES TRUST, I 72 W.D. HENDRICKS MEMORIAL BURSARY FUND, GENREC CONSTRUCTION BURSARY SCHEME, FOR SOCIAL WORK, 210 ZIERVOCEL LOAN, I 73 171 194 NORTH WEST PROVINCIAL SERVICE B WAR MEMORIAL SCHOLARSHIP, 171 GENREF LIMITED BURSARY, 194 COMMISSION BURSARY. 211 Port Elizabeth Technikon GERALD WRIGHT SCHOLARSHIP, 195 NORTHWOOD JUBILEE SCHOLARSHIP, 159 Border Technikon DEPARTMENT OF EDUCATION BURSARY LOAN CMSA BURSARY. 195 OFS DEPARTMENT OF EDUCATION BURSARIES, BORDER COUNCIL BURSARY SCHEME, 181 SCHEME, 147 GOLD FIELDS OF SA LIMITED BURSARY, 195 211 C PORT ELIZABETH TECHNIKON ADMINISTERED GORDON LE ROUX MEMORIAL BURSARY LOAN, OLD MUTUAL ACTUARIAL BURSARY, 211 BURSARIES AND STUDY LOANS, 161 195 OVE ARUP INCORPORATED SCHOLARSHIP, 212 Cape Technikon 5A COUNCIL FOR PROFESSIONAL LAND GRAHAMSTOWN CITY BURSARY, 151 PALABORA MINING COMPANY LTD BURSARY, AMATIE MEMORIAL SCHOLARSHIP, 143 SURVEYORS AND TECHNICAL SURVEYORS GREATER JOHANNESBURG TRANSITIONAL 212 BURSARIES ADMINISTERED BY THE CAPE (BURSARIES FOR TECHNIKON STUDY), 217 METROPOLITAN COUNCIL (GJTMC) PELOPONNESIAN SOCIETY OF SA BURSARY, 161 TECHNIKON, 145 PIETERSBURGIPOLOKWANE TRANSITIONAL Port Elizabeth Technikon BURSARY, 195 CAPE TECHNIKON LOANS, 145 GREATER LOUIS TRICHARDT TRANSITIONAL LOCAL COUNCIL, 161 CAPE TECHNIKON MERIT BURSARIES, 145 (Saasveld College) LOCAL COUNCIL BURSARY LOAN SCHEME. PLATO DEVELOPMENT FUND BURSARY, 213 COLIN GOHL SCHOLARSHIP FUND, 185 SABIE BOSFEESKOMITEE-BEURS, 218 POLIFIN BURSARY SCHEME, 213 151 DEPARTMENT OF WELFARE AND POPULATION GRINAKER BURSARIES, 196 PORT ELIZABETH CITY COUNCIL BURSARIES, Potchefstroom University for CHE DEVELOPMENT BURSARIES, 188 GROUP FIVE ROADS SAVAGE AND LOVEMORE AHI POTCHEFSTROOM BEURS, 176 213 ENGEN LTD BURSARY SCHEME, 191 (EASTERN CAPE) (KY) LTD BURSARY, 196 PRECIOUS METALS REFINERS BURSARY AWARD, ANALENE DU PLESSIS MEMORIAL TRUST, 143 GARDEN CITIES BURSARY, 194 ATKB REDENAARSKOMPETISIE-BEURS, 144 GUY SUTTON MEMORIAL BURSARY, 196 213 GERTRUIDA C. DU TOIT MEMORIAL TRUST, 151 BRUNEL BURSARY, 181 HAGGIE BURSARY, 196 PREMIER FOOD INDUSTRIES LTD BURSARY, 161 INSTITUTE OF PACKAGING BURSARY, 198 C.H.E. BURSARY, 182 HANSIE BOTHA STUDY BURSARY FUND (LOAN), PRETORIA CITY COUNCIL FULL-TIME BURSARY ITESSA BURSARY, 199 CHARL ERASMUS BURSARY, 184 196 SCHEME, 213 LIGHT HOUSE CLUB BURSARY, 204 HEXAGON TRUST BURSARY, 197 CHARTERED ACCOUNTANTS' BURSARY, 184 PRETORIA PORTLAND CEMENT BURSARY MOLTEN() BROTHERS BURSARY, 207 HIGHVELD STEEL AND VANADIUM CORP LTD CLOVER BURSARY, 184 SCHEME (MEMBER BARLOWS), 213 PIET NEETHLING EDUCATIONAL TRUST BURSARY, 197 PRICE WATERHOUSE BURSARY, 214 D.N.G. KOTZE BURSARY FOR THEOLOGY,186 BURSARY/LOAN, 161 HNR COMPUTERS BURSARY FUND, 197 DEANS BURSARY, 187 PRINSLOO-WOLMARANS STUDY FUND (LOAN). PLASTICS INDUSTRY TRAINING BOARD HOME ECONOMICS ASSOCIATION OF 162 DEPARTMENT OF PUBLIC WORKS AND LAND BURSARY, 213 AFFAIRS BURSARY, 188 SOUTHERN AFRICA BURSARY (HEASA), 198 PROFESSIONAL EXAMINATION BURSARY, 214 S.F. AND V.R. DU TOIT BURSARY, 216 IAN FRASER MEMORIAL BURSARY FUND PROVINCIAL ADMINISTRATION WESTERN CAPE DETTMAN TRUST BURSARY, 147 SA COUNCIL FOR PROFESSIONAL LAND (BURSARIES FOR THE BLIND), 152 BURSARY SCHEME, 214 DORFLING BURSARY, 188 SURVEYORS AND TECHNICAL SURVEYORS DOROTHY ADELINE JOOSTE FUND, 188 !DB SCHOLARSHIP TRUST BURSARY LOAN, 198 PUBLIC SERVICE BURSARY SCHEME. 214 (BURSARIES FOR TECHNIKON STUDY), 217 ELI LILLY BURSARY AND LOAN SCHEME, 191 INDIAN CENTENARY SCHOLARSHIP TRUST RANDFONTEIN TOWN COUNCIL BURSARY SA INSTITUTE FOR UBRARIANSHIP AND LOAN /BURSARY, 153 FACULTY OF LAW PERSONNEL BURSARY FUND, LOANS, 163 INFORMATION SCIENCE (SAILIS) (WESTERN INSTITUTION OF CERTIFICATED MECHANICAL 192 RC DIOCESE OF KIMBERLEY BURSARY FUND, 215 CAPE BRANCH) STUDY GRANT, 217 REIGER PARK BURSARY LOAN FUND, 163 FAK MUSIEKBEURSE,192 AND ELECTRICAL ENGINEERS BURSARY, 198 SA NATIONAL COMMITTEE ON ILLUMINATION ISCOR BURSARIES FOR TECHNIKON/TECHNICAL RICHARDS BAY MINERALS BURSARIES FOR FIDELITY FUND STUDENT LOAN SCHEME, 193 BURSARY, 218 UNIVERSITY STUDY), 215 GERT AND CATHARINA SWANEPOEL COLLEGE AND UNIVERSITY STUDIES, 198 SA NURSERY ASSOCIATION BURSARY, 218 ISCOR BURSARY LOAN, 199 ROBERT JUNG SCHOLARSHIP, 216 THEOLOGICAL FUND, 195 J.E. CONRADIE LOAN, 199 ROODEPOORT MUNICIPALITY BURSARY LOAN, E GLAXO BURSARY, 195 JCI LIMITED BURSARY, 200 216 GOEDE LOAN FUND, 151 JEFFARES AND GREEN, CONSULTING ENGINEERS ROTARY CLUB OF BELLVILLE BURSARY, 164 Eastern Cape Technikon GOVERNMENT BURSARIES, 151 BURSARY SCHEME, 200 SA BLIND WORKERS ORGANISATION BURSARY, EASTERN CAPE TECHNIKON BURSARIES, 190 GROVE, VAN DER HEEVER AND MAY JO BROWNE TRUST FUND FOR MEDICAL 164 SCHOLARSHIP, 196 STUDENTS, 200' SA BREWERIES BEER DIVISION BURSARY SCHEME, HENDRIK EN ANNATJIE VISAGE BURSARY, 197 JOHANN G. LEIPOLDT MEMORIAL TRUST 217 ISU Campus INSTITUTE OF CHARTERED ACCOUNTANTS BURSARY, 200 SA INSTITUTE OF ELECTRICAL ENGINEERS MICROSOFT APPRENTICESHIP PROGRAMME BURSARY, 198 JOHANNESBURG CONSOLIDATED INVESTMENT BURSARY SCHEME, 217 EDUCATIONAL TRUST (mApEn, 207 J. TOXOPEUS BURSARY FUND, 153 CO LTD (JCI) CATEGORY B BURSARY, 200 SA INSTITUTE OF FOUNDRYMEN SPONSORSHIP, M J.F. HAVENGA TRUST BURSARIES,153 JOHANNESBURG CONSOLIDATED INVESTMENT 217 J.M. HATTINGH STUDY FUND, 153 CO LTD 'JOHNNIES' CATEGORY C BURSARY, SA INSTITUTE OF RACE RELATIONS (SAIRR) M.L. Sultan Technikon JUNIOR RAPPORTRYERSKORPS 200 BURSARIES, 217 COMPUTER SOCIETY OF SA BURSARY, 185 DEBATSKOMPETISIE-BEURSE, 155 JOHNSON AND JOHNSON BURSARY, 201 SA INSTITUTION OF MECHANICAL ENGINEERING ENGEN LTD BURSARY SCHEME, 191 JUNIOR RAPPORTRYERSKORPS KLERKSDORP- jOSSIE ACKERMANN LOAN, 201 MERIT AWARDS, 217 GENREF LIMITED BURSARY, 194 BEURSE, 201 KAGISO TRUST BURSARIES. 202 SA ORT BURSARY TRUST. 218 GUY SUTTON MEMORIAL BURSARY, 196 KAS VIR TEOLOCIESE STUDENTE-BEURSE, 202 KANGWANE BURSARY, 155 SA ROADS BOARD (SARB) BURSARIES, 218 M.L. SULTAN TECHNIKON BURSARIES, 205 KLERKSDORP ROTARY CLUB LOAN FUND,156 KANTEY AND TEMPLER BURSARY. 202 SA SCHOLARSHIP PROGRAMME, 218 SA COUNCIL FOR PROFESSIONAL LAND KLERKSDORPSE AFRIKAANSE SAKEKAMER KARBOCHEM BURSARY, 202 SA STUDENTS EDUCATION TRUST BURSARY SURVEYORS AND TECHNICAL SURVEYORS MERIETEBEURS, 156 KEMPTON PARK CITY COUNCIL BURSARY csAsEn. 218 (BURSARIES FOR TECHNIKON STUDY), 217 LUKIN BURSARY, 204 SCHEME, 155 SAAMBOU BURSARY FUND, 165 UMGENI WATER BURSARY, 224 MEDICAL EDUCATION FOR SA BLACKS (MESABI KEMPTON PARK CITY COUNCIL BURSARY SAFRIPOL BURSARY. 218 BURSARY, 207 SCHEME (LOCAL GOVERNMENT), 202 SAMRO'S INTERMEDIATE BURSARIES FOR Mangosuthu Technikon MERIT BURSARIES FOR HEADBOY AND MANGOSUTHU TECHNIKON ACADEMIC KESSEL FEINSTEIN BURSARIES (CHARTERED COMPOSITION STUDY IN SOUTHERN HEADGIRL (PU FOR CHE), 158 ACHIEVEMENT AWARDS, 205 ACCOUNTANTS), 202 AFRICA. 219 MIEN HAMMERSMA BURSARY FOR SINGING, 207 MANCOSUTHU TECHNIKON SPORTS AWARDS. KIMBERLEY AND KURUMAN DIOCESAN BURSARY SAMST BURSARY/LOAN, 219 MPUMALANGA PREMIER PRIVATE SECTOR FUND, 155 SANLAM BURSARIES (UNIVERSITIES), 219 205 BURSARY FUND, 208 SA COUNCIL FOR PROFESSIONAL LAND KIMBERLEY CITY COUNCIL BURSARY. 155 SANLAM PROPERTIES BURSARY, 219 NATIONAL EXPO-COMPETITION BURSARY,159 SURVEYORS AND TECHNICAL SURVEYORS KING SOLOMON MAPHUMZANA BURSARY FUND. SAPPI BURSARY, 219 NATIONAL OLYMPIAD BURSARIES, 159 (BURSARIES FOR TECHNIKON STUDY). 217 155 SAPREF ENGINEERING SCHOLARSHIP. 219 NCKERK VAN GAUTENG-LENINGS/BEURSE, 210 UMGENI WATER BURSARY. 224 KOBUS VERSTER STUDY FUND. 156 SASOL LTD BURSARY, 220 ORKNEYSE AFRIKAANSE SAKEKAMER-BEURS, KPMG SCHOLARSHIP (CHARTERED SEA PLANT WELFARE TRUST BURSARY, 165 Medical University of Southern 160 ACCOUNTANTS), 202 SEIFSA UNIVERSITY SCHOLARSHIP. 220 OUD-STUDENTELENINGSFONDS, 160 Africa P.W. BOTHA BURSARY, 160 ANGLO AMERICAN CORPORATION OF SA PHARMACEUTICAL SOCIETY BURSARIES, 213 WOMEN'S AND MOTHER'S MOVEMENT (BENONI) STANDARD BANK LOANS FOR TECHNIKON LIMITED BRIDGING PROGRAMME BURSARY, PU FOR CHE BURSARIES FOR HANDICAPPED BURSARY, 172 PRETORIA, 167 177 STUDENTS, 162 WOMEN'S AND MOTHER'S MOVEMENT ATKV Technikon SA ASSOCIATION OF SA QUANTITY SURVEYORS PU FOR CHE BURSARIES FOR NEEDY STUDENTS, ISAR & H) JOHANNESBURG BURSARY, 227 PACKAGING INSTITUTE OF SA, 212 STUDENT LOAN SCHEME, 178 162 Rhodes University SA INSTITUTE FOR LIBRARIANSHIP AND AUBREY SIMPSON BURSARY, 178 PU FOR CHE CULTURAL PERFORMANCE ALFRED BEIT SCHOLARSHIP, 142 INFORMATION SCIENCE (SAIL'S) (WESTERN BARCOM ELECTRONICS (PTY) LIMITED BURSARY, BURSARIES, 162 AUBREY FALKSON BURSARY, 178 CAPE BRANCH) STUDY GRANT, 217 179 PU FOR CHE FAMILY BURSARY, 162 BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 SANTAM BURSARIES, 219 BOB BUTTON ACCOUNTING BURSARY, 181 PU FOR CHE SCHOLARSHIPS FOR BEGINNERS CAPITAL RADIO/RHODES MUSIC RADIO TECHNIKON SA BURSARIES AND LOANS, 167 CHARTERED ACCOUNTANTS' BURSARY, 184 (ACADEMIC), 162 BURSARY, 183 COMPUTER SOCIETY OF SA BURSARY, 185 PU FOR CHE SPORTS BURSARIES, 162 Technikon Witwatersrand CHARLES EGAN BURSARY, 146 COUNCIL UNIVERSITY BURSARY, 185 PU FOR CHE STUDENT LOAN SCHEME. 162 BLUE CIRCLE BURSARY. 180 CHARTERED ACCOUNTANTS' BURSARY, (84 ENGEN LTD BURSARY SCHEME, 191 PU FOR CHE STUDY LOAN FUNDS, 162 ENGEN LTD BURSARY SCHEME, 191 CLAUDE HARRIS LEON FOUNDATION FORD BURSARY. 193 PU FOR CHE TRAVEL BURSARIES, 162 M.E.I. CONSTRUCTION TRAINEE TECHNICIAN BURSARIES. 146 FRANK CONNOCK UNIVERSITY TRUST PU FOR CHE UNDERGRADUATE SCHOLARSHIPS SCHEME. 205 DAAD UNDERGRADUATE BURSARIES (GERMAN BURSARIES, 193 (ACADEMIC), 162 MURRAY AND ROBERTS BURSARY (TECHNIKON ACADEMIC EXCHANGE SERVICE), 186 GEORGE COATES SCHOLARSHIP, 195 PU VIR CHO FAK MUSIEKBEURS, 214 STUDY), 208 DAVID KIBBEY TAYLOR MEMORIAL BURSARY, INSTITUTE OF PROFESSIONAL LAND SURVEYORS PUK ONDERSTEUNINCSKEMA, 162 ROTARY CLUB OF KYALAMI BURSARY, (64 186 SALES HOUSE CLUB BURSARY. (65 BURSARY, 198 RAND CARBIDE LIMITED BURSARY, 214 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL SENEKAL (ROOIKRANS) EDUCATION FUND, 165 TECHNICARE BURSARY, 223 J.C. BITCON SCHOLARSHIP. 199 SCHOLARSHIP, 194 JACK PALMER EDUCATION TRUST BURSARY, 154 TAFELRONDE 47. POTCHEFSTROOM, 167 TECHNIKON WITWATERSRAND ADMINISTERED GRAHAMSTOWN TRAINING COLLEGE JOHN DEERE BURSARY, 201 TRANSFARM BURSARY, 223 BURSARIES AND SCHOLARSHIPS, 167 SCHOLARSHIP, 195 KANGWANE MEDICAL BURSARIES, 202 TRANSVAAL PROVINCIAL ADMINISTRATION TECHNIKON WITWATERSRAND ADMINISTERED GREENSLADE SCHOLARSHIP, 151 LESOTHO GOVERNMENT BURSARY, 203 (TPA) BURSARIES, 168 SPORTS BURSARIES, 167 JOHN BRUNTON WHITE BURSARY. 155 MAGWA TEA CORPORATION BURSARY SCHEME. TUPPERWARE BURSARY. 224 JUTA BURSARIES. 201 U 205 TURKSTRA BURSAR?, 224 KENNETH B. GLOAG BURSARY. 155 University of Cape Town NATAL COLOURED BURSARY FUND, 158 MAX AND WINNIE SALOMON MEMORIAL R ALVISE PISANO SCHOLARSHIPS. 176 NCORA IRRIGATION SCHEME AGRICULTURAL BURSARY. 206 AMATIE MEMORIAL SCHOLARSHIP, 143 BURSARY, 209 Rand Afrikaans University MEDICAL EDUCATION FOR SA BLACKS (MESABI ANDRIES OLIVIER BURSARIES (ANDRIES OLIVIER NDF STUDY BURSARY (NATIONAL ADIE FUHRMANN BURSARY, I 75 BURSARY, 207 YSTERKOPPE, VICTORIA-WES FONDS), 143 DEVELOPMENT FUND), 210 ADRIAAN ELFERINK BURSARY. 175 NANCY LITTLE BURSARY, 209 ANGLO AMERICAN CORPORATION OF SA NDF STUDY LOAN/BURSARY, 210 ALBERT ELLMER BURSARY, 176 NATAL BUILDING SOCIETY BURSARY, 209 LIMITED BRIDGING PROGRAMME BURSARY. OUTSPAN BURSARY, 212 ANNEMARIE BASSON BURSAR?. 177 OLD RHODIAN UNION BURSARIES AND GRANTS. PANNAR SEED (PTY) LTD BURSARY, 212 177 APOSTOLIC FAITH MISSION OF SA BURSAR?, 160 RANDCOAL SERVICES BURSARY, 214 ASSOCIATION OF SA QUANTITY SURVEYORS 143 PERCY FOX FOUNDATION BURSARIES, 161 STUDENT LOAN SCHEME, 1 78 RICHARDS BAY COAL TERMINAL BURSARY, 215 AVBOB STUDY LOAN FUND, 179 PHARMACEUTICAL SOCIETY BURSARIES, 213 SA COUNCIL FOR PROFESSIONAL LAND AUBREY SIMPSON BURSAR?. 178 AVRIL FRIEDA MALAN STUDY LOAN FUND. 144 REGINALD N. DRYDEN BURSARIES, 215 BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 SURVEYORS AND TECHNICAL SURVEYORS B.L. STEYN, 179 RHODES UNIVERSITY ENTRANCE CAPE TOWN HEBREW CONGREGATION BURSARY, BURSARY, 217 BANK OF LISBON BURSARY, I 79 SCHOLARSHIPS, 164 (83 TRANSKEI TEA MANAGEMENT, 223 BKS BURSARY. 180 RHODES UNIVERSITY RESIDENCE BURSARIES. CARTER ACCOUNTING BURSARY, 183 TREK PETROLEUM BURSAR?, 224 BOPHUTHATSWANA TRANSPORT HOLDINGS 164 CHARTERED ACCOUNTANTS' BURSAR?. 184 UMGENI WATER BURSARY, 224 (BTH) BURSARY, 181 RHODES UNIVERSITY SPORTS BURSARIES AND CORPORATION (DUKE OF YORK) SCHOLARSHIP. VERULAM HIGH EX-STUDENTS' BURSARY TRUST, BURSARIES TO DEPUTY HEADBOYS AND DEPUTY SCHOLARSHIPS, 164 147 170 HEADGIRLS (RAU). 145 RHODES UNIVERSITY STUDENT STUDY LOANS, COUNCIL FOR MINERAL TECHNOLOGY VKE BURSARY, 225 BURSARIES TO HEADBOYS AND HEADG1RLS 164 UNDERGRADUATE BURSARY, 185 (RAU). 145 RUDOLPH GINSBERG MEMORIAL BURSARIES, 164 University of Port Elizabeth DEPARTMENT OF PUBLIC WORKS AND LAND BURSARIES TO WINNERS IN SUBJECT SA LEGION AND WOMEN'S AUXILIARY ASSOCIATION OF SA QUANTITY SURVEYORS AFFAIRS BURSARY, 188 OLYMPIADS. 145 (GRAHAMSTOWN BRANCH) BURSARY, 165 STUDENT LOAN SCHEME, 178 ENGEN LTD BURSAR? SCHEME, 191 CARL ZIERVOGEL BURSARY. 146 SAWAS MEMORIAL SCHOLARSHIP. (65 CHARTERED ACCOUNTANTS' BURSARY, 184 FRANK CONNOCK UNIVERSITY TRUST CHARTERED ACCOUNTANTS' BURSARY. 184 SOLOMON REUBEN AND ANN WINER BURSARY. DEPARTMENT OF PUBLIC WORKS AND LAND BURSARIES. 193 CHILDREN'S FOUNDATION BURSARY, 184 166 AFFAIRS BURSARY, 188 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL CHRIS KOKKORIS BURSARY, 146 WILFRED ORR BURSARY FUND. 171 ERNIE WENTZEL SCHOLARSHIP, 191 CLUB (0- 100.146 SCHOLARSHIP, 194 J.C. BITCON SCHOLARSHIP, 199 DEVELOPMENT COMMITTEE BURSARY FUND. T FRENCH EMBASSY IN SA BURSARIES. 150 NATIONAL READJUSTMENT COMMITTEE AND 147 GROUP FIVE ROADS, SAVAGE AND LOVEMORE VOCATIONAL BOARD BURSARY FUND, 209 Technikon Free State (WESTERN CAPE) (PTY) LTD BURSARY. 196 NDF STUDY BURSARY (NATIONAL DR J.J. VAN TONDER BURSARY (HISTORY TECHNIKON FREE STATE BURSARIES, 223 BURSARY FUND). 189 HOSPITAL WELFARE AND MUSLIM DEVELOPMENT FUND), 210 DUTCH REFORMED CHURCH OF AFRICA Technikon Natal EDUCATIONAL MOVEMENT BURSARY-LOAN. NDF STUDY LOAN/BURSARY, 210 BURSARY, 148 COMPUTER SOCIETY OF SA BURSARY, I 85 152 NG KERK (00S-KAAP) BEURSE, 210 EBEN AND FREDA VAN ZYL STUDY LOAN FUND. SA COUNCIL FOR PROFESSIONAL LAND J.C. BITCON SCHOLARSHIP, 199 P.W. BOTHA BURSARY, 160 149 SURVEYORS AND TECHNICAL SURVEYORS JACOB FRANK SCHOLARSHIP, 154 PHARMACEUTICAL SOCIETY BURSARIES, 213 GAUTENG PROVINCIAL GOVERNMENT BURSARY, (BURSARIES FOR TECHNIKON STUDY), 217 JEANETTE GOLDMAN TRUST BURSARY. 200 RANDCOAL SERVICES BURSAR?. 214 194 SA NURSERY ASSOCIATION BURSARY. 218 KAPLAN CENTRE AWARD IN JEWISH EDUCATION. ROOTH & WESSELS SCHOLARSHIP, 216 HERMAN KRIGE BURSARY, 197 TECHNIKON NATAL BURSARIES / 202 SA FOOTPLATE PERSONNEL ASSOCIATION J.C. VAN DER MERWE BURSARY FUND. 153 SCHOLARSHIPS. 167 KWV UNDERGRADUATE BURSARY. 203 BURSAR?. 164 JOHANNESBURG TRANSPORT DIVISION (JTD) UMGENI WATER BURSARY. 224 MAGWA TEA CORPORATION BURSARY SCHEME, SOUTH EASTERN CAPE ATTORNEYS JOHANNESBURG MUNICIPALITY BURSAR?. 205 ASSOCIATION BRUSARY, 221 Technikon North West MIG SULTER MEMORIAL FUND BURSARY, 207 201 TRUST FOR CHRISTIAN OUTREACH AND GODIMO BURSARY FUND. 151 MUNICIPAL UNIVERSITY SCHOLARSHIP. 158 EDUCATION (ZINGISA BURSARY), 168 JOSEPH JOWELL BURSARY, 201 TECHNIKON NORTH WEST ACADEMIC KEMPTON PARK CITY COUNCIL PRESTIGE NOF STUDY BURSARY (NATIONAL UPE ALUMNI AND FANIE DU PREEZ BURSARIES, ACHIEVEMENT FUND (PROSPECTIVE DEVELOPMENT FUND). 210 170 BURSARY. 155 STUDENTS), 167 NDF STUDY LOAN/BURSARY. 210 UPE BONUSES BURSARY, 170 KOOS DU TOIT AND LOWISA GRIEBENOW STUDY TECHNIKON NORTH WEST ACADEMIC LOAN FUND, 156 NORISTAN BURSARY, 210 UPE CONVERTIBLE LOAN/BURSARY. 170 ACHIEVEMENT FUND (SENIOR STUDENTS). NORISTAN MEDICAL STUDY LOAN, 210 UPE FINANCIAL ASSISTANCE, I 70 KRUGERSDORP KRUGER FESTIVAL STUDY LOAN 167 FUND, 156 PHILIP AND ISAAC ALBOW SCHOLARSHIP A & B, UPE LOANS, 170 TECHNIKON NORTH WEST PRESTIGE BURSARY, 161 UPE SCHOLAR MERIT AWARD, 1 70 LIBERTY LIFE BURSARY SCHEME, 204 167 LOEKIE ODENDAAL BURSARY, 204 QUEEN ELIZABETH II CORONATION UNIVERSITY UPE SPORT BURSARY, I 70 MARIA MALAN CLUB BURSARY, 158 Technikon Northern Transvaal SCHOLARSHIP, 162 University of Pretoria RANDCOAL SERVICES BURSARY, 214 MARIA VAN RIEBEECK CLUB BURSARY, 158 SA COUNCIL FOR PROFESSIONAL LAND ACHIEVEMENT BURSARY (PROSPECTIVE SA COUNCIL FOR PROFESSIONAL LAND MIMI COERTZE BURSARY. 207 SURVEYORS AND TECHNICAL SURVEYORS STUDENTS), 142 SURVEYORS AND TECHNICAL SURVEYORS MPUMALANGA PREMIER PRIVATE SECTOR (BURSARIES FOR TECHNIKON STUDY), 217 ACHIEVEMENT BURSARY (SENIOR BURSARY, 217 BURSARY FUND, 208 TECHNIKON NORTHERN TRANSVAAL UNDERGRADUATE STUDENTS), 142 SA INSTITUTE FOR LIBRARIANSHIP AND NG KERK VAN GAUTENG - LENINGS /BEURSE, 210 BURSARIES/LOANS. 223 ADAMS AND ADAMS BURSARY, 174 INFORMATION SCIENCE (SAIL'S) (WESTERN OLLEY AND MEYER BURSARY, 160 BEURS VIR Technikon Pretoria CAPE BRANCH) STUDY GRANT, 217 AFRIKAANSE MUSIEKKLUB PARKHURST DUTCH REFORMED COMMUNITY KOMPOSISIE, 175 AKASIA CITY COUNCIL BURSAR?, 142 SAUL ALBOW SCHOLARSHIP, 165 BURSARY, 160 AFRIKAANSE SAKEKAMER PIETERSBURG- AVBOB BURSARY. 144 TILLY STAPPER TRUST (BURSARY), 223 R.B. HAGART TRUST. 163 BEURSFONDS, 142 COUNCIL OF TECHNIKON PRETORIA BURSARY TREK PETROLEUM BURSARY, 224 RAG BURSARIES (RAU). 163 ASSOCIATION OF SA QUANTITY SURVEYORS FUND. 147 UCT BURSARIES, 168 RANDBURG SOUTH DUTCH REFORMED STUDENT LOAN SCHEME, 178 COUNCIL OF TECHNIKON PRETORIA LOAN UCT SPORTS BURSARIES. 168 COMMUNITY. 163 AUBREY SIMPSON BURSARY, 178 FUND. 147 UCT STUDENT LOAN FUND. 169 RAU ALUMNI ASSOCIATION BURSARY 163 AVRIL FRIEDA MALAN BURSARY, 144 DR J.H. MEYER BURSARY. 148 VAN DER SPUY SCHOLARSHIP, 225 RAU BURSARY LOAN FUND, 163 BURSARY, I80 E SELLARS TRUST BURSARY, 148 VKE BURSARY. 225 BIA RAU DEPARTMENT OF TRANSPORT ECONOMICS ERNEST OPPENHEIMER MEMORIAL TRUST BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 BURSARY, 215 BURSARY, 149 University of Durban-Westville BOB BLUNDELL TRUST (SIR ARNOLD THEILER RAU LADIES CIRCLE BURSARY. 163 HIGHVELD STEEL AND VANADIUM CORP LTD BARCOM ELECTRONICS (PTY) LIMITED BURSAR?. MEMORIAL BURSARY), 181 RAU MERIT BURSARIES (UNDERGRADUATE). 163 BURSARY (TECHNIKON), 197 179 C.P. DE LEEUW BURSARY, 182 RAU STUDY LOAN FUND, 163 J.L.C. DU PLESSIS BURSARY, 153 CHARTERED ACCOUNTANTS' BURSAR?, 184 CHARTERED ACCOUNTANTS' BURSAR?, 184 REPFIN FINANCE BURSARY, 215 JAN AND MARTIE BOOT BURSARY, 154 COMPUTER SOCIETY OF SA BURSARY, 185 CHRIS SNIJMAN LOAN, 184 SA FOOTPLATE PERSONNEL ASSOCIATION MERIT BURSARY OF THE DEAN OF STUDENT ENGEN LTD BURSARY SCHEME, 191 CHRISTMAS STUDY BURSAR?, 184 BURSARY, 164 AFFAIRS (TECHNIKON PRETORIA), 158 PHARMACEUTICAL SOCIETY BURSARIES. 213 CORNELIUS AND LEA GROBLER THEOLOGICAL SA VISION CARE PIN (LTD) BURSAR?, 218 MPUMALANGA PREMIER PRIVATE SECTOR SA VISION CARE PTY (LTD) BURSARY, 218 FUND, 185 SAADAKKER BURSAR?. 218 BURSARY FUND. 208 UNIVERSITY OF DURBAN-WESTVILLE BURSARIES DAAN MARAIS BURSAR?, 186 SCHUMANN-WENGEL BURSARY. 220 MURRAY AND ROBERTS BURSARY (TECHNIKON AND LOANS, 224 DUNCAN HUTCHEON BURSARY, 189 SPIRO PLOMARITIS BURSARY. 166 STUDY), 208 UNIVERSITY OF DURBAN-WESTVILLE EFAMED PERFORMANCE BURSARY, 190 STATE STUDY LOAN FUND, 222 PLASTICS INDUSTRY TRAINING BOARD SCHOLARSHIPS, 224 ELI LILLY (SA) (PTY) LTD BURSARY, 191 STEVE ROSSOUW BURSARY, 222 BURSARY. 213 University of Fort Hare EMIL K(Tk)NIG BURSARY, 191 TEACHERS' ASSOCIATION OF TRANSVAAL EXPO FOR YOUNG SCIENTISTS BURSARY, 150 PRIVATE SECTOR BURSARY FUND OF THE MAGWA TEA CORPORATION BURSARY SCHEME, SECONDARY SCHOOLS BURSAR?. 223 PREMIER OF THE MPUMALANGA PROVINCE, FAK MUSIEKBEURSE, 192 TRANSPORT TECHNICAL INDUSTRIES (PTY) LTD 205 FAK UNIVERSITEIT VAN PRETORIA-BEURSE, 192 162 SABELO MAGWENTSHU MEMORIAL ITTI( BURSARY. 224 FAMILY BURSARY, 150 RECTOR'S BURSARY FOR OUTSTANDING SCHOLARSHIP FUND. 218 UN1TRANS LTD BURSARY, 224 PERFORMANCE (TECHNIKON PRETORIA), FINE ARTS MERIT BURSARY, t93 VERWOERDBURGSE JUNIOR RAPPORTRYERS- 163 University of Natal FORD BURSARY, 193 BEERS. 225 SA COUNCIL FOR PROFESSIONAL LAND AIR SURVEY COMPANY OF AFRICA LOAN, 176 FRED BOUSFIELD MOSS BLUNDELL MEMORIAL VICE BURSARY, 225 SURVEYORS AND TECHNICAL SURVEYORS ALAN STARKE COMMEMORATION FUND (LOAN). SCHOLARSHIP. 194 W.L. HECKROODT STUDY LOAN FUND. 226 (BURSARIES FOR TECHNIKON STUDY), 217 176 GAUTENG PROVINCIAL GOVERNMENT BURSARY, WITWATERSRAND WOMEN'S AGRICULTURAL SA NURSERY ASSOCIATION BURSAR?. 218 194 UNION BURSARY, 172 25 2 BEST COPY AVAILABLE Bursaries 237 HEADBOY AND HEADGIRL BURSARIES EIKENHOF-MOULTON BURSARY, 149 PROF J.H. NEETHUNG BURSARY, 162 NDF STUDY BURSARY (NATIONAL (PRETORIA). 152 EU ULLY (SA) (PTV) LTD BURSARY, 191 PRETORIUS BURSARY, 214 DEVELOPMENT FUND), 210 HELENA JOOSTE UNDERGRADUATE BURSARY, EUSE VISSER BURSARY, (49 RANDCOAL SERVICES BURSARY, 214 NDF STUDY LOAN/BURSARY, 210 197 ELIZABETH MARAIS BURSARY, 149 RAPPORTRYERSKORPS EIKESTAD- NG GEMEENTE BLOEMFONTEIN-WES-BEURSE, J.C. BITCON SCHOLARSHIP. 199 EUZABETH VILJOEN TRUST BURSARY, 149 MERIETEBEURS. 163 159 JOHANNES C. PIETERSE STUDY BURSARY, 200 ELSIE CECIUA MCDERMID BURSARY, 191 RAPPORTRYERSKORPS PIKETBERG-BEURS, 214 NORISTAN BURSARY, 210 JOHN DEERE BURSARY. 201 ESTER MENTZ BURSARY, 192 RICHTER BURSARY, 215 NORISTAN MEDICAL STUDY LOAN, 210 JOHN MICHAEL HANSEN BURSARY, 201 ETHEL JOYCE CHARLTON BURSARY, 192 ROTARY CLUB OF CAPE TOWN BURSARY, 216 PERSKOR BURSARY, 212 KWAZULU-NATALPROVINCIAL F.S. AND R.E. MALAN BURSARY, 192 ROY BEAMISH BURSARY, 216 PIETER AND FLORRIE DU PREEZ BURSARY, 161 ADMINISTRATION BURSARY SCHEME, 203 F.W. KNACKE BURSARY, 150 S.I.J. CILLIERS BURSARY, 216 ROSA DE MUNNIK-ELOFF STUDY LOAN FUND. LATE G.A. NIVEN TRUST VETERINARY BURSARY, FAK BEURS, 192 S.P. GREEN BURSARY, 216 164 203 FEDERALE VOLKSBELEGGINGS BEURS, 192 SA ASSOCIATION FOR CROP PRODUCTION, 216 SA ASSOCIATION FOR FOOD SCIENCE AND LEADERSHIP BURSARIES, 157 FELIX AND CHRISTINE GUT BURSARY LOAN, 193 SA ASSOCIATION FOR FOOD SCIENCE AND TECHNOLOGY (SAWOT) UNDERGRADUATE LIBERTY LIFE BURSARY SCHEME, 204 FEUX EN CHRISTINE GUT BURSARY LOAN TECHNOLOGY (SAWOT) UNDERGRADUATE BURSARY, 217 LUTHER FIELD VETERINARY TRUST (BURSARY), (GENERAL), 150 BURSARY, 217 SA FOOTPLATE PERSONNEL ASSOCIATION 204 FEMNET ELIZABETH LOUW BURSARY, 150 SA DRIED FRUIT CO-OPERATION (EMPLOYEES BURSARY, 164 M.S.B. KRITZINGER BURSARY, 157 FOREST OWNERS BURSARY, 193 BURSARIES), 217 SANDERS AND HAVENGA BURSARIES, 165 MPUMALANGA PREMIER PRIVATE SECTOR FOURTH CHILD BURSARY, 150 SA DRIED FRUIT CO-OPERATION (JAN BOSMANI SENEKAL (ROOIKRANS) EDUCATION FUND, 165 BURSARY FUND, 208 FRANS EN RYKIE THERON BURSARY. 193 BURSARY, 217 SMITH AND NEPHEW EDUCATIONAL TRUST NDF STUDY BURSARY (NATIONAL FRED BOUSFIELD MOSS BLUNDELL MEMORIAL SA DRUGGIST BURSARY, 217 BURSARY, 221 DEVELOPMENT FUND), 210 SCHOLARSHIP, 194 SA FOOTPLATE PERSONNEL ASSOCIATION SMITH EDUCATION FUND, 221 NDF STUDY LOAN /BURSARY, 210 G.P. CANITZ BURSARY, 194 BURSARY, 164 THEOLOGICAL STUDENTS PROVIDENT FUND NEDERLANDSE STUDIEFONDS-BEURS, 210 GAWIE HENDRIKSZ BURSARY, 151 5A INSTITUTE FOR LIBRARIANSHIP AND (LOAN), 223 NG KERK VAN GAUTENC-LENINGS / BEURSE, 210 GEORGE BLAKE BURSARY, 194 INFORMATION SCIENCE (SAIUS) (WESTERN THOMAS ROBERTSON BURSARY, 168 NORISTAN BURSARY, 210 GEORGE HOME BURSARY, I 51 CAPE BRANCH) STUDY GRANT, 217 U015 SCHOLARSHIP FOR CULTURE AND NORISTAN MEDICAL STUDY LOAN, 210 GIDEON ROOS BURSARY, 151 SA PERMANENT BUILDING SOCIETY BURSARY, LEADERSHIP (SENIOR STUDENTS), 170 OUTSPAN BURSARY. 212 GROUP FIVE ROADS, SAVAGE AND LOVEMORE (65 UOFS SCHOLARSHIPS FOR CULTURE AND PANNAR SEED (PTV) LTD BURSARY, 212 (WESTERN CAPE) (PTY) LTD BURSARY. 196 SABIE BOSFEESKOMITEE-BEURS. 218 LEADERSHIP, 170 PETRUSBURG THEOLOGICAL STUDY FUND, 212 HJ. BRUWER BURSARY. 196 SAKKIE GEYSER BURSARY, 219 UOFS SPECIAL SCHOLARSHIPS FOR SPORTS, 170 PRETORIA CHAMBER OF COMMERCE BURSARY. HAMEL BURSARY, 196 SALMA BURSARIES (FOR UNIVERSITY STUDY), UOFS UNIVERSITY LOANS, 170 213 HANS MERENSKY BURSARY. 196 219 VISSER -NESER BURSARY FUND, 171 PRETORIUM TRUST BURSARY, 213 HERMANN OHLTHAVER BURSARY, 152 SAREL AND GERM VISSER TRUST FUND WILUE SCHEEPERS BURSARY, 172 PROTEA BURSARY FUND, 214 HILDA HENDRIKZ BURSARY, 197 (BURSARIES AND LOANS), 220 University of the Western Cape SENEKAL (ROOIKRANS) EDUCATION FUND, 165 REX POYNTON AND BEN COHEN BURSARY, 21 5 HOFMEYR AND DE VOS BURSARY, 197 3M SA BURSARY, 174 ROBT. B. VIUOEN LOAN, 216 HOPEFIELD AND KUILSRIVER CONGREGATIONS SOCIAL WORK BURSARY, 221 ADAMS AND ADAMS BURSARY, 175 SA COUNCIL FOR PROFESSIONAL LAND BURSARY, 198 SOL MOSHAL BURSARY, 221 AMATIE MEMORIAL SCHOLARSHIP, 143 STELLENBOSCH AGRICULTURAL SOCIETY SURVEYORS AND TECHNICAL SURVEYORS IMMANUEL BURSARY. 198 ANGLO AMERICAN ASSURANCE BURSARY, 177 BURSARY, 222 BURSARY, 217 IMMIGRANT CHILD BURSARY, 152 ANTON RUPERT BURSARY, 178 STELLENBOSCH BOERE-ORKES-BEURS, 222 SA FOOTPLATE PERSONNEL ASSOCIATION IRVIN AND JOHNSON BURSARY, 198 ARGUS CENTENERY BURSARY, 178 STELLENBOSCH CHAMBER OF COMMERCE BURSARY, 164 ISAAC GREENBERG BURSARY, 153 BACHE BABOO BENEVOLENT FUND, 144 BURSARY. 222 SENEKAL (ROOIKRANS) EDUCATION FUND, 165 2. DU P. SCHOLTZ BURSARY. 199 CALTEX BURSARY, 182 SHOREDITS BURSARY, 220 J.B. COLLINS LOAN FUND, 199 STEVE LOUW SCHOLARSHIPS, 222 CAPE CHAMBER OF COMMERCE, 182 TILLY STAPPER TRUST (BURSARY), 223 TAAIBOS MERIT BURSARY, 167 COETZEE BURSARY FOR ECCLESIASTICAL CAPE OF GOOD HOPE BANK BURSARY, 182 TRANSNET BURSARY LOAN SCHEME, 168 THEOLOGICAL TRAINING FUND (NEDERDUITCH ORGAN MUSIC, 199 CARL AND EMILY FUCHS BURSARY. 146 UNIVERSITY OF STELLENBOSCH BURSARY LOAN HERVORMDE KERK VAN AFRIKA), 223 J.C.D. HECKROODT BURSARY. 199 CARTER ACCOUNTING BURSARY, 183 UNIVERSITY OF PRETORIA LOANS, 169 J.LM. FRANKEN BURSARY, 199 SCHEME. 169 CHARTERED ACCOUNTANTS' BURSARY. 184 UNIVERSITY OF PRETORIA SPORTS BURSARY, J.W. DU PREEZ BURSARY, 199 UNIVERSITY OF STELLENBOSCH MERIT DEPARTMENT OF HEALTH BURSARY, 188 BURSARIES FOR FIRST YEAR STUDENTS, 169 169 JACOBS FAMILY BURSARY, 154 OURBANVILLE MEN'S FORUM BURSARY, 148 UNIVERSITY OF PRETORIA WINNERS AND JAN THOMAS MARTENS BURSARY, 200 UNIVERSITY OF STELLENBOSCH SPECIAL El LOMBARDI TRUST BURSARY, 190 BURSARIES, 169 RUNNERS-UP OF SUBJECT OLYMPIADS JOEY HANEKOM BURSARY, 154 E.O. BAXTER BURSARY, 190 US-VROUEVERENICING BEURS, 225 BURSARY. 169 JOHAN AND WILLIE SPIES BURSARY, 154 ELI LILY BURSARY, 191 VAN ENTER KRYNAUW BURSARY FUND, 225 VKE BURSARY, 225 JOHAN VAN RENSBURG STUDY FUND, 154 ENGEN LTD BURSARY SCHEME, 191 University of South Africa JOHN MICHAEL HANSEN BURSARY, 201 VAN EWUCK FOUNDATION MERIT BURSARIES. FINNISH GOVERNMENT BURSARY, 150 JOSEPH GRANELU BURSARY, 201 225 BURSARY FUND FOR THEOLOGICAL STUDENTS. FOSCHINI BURSARY, 1 SO JUTA BURSARIES, 201 VERENIGING VIR VOLKSANG EN MUSIEK-BEURS, 182 GEORCEJACOBUS PETERSEN SCHOLARSHIP, 151 KAT BURSARY, 202 225 CHARTERED ACCOUNTANTS BURSARY, 184 GILLETTE SA LTD BURSARY, (51 KWEEKSKOOL BEURSE EN LENINGS, 203 VKE BURSARY, 225 GAUTENG PROVINCIAL GOVERNMENT BURSARY, HOSPITAL WELFARE AND MUSUM KWV UNDERGRADUATE BURSARY, 203 WENTZEL BURSARY, 226 194 EDUCATIONAL MOVEMENT BURSARY-LOAN, L.M.C. BEND/KS-BEURS, 156 WILFRED METJE BURSARY, 171 JACK PALMER EDUCATION TRUST BURSARY, 154 I52 LANGENHOVEN CENTENARY BURSARY, 156 WILFRED ORR BURSARY FUND, 171 MPUMALANGA PREMIER PRIVATE SECTOR IA APPEL BURSARY, 152 LEADERSHIP (CATEGORY WINNERS US DEBATING WILHELMINA DU TOR NYBOER BURSARY, 226 BURSARY FUND, 208 IBM BURSARY, 198 COMPETITION) BURSARIES, 156 WILLEM DE KOCK GEOLOGY BURSARIES, 226 SA INSTITUTE FOR UBRARIANSHIP AND ITALIAN BURSARY, 153 LEADERSHIP (HEADPREFECTS) BURSARY, 156 WILLEM PRETORIUS BURSARY, 226 INFORMATION SCIENCE (SAIUS) (WESTERN J.F. OOSTHUIZEN MEMORIAL FUND, 199 LEADERSHIP (PRESIDENT SCOUTS) BURSARY, WILLIE DU TOR (QUAGGASFONTEIN) CAPE BRANCH) STUDY GRANT, 217 J.G. MEIRING BURSARY FUND, 199 156 EDUCATIONAL FUND, 171 SOUTH AFRICAN POUCE ACADEMY BURSARY, JACK ELLERT BURSARY FUND, 153 LEADERSHIP (US HONORARY AWARD AND 166 University of the North JUTA BURSARIES, 201 JUNIOR RAPPORTRYERS DEBATING STANLEY J.O. NOOME BURSARY, 167 PHARMACEUTICAL SOCIETY BURSARIES, 213 JUTA BURSARY FUND, 155 COMPETITION) BURSARY, 157 SA VISION CARE PTY (LTD) BURSARY, 218 LEOPOLD PREMYSLAV BURSARY. 203 University of Stellenbosch LEADERSHIP (WINNER All(8 ORATOR STANLEY J.O. NOOME BURSARY, 167 MAUERBERGER FOUNDATION BURSARY, 158 COMPETITION) BURSARY, 157 A.C. TINGLE MEMORIAL BURSARY, 174 UNIVERSITY OF THE NORTH BURSARIES, 225 MEDICAL EDUCATION FOR SA BLACKS ( MESAB) A.E. ROSENZWEIG BURSARY, 142 LEVI AND BESSIE JONES BURSARIES, 204 BURSARY, 207 AJ.M. STEPHANSEN BURSARY LOAN SCHEME, LUKAS HAVENGA BURSARY, 204 University of the North West MILLNER'S DENTAL SUPPUERS BURSARY, 207 BOPHUTHATSWANA MPUDULOLE BURSARY AID 174 M.M. HATTINGH STUDY BURSARY. 15 7 MYRA CHAPMAN EDUCATIONAL TRUST A.P. LUBBE BURSARY, 174 M.M. ROBERTSON BURSARY, 157 FUND, 181 (BURSARY), 208 MEDICAL EDUCATION FOR SA BLACKS (MESAB) A.W. SCHUMANN BURSARY, 174 MABEL QUICK BURSARY. 205 NATAL COLOURED BURSARY FUND, 158 ALETTA VORSTER BURSARY, 176 MAGDALENA GRUNDUNG TRUST, 205 BURSARY, 207 NATIONAL BEVERAGES BURSARY, 159 AMATIE MEMORIAL SCHOLARSHIP, 143 MAGGIE LAUBSER LOCAL BURSARY, 205 NATIONAL BEVERAGE SERVICES (COCA-COLA) NATIONAL CHEMISTRY BURSARY, 209 BURSARY, 158 ANNA JULIANA THERON BURSARY, 177 MALAN BURSARY. 157 NED CEREF CEMEENTE KUILSRNIEJI BEURS, 210 ANNA PRETORIUS BURSARY, 177 MARIA CILUE BURSARY, 157 NORTH WEST TRANSPORT INVESTMENTS NORAH TAYLOR BURSARY, 210 BURSARY, 211 ANTON HARTMAN BURSARY, (77 MARILYN LOUW SCHOLARSHIPS, 205 OVERBEEK TRUST, 212 AVBOB MUTUAL INSURANCE SOCIETY BURSARY, MARJORIE HOCKEN BURSARY, 205 OSMOND LANGE ARCHITECTS BURSARY, 212 P.M. ANDERSON EDUCATIONAL TRUST, 160 I 79 MAUERBERGER BURSARY. 206 UNIVERSITY OF THE NORTH WEST LOANS, 169 PHARMACEUTICAL SOCIETY BURSARIES, 213 BAGS BEYLEVELD BURSARY, 179 MAX AND LOUISE ACKERMANN BURSARIES FOR University of the OFS PHILIP AND ISAAC ALBOW SCHOLARSHIP A 818. BENADE/WOMAN'S ASSOCIATION BURSARY. 180 AFRIKAANS. 206 ASSOCIATION OF SA QUANTITY SURVEYORS 161 BOB BLUNDELL MEMORIAL BURSARY, 180 MAX AND LOUISE ACKERMANN BURSARIES FOR STUDENT LOAN SCHEME, 178 PHILIP AND RACHEL LEVY DONATION BURSARY. BOB BLUNDELL MEMORIAL SCHOLARSHIP, 180 HOME ECONOMICS, 206 BARKLY WEST/KUPDAM FARMERS' 161 BOKOMO BURSARY. 181 MAX AND LOUISE ACKERMANN LOANS FOR ASSOCIATION BURSARY, 179 QUEEN ELIZABETH II CORONATION UNIVERSITY BUTTERWORTHS BURSARY. 182 MEDICINE, 206 BEURSFONDS TEOLOGIESE STUDIE VAN DIE NG SCHOLARSHIP, 162 C.TJ. VAN DER WALT BURSARY LOAN SCHEME, MECHANICAL ENGINEERING (ANONYMOUS KERK VAN DIE OVS, 180 RANDU DURAND THEOLOGY BURSARY, 214 145 DONOR), 206 BPP (BEPERKTE PRIVAATPRAKTYK) STUDIEBEURS, ROTARY SEA POINT BURSARY. 216 MEDICAL ASSOCIATION OF SA (TYGERBERG - CAPE OF GOOD HOPE BANK BURSARY, 182 181 ROTARY STUDENT FUND, 216 BOLAND) BURSARY. 206 CAR MAGAZINE BURSARY, 183 BREBNER BURSARY, 145 ROUND TABLE BURSARY FUND (UNIVERSITY OF CARTER ACCOUNTING BURSARY, 183 MEDICAL EDUCATION FOR SA BLACKS (MESAS) CJ. LATEGAN AND PARTNERS LOAN FUND, 182 THE WESTERN CAPE), 216 CHARLES PELTERET EDUCATIONAL TRUST, 184 BURSARY, 207 CALLA HUMAN GYMNASTIC BURSARIES, 182 SA INSTITUTE FOR U8RARIANSHIP AND MUSKET BURSARY, 208 CHARTERED ACCOUNTANTS' BURSARY. 184 CHARTERED ACCOUNTANTS' BURSARY, 184 INFORMATION SCIENCE (SAIUS) (WESTERN CIBA BURSARY, 184 MYRA CHAPMAN EDUCATIONAL TRUST CHRISTINE FERREIRA FUND. 146 CAPE BRANCH) STUDY GRANT, 217 (BURSARY), 208 CITRUSDAL BURSARY LOAN SCHEME, 146 E.G. PELZER BURSARY FUND, 148 SA LIBRARY ASSOCIATION (WEST. CAPE CLIFFORD-GLOSSOP BURSARY. 184 NJ. DEAN BURSARY. 208 FAK UNIVERSITEIT VAN DIE OVS-MUSIEKBEURS, BRANCH) STUDENT BURSARY, 218 NG KERK-BEURS, 210 COLIN GOHL SCHOLARSHIP FUND, 185 192 SA.WOMEN'S CULTURAL ORGANISATION CONSANI BURSARY, 185 NORISTAN BURSARY, 210 FIRST NATIONAL BANK AGRICULTURAL BURSARY, 165 NORISTAN MEDICAL STUDY LOAN, 210 D.P. PONGRACZ SCHOLARSHIP TRUST, 186 BURSARY SCHEME, 193 SAKMET BURSARY, 165 OCCUPATIONAL THERAPY BURSARY, 211 O.R. MEIRING MEMORIAL BURSARY, 186 FIVE OR MORE CHILDREN AT UOFS BURSARY, SIDNEY JACOBZ BURSARY FUND, 220 OLD MUTUAL LOAN FUND. 159 DANIE SWANEPOEL BURSARY, 186 ISO STELLENBOSCH FARMERS' WINERY BURSARY, DENTAL ASSOCIATION OF SA LOAN, 187 OLD TRUST BANK BURSARY, 211 HIGH SCHOOL MODEL BURSARY, 152 167 ORANJEBOND BURSARY, 160 DEPARTMENT OF CHEMICAL ENGINEERING INDEPENDENT DEVELOPMENT TRUST, 153 STUDENT SERVICES CENTRE BURSARIES. 222 OUD-MATIE GHOLFKLUB (SUIDE), 160 BURSARY LOAN SCHEME, 187 J.C. BITCON SCHOLARSHIP, 199 TILLY STAPPER TRUST (BURSARY), 223 DIPPENAAR BURSARY, 188 OUD-MATTE GHOLFKLUB (TRANSVAAU BEURS, J.F. HAVENGA TRUST BURSARIES. 153 TRANSVAAL ASSOCIATION OF TEACHERS DORINDA KOK BURSARY, 188 160 JACOBS FAMILY BURSARY, 154 LOAN/BURSARY, 224 OR AND MRS N. SIEBERHAGEN BURSARY, 189 OUTSPAN BURSARY, 212 JAMES ROBERTSON BURSARY, 154 UNITED NATIONS EDUCATIONAL AND TRAINING DR J.M. MULLER BURSARY, 148 PATRIC OWENS BURSARIES. 212 JOHN MICHAEL HANSEN BURSARY, 201 PROGRAMME FOR SOUTHERN AFRICA PEROLD-STEINER BURSARY LOAN SCHMEME, DR J.P. MEYER AND W.A. JOHNSEN BURSARY LETTIE FOUCHE TRUSTFUND LOAN, 157 (UNETPSA) BURSARIES. 224 LOAN. 189 212 MEDICAL ASSOCIATION OF SA LOWVELD UNIVERSITY OF THE WESTERN CAPE MERIT DR P.G. JANSEN BURSARY. 189 PETRUSA VAN ZUL BURSARY. 161 BRANCH MEDICAL BURSARY. 206 AWARDS, 169 DS. J.H. NEETHLING BURSARY, 148 PIERRE F. THERON BURSARY, 213 MEDICAL EDUCATION FOR SA BLACKS (MESAS) VAN EWIJCK FOUNDATION MERIT BURSARIES, PIET NEETHLING EDUCATIONAL TRUST DU TOIT HUGENOTE BURSARY, 148 BURSARY, 207 225 DURBANVILLE MEN'S FORUM BURSARY. 148 BURSARY/ LOAN. 161 MER-NATIONAL BURSARY, 207 W.D. HENDRICKS MEMORIAL BURSARY FUND, EJ. LOMBARDI BURSARIES, 190 PRICE WATERHOUSE MEMORIAL BURSARY, 214 171 LIBERO FATTI MEDICAL BURSARY FUND, 204 SONIA SCHWAB SCHOLARSHIP, 166 W.K. KELLOGG FOUNDATION BURSARIES, 225 ELI LILY BURSARY. 191 LIBERTY LIFE BURSARY SCHEME, 204 SPORTS DEVELOPMENT BURSARIES, 166 WARNER LAMBERT BURSARY, 226 ELLEN DANIELL BURSARY, 191 LIUTHEA SINGER ART FORUM BURSARY, 204 STELLA AND PAUL LOEWENSTEIN CHARITABLE WILFRED ORR BURSARY FUND, 171 EMANUEL JACOBSON BURSARY, 191 ENGEN LTD BURSARY SCHEME, 191 LOUIS LANDAU SCHOLARSHIP, 157 AND EDUCATIONAL TRUST BURSARIES. 222 University of the Witwatersrand ESTEE LAUDER GROUP OF COMPANIES LOUIS OSTROWIAK MEMORIAL BURSARY, 157 STUDENT GOVERNMENT BURSARIES, 167 A. TREVOR WILLIAMS SCHOLARSHIP, 174 BURSARY, 192 M.F. ESMONDE-WHITE BURSARIES, 205 SWISS RE SA, 222 A.L. NORDEN EDUCATIONAL TRUST BURSARY, ESTHER AND DAVID HORWICH SCHOLARSHIPS. MARGARET GIBSON BURSARY FUND, 205 SWISS RE SA LTD BURSARY (ACTUARIAL 142 149 MARGARET THOMSEN SCHOLARSHIP, 205 SCIENCE), 222 ABELIS LEIBOVICIUS BURSARY, 142 ESTHER TAYLOR AWARD, 192 MARITZ JOHN PLEN BURSARY, 158 TETJE PATTISON BURSAR/ES, 223 ABRAHAM AND OLGA LIPMAN FUND BURSARIES, ETHEL MARY SMITH BEQUEST BURSARY, I49 MARLEY BURSARY, 205 TREK PETROLEUM BURSARY. 224 174 EVE ANDERSON BURSARY, 150 MARY AND LOUIS GOLDFOOT SCHOLARSHIPS, TREVOR SALES MEMORIAL BURSARY. 168 ABRAHAM AND OLGA LIPMAN FUND FENELLA LEVY MEMORIAL BURSARY, 193 205 UNIVERSITY COUNCIL SPORTS SCHOLARSHIPS. SCHOLARSHIPS, 174 FLORENCE VAN DER BIJL MUSIC BURSARY (IN MARY GORDON BURSARY, 206 169 ABRAHAM AND SARAH SKAPINKER BURSARY CORPORATION WITH THE MARTHA MAUDE CATHERINE BIRD MEMORIAL VINUCHI TIES BURSARIES, 171 FUND, 142 WASHINGTON CLUB), 193 SCHOLARSHIPS, 206 VKE BURSARY, 225 ADAMS AND ADAMS BURSARY FUND. 175 FRANK CONNOCK UNIVERSITY TRUST MAX FELDMAN BURSARY, 206 W.K. KELLOGG FOUNDATION BURSARIES, 225 AFRICAN EDUCATIONAL TRUST, 175 BURSARIES. 193 MEDICAL EDUCATION FOR SA BLACKS (MESAS) W.M. RICHARDSON BURSARY, I 71 AKTOL UNDERGRADUATE BURSARY, 176 GAUTENG PROVINCIAL GOVERNMENT BURSARY, BURSARY, 207 WALTER POLLAK BURSARY, 226 ALAN B. CLEMONS BURSARY, 176 194 MEDICAL GRADUATES' ASSOCIATION BURSARY, WILE ROSENBERG RUGBY BURSARY, 171 ALAN WIGODER MEMORIAL FUND, 176 GAVIN COOKE CANOEING BURSARY, 151 207 WILFRED ORR BURSARY FUND. 171 ALBERT GEYSER BURSARY FUND, 176 GEORGE HIBBERT SCHOLARSHIP IN MICHAEL ZARCHI BURSARY, 158 WILLIAM FREDERICK BENARD SCHOLARSHIP ALBERT HOSSACK SCHOLARSHIP, 176 PHYSIOTHERAPY, 195 MIKE AND HANNAH AMOILS MEDICAL BURSARY FUND, 226 ALLAN AND GERRY SIMPSON MEMORIAL GOLDSMITH AND PAPENFUS BURSARY. 195 FUND. 207 WIMBLE, CAIRNS AND TAYLOR SCHOLARSHIP, BURSARY. 142 GROUP CAPTAIN 'SAILOR' MALAN MEMORIAL MILTON ALUMNI ENGINEERING SPORTS 226 ALUMNI FUND BURSARY, 143 BURSARIES. 196 BURSARY, 207 WITS CRICKET CLUB BURSARY, 1 72 ALUMNI SPORT BURSARIES, 143 H.A. WHITECROSS SCHOLARSHIPS. 196 MONSANTO BURSARY, 208 WITS HOCKEY CLUB BURSARIES, 172 ALWYN ZOUTENDYK BURSARIES, 176 HAROLD AND DORIS TOTHILL FUND (BURSARY MURRAY AND ROBERTS (BUILDINGS) BURSARY. WITS RUGBY CLUB BURSARIES, I 72 ANDREW DICKSON SCHOLARSHIP, 177 FOR TUITION FEES), 197 208 WITS SPORTS COUNCIL BURSARIES, 172 ANGLO AMERICAN CORPORATION OF SA HARRY COLMAN MEMORIAL SCHOLARSHIP. 152 N.F. PATTERSON BURSARY, 158 WITS SQUASH CLUB BURSARY. 172 LIMITED BRIDGING PROGRAMME BURSARY. HARRY LAMPERT ATHLETICS BURSARY, 152 NATBEV/COCA-COLA BOTTLERS' TERTIARY WITS TENNIS CLUB BURSARIES, 1 72 177 HARVEY P1RIE BURSARY FUND. 152 EDUCATION, 209 WITS UNIVERSITY COUNCIL BURSARIES, 172 ANTON HARTMAN TRUST BURSARIES, 178 WITS UNIVERSITY COUNCIL LOANS, 172 HELEN SUZMAN BURSARY. 152 NDF STUDY BURSARY (NATIONAL ARTHUR AIKEN SCHOLARSHIP, 143 HELEN SUZMAN /BRITISH GOVERNMENT DEVELOPMENT FUND), 210 WITS WOMEN'S CLUB BURSARIES, 1 72 ARTHUR E. HILL BURSARY, 178 AWARDS. 197 NDF STUDY LOAN/BURSARY, 210 University of Transkei ASICS SOCCER BURSARIES, 143 HELLENIC BURSARY OF LODGE PYTHAGORAS, NEIL SYMONS ATHLETIC BURSARY. 159 A.H. HESSEL BURSARY FUND, 174 ASSOCIATION OF HELENES FROM EGYPT AND 152 NEW SETTLERS' FOUNDATION BURSARY, 210 BANK OF TRANSKEI BURSARY, 144 SUDAN BURSARY FUND, 143 HELMUT HUSSERL BURSARY, 197 NORMAN E. ROSENBERG BURSARY, 210 BONA MAGAZINE BURSARY, 181 ASSOCIATION OF SA QUANTITY SURVEYORS HELPING HAND TRUST BURSARIES. 152 NURCOMBE SUMMERLEY RINGROSE AND TODD CALTEX BURSARY, 145 STUDENT LOAN SCHEME, 178 HERMAN LOUIS KARNOVSKY FUND, 197 BURSARY, 211 COCA-COLA BURSARY, 146 ATHLETICS BURSARY FUND. 143 DE VILLIERS BURSARY, (98 ODA 8URSARY/LOAN SCHEME, 2)1 MOBIL FOUNDATION BURSARIES, 158 ATZO NICOLA! MEMORIAL SCIENCE BURSARIES, ISAAC AND SARAH SCHNEIDER BURSARIES. 153 OLIVE TAYLOR BURSARIES, 211 PLATINUM MINES BURSARY, 161 178 ITHAQUESIAN PHILANTHROPIC SOCIETY OF SA OPEN SOCIETY SCHOLARS FUND BURSARIES, REMBRANDT BURSARY FUND, 164 B.S. PRYCE MEMORIAL BURSARY, 179 BURSARY, 153 160 SABEL° MAGWENTSHU MEMORIAL BARNEY BLIEDEN BURSARIES, 179 J AND B BENNUM BURSARY, 153 ORAL-B BURSARY, 211 SCHOLARSHIP FUND, 218 BARROW CONSTRUCTION BURSARY. 180 J.C. BITCON FOUNDATION BURSARIES, 199 PAM GREGORY MEMORIAL BURSARY, 212 SPARGS WHOLESALE BURSARY, 221 BATEMAN SCHOLARSHIP FUND, 180 BITCON SCHOLARSHIP. 199 PATRICK FLANAGAN AND WILE ISAACS CRICKET STANDARD BANK SCHOLARSHIP. 167 BENJAMIN AND MIRIAM DRIEBAND BURSARY J.H. HOFMEYER SCHOLARSHIP FUND, 153 BURSARY, 160 TRANSKEI INSURANCE BROKERS BURSARY. 223 FUND, 144 JACK MINCER BURSARY. 199 PAULINE CUZEN BURSARY, 161 TRANSKEI NATIONAL BURSARY, 223 BENNO AND LEAH MARGULIES BURSARY, 144 JACOB AND PAULINE PERTZ SCHOLARSHIP, 154 PETER AND SYDNEY DICKSON TRUST BURSARY. UNIVERSITY OF TRANSKEI LOANS, 169 BEREND KOLK BURSARY, 180 JAMES DAVID LENNOX MEMORIAL FUND, 154 212 University of Venda BERNARD THOMAS BOURKE BURSARY. 180 JAMES MAY DUTHIE BURSARY, 200 PHARMACEUTICAL SOCIETY BURSARIES, 213 ETNA! B'RITH JOHANNESBURG LODGE AND JAN DRECHMEIER MEDICAL BURSARY, 200 R.B.TAYLOR ACCOUNTANCY BURSARY, 214 JUTA BURSARIES, 201 NATIONAL READJUSTMENT COMMITTEE AND CHAPTER LILLIENFIELD BURSARY, 179 JAN LEENDERDT ACHTERBERG BURSARY, 200 RAPS TRUST BURSARIES, 214 VOCATIONAL BOARD BURSARY FUND, 209 BOART LONGYEAR BURSARY (BRIDGING JANE KUMMER BURSARY, 154 RAY SPILKIN MEMORIAL SCHOLARSHIP, 163 UNIVERSITY OF VENDA ADMINISTERED SCHEME). 180 JOAN AND LEN STARFIELD FAMILY BURSARY RED CROSS CALEDONIAN MARKET BODO KOCH BOOK BURSARY, 181 FUND. 200 SCHOLARSHIPS, 215 BURSARIES, 169 UNIVERSITY OF VENDA VICE CHANCELLOR'S BONA PEOPLE'S FUND BURSARY, 144 JOE KAMINER RUGBY BURSARY, 154 REEVE SHAPIRO MEMORIAL BURSARY, 215 MERIT BURSARY, t69 BREYTENBACH BURSARY, 181 JOHANNESBURG CITY COUNCIL BURSARIES - REX RUSHWORH LENNOX MEMORIAL FUND. 215 BRITISH AWARD SCHEME. 181 UNIVERSITY-ADMINISTERED. 154 REYERSBACH BURSARY, 164 University of Zululand BRONWEN WALKER BURSARY. 181 JOHANNESBURG REPERTORY PLAYERS BURSARY RICHARD NIEBUHR SCHOLARSHIP, 215 MPUMALANGA PREMIER PRIVATE SECTOR BRUCE MURRAY CRICKET BURSARY, 145 FOR DRAMATIC ART, 201 ROBERT HULME BURSARY, 215 BURSARY FUND, 208 CALTEX BURSARY FUND, 182 JOHN DEERE BURSARIES, 201 ROSS BRESLER SCHOLARSHIP, 164 UNICENI WATER BURSARY. 224 CHARLES HURWITZ BURSARY, 184 JOHN HURWITZ BURSARY. 155 RUBY REEVES BURSARY, 216 CHARTERED ACCOUNTANTS' BURSARY, 184 JOHN MICHAEL HANSEN BURSARY, 201 SA GE EDUCATIONAL TRUST BURSARY, 217 V CLIVE ULYATE RUGBY BURSARY, 146 JOHN SAVOPOULOS BURSARIES, 155 SANDER AND LAURIE OSTROWIAK Vaal Triangle Technikon CYANAMID BURSARY SCHEME, 186 SCHOLARSHIP, 219 JOHNSON AND JOHNSON 'PROFESSIONAL HIGHVELD STEEL AND VANADIUM CORP LTD DAISY MOSKOW BURSARIES, 147 SERVIER BURSARY, 220 PRODUCTS' BURSARY, 201 BURSARY (TECHNIKON), 197 DARRAS HELLENIC BURSARY, 147 SHULTON MUSIC BURSARY. 220 JOSEPH SINGER BURSARY, 201 SASOL CHEMICAL INDUSTRIES BURSARIES FOR DAVID FREEMAN BURSARIES, 147 SIMON KUPER MEMORIAL BURSARIES. 166 JUTA BURSARIES. 201 TECHNIKON STUDIES, 220 DAVID MORRISON BURSARY, 186 SIR HENRY STRAKOSCH MEMORIAL KATHLEEN ALISTER HARP SCHOLARSHIP, 202 VAAL TRIANGLE TECHNIKON BURSARIES AND DR ZUURDEEG MEMORIAL BURSARIES, (89 KHOLVAD MADRESSA FUND. 202 SCHOLARSHIP, 220 E. GLUCKMAN WILL TRUST LOANS, 189 LOANS, 22S L. COHEN BURSARY, 203 SKYE RUGBY BURSARIES, 166 E.J.A. LOERINCZ SCHOLARSHIP, 149 LAKOFSKI BURSARIES, 156 SMITH AND NEPHEW EDUCATIONAL TRUST Vista University EDDIE LEVITZ BURSARY, 190 LANGELER SCHOLARSHIP, 203 BURSARY, 221 GAUTENG PROVINCIAL GOVERNMENT BURSARY. EDKINS BURSARY FUND, 190 LAURENCE DAVID ADLER BURSARY, 203 SOLOMON AND ANN WINER BURSARIES, 221 194 EDWARD H. WAUGH MEMORIAL SCHOLARSHIP, LAZAR RAVID MEMORIAL SCHOLARSHIP, 203 SOLOMON RABINOWITZ OF PAARL VISTA UNIVERSITY BURSARIES AND LOANS, 225 190 LEO AND SARA BUCHEN SCHOLARSHIPS. 203 SCHOLARSHIP, 166 EDWARD WALKER BUCHANAN BURSARY, 190 LEONTINE SAGAN SCHOLARSHIP, 203 SOLOMON REUBEN AND ANN WINER BURSARY, ELI LILLY (SA) (PTY) LTD BURSARY, 191 LEZA LEGALWISE BURSARY, 204 166 25.4 239 a A Universities Technikons Private Colleges Technical Colleges Agricultural Colleges Nursing Colleges Teacher Training Institutes Addresses Universities (Address correspondence to The University of Natal University of the North Registrar.) Pietermaritzburg Qwaciwa Branch Private Bag X01 Private Bag X13 Medical University SCOTTSVILLE PHUTHADITJHABA of Southern Africa 3200 9866 PO Box 189 Tel.: (0331) 260-5111 Tel.: (058) 713-0211 MEDUNSA Fax: (0331) 260-5599 Fax: (058) 713-0156 0204 Tel.: (012) 521-4111 University of Natal (Durban) University of the Orange Free State DURBAN PO Box 339 Potchefstroom University for CHE 4041 BLOEMFONTEIN Private Bag X6001 Tel.: (031) 260-1111 9300 POTCHEFSTROOM Fax: (031) 260-2214 Tel.: (051) 401-9111 2520 Fax: (051) 401-2117 Tel.: (0148) 299-1111 University of North West Fax: (0148) 299-2799 Private Bag X2046 University of the Western Cape MMABATHO Private Bag X17 Rand Afrikaans University 2735 BELLVILLE PO Box 524 Tel.: (0140) 89-2111 7535 AUCKLANDPARK Fax: (0140) 25775 Tel.: (021) 959-2911 2006 Tel.: (011) 489-2911 University of Port Elizabeth University of the Witwatersrand Fax: (011) 489-2191 PO Box 1600 Private Bag 3 PORT ELIZABETH WITS Rhodes University 6000 2050 PO Box 94 Tel.: (041) 504-2111 Tel.: (011) 716-1111 GRAHAMSTOWN Fax: (041) 504-2574 Fax: (011) 716-8030 6140 Tel.: (0461) 31-8111 University of Pretoria University of Transkei Fax: (0461) 25049 PRETORIA Private Bag X1 0002 UNITRA University of Cape Town Tel.: (012) 420-9111 5117 Private Bag Fax: (012) 43-2185 Tel.: (0471) 302-2272 RONDEBOSCH Fax: (0471) 302-2272 7701 University of South Africa Tel.: (021) 650-9111 PO Box 392 University of Venda Fax: (021) 650-2138 PRETORIA Private Bag X5050 0003 THOHOYANDOU University of Durban-Westville Tel.: (012) 429-4116 0950 Private Bag X54001 Fax: (012) 429-4150 Tel.: (0159) 21071 DURBAN Fax: (0159) 22045 4000 University of Stellenbosch Tel.: (031) 204-4111 Private Bag X1 University of Zululand MATIELAND Private Bag X1001 University of Fort Hare 7602 KWADLANGEZWA Private Bag X1314 Tel.: (021) 808-9111 3886 ALICE Fax: (021) 808-4499 Tel.: (0351)93911 5700 Tel.: (0404) 22468 University of the North Vista University Fax: (0404) 31643 Private Bag X1106 Private Bag X634 SOVENGA PRETORIA 0727 0001 Tel.: (0152) 268-2226 Tel.: (012) 322-8967 Fax: (0152) 268-2624 Fax: (012) 320-0528 Technikons (Address correspondence to Port Elizabeth Technikon Technikon North-West The Registrar) Private Bag X6011 PO Box 911-1263 PORT ELIZABETH ROSSLYN Border Technikon 6000 0200 Private Bag 1421 Tel.: (041) 504-3911 Tel.: (01461) 32251/2 EAST LONDON Fax: (041) 53-3644 Fax: (01461) 32255 5200 Tel.: (0403) 63-1491 Port Elizabeth Technikon Technikon Northern Transvaal Fax: (0403) 63-2236 Saasveld Faculty of Forestry Private Bag X07 Private Bag 6531 PRETORIA-NORTH Cape Technikon GEORGE 0116 PO Box 652 6530 Tel.: (01214) 793-0950 CAPE TOWN Tel.: (044) 801-5111 Fax: (01214) 793-0966 8000 Fax: (044) 801-5031 Tel.: (021) 460-3911 Technikon Pretoria Technikon Free State Private Bag X680 Eastern Cape Technikon Private Bag X20539 PRETORIA Private Bag X3182 BLOEMFONTEIN 0001 BUTTERWORTH 9300 Tel.: (012) 318-5533 4960 Tel.: (051) 507-3911 Tel.: (0474) 62-0707 Fax: (051) 507-3199 Technikon SA Fax: (0474) 62-0735 Private Bag X6 Technikon Mangosuthu FLORIDA M.L. Sultan Technikon PO Box 12363 1710 PO Box 1334 JACOBS Tel.: (011) 471-2000 DURBAN 4026 Fax: (011) 471-2134 4000 Tel.: (031) 907-7111 Tel.: (031) 308-5111 Fax: (031) 907-2892 Technikon Witwatersrand Fax: (031) 308-5194 PO Box 17011 Technikon Natal DOORNFONTEIN Peninsula Technikon PO Box 953 2028 PO Box 1906 DURBAN Tel.: (011) 406-2221 BELLVILLE 4000 7535 Tel.: (031) 204-2111 Vaal Triangle Technikon Tel.: (021) 959-6911 Fax: (031) 223405 Private Bag X021 Fax: (021) 951-5617 VANDERBIJLPARK 1900 Tel.: (016) 85-2221 Fax: (016) 85-1203 Private Collees The Principal The Principal The Principal AAA School of Advertising Academy of Computer Academy of Learning PO Box 3423 Bookkeeping PO Box 559 CAPE TOWN PO Box 46217 WENDYWOOD 8000 ORANGE GROVE 2144 Tel.:(021) 418-1461 2119 Tel.:(011) 444-2887 Fax: (021) 21-1952 Tel.:(011) 483-1980 Fax:(011) 444-4634 Fax:(011) 483-1909 Addresses 243 Private = Colleges (continue The Principal The Principal The Principal Alberton College College of Progressive Learning Exercise Teachers Academy PO Box 166575 PO Box 21073 Sport Sc Inst 4th Floor BRACKENDOWNS VALHALLA Boundary Road 1454 0137 NEWLANDS Tel.:(011) 900-1202 Tel.:(012) 71-3931 7700 Fax:(011) 900-1712 Fax:(012) 71-4420 Tel.:(021) 689-1491 Fax:(021) 686-2600 The Principal The Principal Anchor College Computer Training Institute (CTI) The Principal PO Box 30715 PO Box 297 Gauteng Business College BRAAMFONTEIN CRAMERVIEW 597 Louis Botha Ave 2017 2060 BRAMLEY Tel.:(011) 403-3580 Tel.:(011) 789-3178 2090 Fax: (011) 403-1505 Fax: (011) 789-4606 Tel.:(011) 440-5116 Fax:(011) 440-5118 The Principal The Principal Birnam Business College Corporate College International The Principal PO Box 37082 Private Bag X7 Global School of Business BIRNAM PARK LANGLAAGTE No 20 De Korte Street 2015 2102 Everite House Tel.:(011) 887-2540 Tel.:(011) 885-2424 BRAAMFONTEIN Fax:(011) 887-4678 Fax:(011) 885-2423 2001 Tel.:(011) 403-8806 The Principal The Principal Fax: (011) 403-8755 Boston Computer Schools Damelin Education Group PO Box 7019 PO Box 32167 The Principal ROGGEBAAI BRAAMFONTEIN Hampton Community College 8012 2017 PO Box 49316 Tel.:(021) 26-1175 Tel.:(011) 403-5420 EAST END Fax:(021) 23-0479 Fax:(011) 403-2985 4016 Tel.:(031) 368-3393/4 The Principal The Principal Fax:(031) 368-3398 Cajee's Commercial College Design 3 School of Fashion PO Box 25136 PO Box 2020 The Principal FERREIRASTOWN STANGER Haute Couture School of 2048 4450 Fashion Design Tel.:(011) 834-1857/8 Tel.:(0324) 9-1770 PO Box 257 Fax:(011) 834-1857 Fax: (0324) 2-4190 CAPE TOWN 8000 The Principal The Principal Tel.:(021) 23-0494 Careers 2000 Business College Design Centre Fax:(021) 439-1564 PO Box 5357 PO Box 84190 DURBAN GREENSIDE The Registrar 4000 2043 Hawthorne University (SA) Tel.:(031) 41-2000 PO Box 5231 Fax:(031) 303-1694 The Principal DURBAN Durbanville College 4000 The Principal PO Box 1668 Tel.:(031) 368-4053 City Varsity DURBANVILLE Fax:(031) 368-3398 32 Kloof Street 7550 CAPE TOWN Tel.:(021) 975-1038 8001 Fax:(021) 96-1721 Tel.:(021) 24-7222 Fax: (021) 24-6657 244 253 Addresses Private Colleges centiriued) The Principal The Principal The Principal IMC Business School Kelly-Greenoaks Midrand Campus 2nd Floor 45 On Castle PO Box 1692 PO Box 2986 45 Castle Street PARKLANDS HALFWAY HOUSE CAPE TOWN 2121 1685 8001 Tel.:(011) 880-4805 Tel.:(011) 315-2853 Tel.:(021) 234747 Fax:(011) 447-2101 Fax:(021) 234745 The Principal The Principal Milpark Business School The Principal Keyboards Secretarial Project PO Box 91714 1MD Education Centre PO Box 31419 AUCKLAND PARK PO Box 137 BRAAMFONTEIN 2006 WITS 2017 Tel.:(011) 482-6378 2050 Tel.:(011) 403-3353 Fax: (011) 482-3397 Tel.:(011) 403-3680 Fax:(011) 339-7185 Fax:(011) 403-3680 The Principal The Principal Montrose Business College The Principal Learn-A-Trade PO Box 23741 Inscape Design College PO Box 41001 CLAREMONT PO Box 87605 ROSSBURGH 7735 HOUGHTON 4072 Tel.:(021) 64-3288 2041 Tel.:(031) 21-7771 Fax: (021) 683-4171 Tel.:(011) 487-1449 Fax: (031) 22-1181 Fax:(011) 487-1030 The Principal The Principal MSC Training Centre The Principal Lindiwe Kuzwayo Academy PO Box 18332 Inst of Personnel Mgt of Fashion Design QUIGNEY PO Box 31390 Suite 1400 Permanent Corner 5211 BRAAMFONTEIN 102 Field Street Tel.:(0431) 43-5778 2017 DURBAN 4001 Fax: (0431) 43-6099 Tel.:(011) 482-4970 Tel.:(031) 301-4690 Fax:(011) 482-5542 The Registrar The Principal Newport University The Principal Lowveld Tertiary College PO Box 2068 Intec College Campus PO Box 1846 PARKLANDS PO Box 2918 TZANEEN 2121 CAPE TOWN 0850 Tel.:(011) 880-2775 8000 Tel.:(0152) 307-5318 Fax:(011) 452-9190 Tel.:(021) 462-4170 Fax: (0152) 307-5318 Fax:(021) 461-5693 The Principal The Principal Office Plus Business Academy The Principal Maritzburg Business College PO Box 11630 Integrity Business College 157 Pietermaritz Street DORPSPRUIT PO Box 2968 PIETERMARITZBURG 3206 PIETERSBURG 3201 Tel.:(0331) 94-0296 0700 Tel.:(0331) 42-1471 Fax:(0331) 45-3962 Tel.:(0152) 297-2619 Fax:(033I)42 -1471 The Principal The Principal The Principal Oxford College of Education K Commercial College Mentor Business College 1234 Church Street PO Box 15908 PO Box 32369 HATFIELD VLAEBERG BRAAMFONTEIN 0083 8018 2017 Tel.:(012) 43-6786 Tel.:(021) 23-9275 Tel.:(011) 403-1387 Fax:(021) 23-6472 Fax: (011) 339-7382 259 245 Private C continued The Principal The Principal The Principal Pax Commercial College School of Fashion Train-A-Child College 102 Field Street Dressmaking & Design 160 Windermere Rd DURBAN 192 Retief St Morningside 4001 PIETERMARITZBURG DURBAN Tel.:(031) 307-4525 3201 4001 Fax:(031) 307-3299 Tel.:(0331) 45-4671 Tel.:(031) 303-2911/23 Fax:(0331) 45-4671 The Principal The Principal Prime Care Training The Principal Travel Training Inst PO Box 13076 St Mary's DSG Outreach PO Box 411498 CAPE TOWN PO Box 11379 CRAIGHALL 7900 Hatfield 2024 Tel.:(021) 45-2734 PRETORIA Tel.:(011) 447-7150 0028 Fax: (011) 447-7157 The Principal Tel.:(012) 386-4184 Ruth Prowse School of Art Fax:(012) 386-4184 The Principal PO Box 89 Varsity College WOODSTOCK The Principal PO Box 1514 7915 Stellenbosch Academy of CRAIGHALL Tel.:(021) 47-2492 Health & Skin Care Therapy 2024 Fax: (021) 448-4393 PO Box 149 Tel.:(011) 886-9077 STELLENBOSCH Fax:(011) 886-9078 The Principal 7599 SA Guild of Speach & Tel.:(021) 883-9777 The Principal Drama Teachers Fax:(021) 886-6061 Waterfront Theatre School PO Box 44308 PO Box 195 LINDEN The Principal GREENPOINT 2104 The Design School SA 8051 Tel.:(011) 782-4814/5 PO Box 13973 Tel.:(021) 418-4600 Fax: (011) 782-4815 HATFIELD Fax: (021) 419-4558 0028 Tel.:(012) 324-1779 The Principal Working World PO Box 5259 DURBAN 4000 Tel.:(031) 304-2693 . db (Address correspondence to The Alexandra Technical College Athlone Technical College Principal) PO Box 40 Private Bag ALEXANDRA ATHLONE Academy for Vocational 2014 7764 Education Tel.: (011) 882-9763 Tel.: (021) 797-5540 PO Box 166575 Fax: (021) 797-6682 BRACKENDOWNS Aliwal North Tech College Atteridgeville College 1454 PO Box 434 PO Box 97615 Tel.: (011) 900-1201/2 ALIWAL NORTH WESPARK Fax: (011) 900-1712 5530 Tel.: (0551) 41035 0146 Fax: (0551) 41035 Tel.: (012) 373-8030 Fax: (012) 373-8032 Bellville Technical College C.S. Barlow Distancekol (Distance Education) Private Bag X7 Private Bag X8660 85 Schoeman Street KASSELSVLEI GROBLERSDAL PRETORIA 7533 0470 0002 Tel.: (021) 951-2231 Tel.: (0132) 69-0020 Tel.: (012) 325-5408/9 Fax: (021) 951-3967 Cape College Durban Central Tech College Benoni Technical College PO Box 726 PO Box 5268 Private Bag X004 CAPE TOWN DURBAN BENONI 8000 4000 (031) 207-2060 1500 Tel.: (021) 462-2053 Tel.: Tel.: (011) 425-2780 Fax: (021) 461-1608 Fax: (031) 28-5498 Bethelsdorp Technical College Carletonville Tech College Durban Technical College Private Bag 17241 Private Bag X2015 Private Bag 1 SALTVILLE 6059 CARLETONVILLE CONG ELLA Tel.: (041) 43-7263 2500 4013 Tel.: (01491) 787-4102 Tel.: (031) 25-1379 Bethlehem College Fax: (01491) 787-5115 Fax: (031) 25-9358 Private Bag X40 BETHLEHEM Cato Manor Tech College East London College 9700 Private Bag X06 Private Bag 9016 Tel.: (058) 303-3377 DORMERTON EAST LONDON 4015 5200 Bloemfontein College Tel.: (031) 269-2412 Tel.: (0431) 2-5453 Private Bag X20542 Fax: (0431) 43-0116 BLOEMFONTEIN Centani Tech College 9300 Private Bag X501 Eastside College Tel.: (051) 448-1525 CENTANI PO Box 53636 Fax: (051) 447-0486 4980 TROYEVILLE 2139 Boksburg College for Centurion College Tel.: (011) 614-4125 Vocational Education Private Bag X1018 Private Bag X08 CENTURION Edendale Technical College BOKSBURG 0140 Private Bag X204 1460 Tel.: (012) 664-5591 EDENDALE Tel.:(011) 52-7907 Fax: (012) 664-0166 4505 Fax: (011) 52-8937 Tel.: (0331) 99-3663 Clydesdale Tech College Border Technical College PO Box 132 Ellisras Technical College Private Bag X9004 UMZIMKULU Private Bag X210 EAST LONDON 4660 ELLISRAS 5200 Tel.: (0536) 341-906 0555 (0014) 763-2252 Tel.: (0431) 43-5177 Tel.: Community Tech College Brits Engcobo Technical College Brakpan College Private Bag X2060 Private Bag X10 BRITS Private Bag X6309 BRAKP AN 0250 ENGCOBO 1540 Tel.: (01211) 20788 5050 Tel.: (0472) 481-105 Tel.: (011) 740-0204 De Aar Campus (0472) 481-105 Fax: (011) 740-9188 Fax: Private Bag X1009 C.N. Mahlangu Tech College DE AAR Enyenyezi Technical College Private Bag X814 PO Box 681 7000 MARBLE HALL Tel.: (05363) 60594 PORT SHEPSTONE 0450 4240 Tel.: (039) 685-5482 Tel.: (0137) 73-1324 Fax: (039) 685-4135 247 Ermelo College Highveld Technical College Kempton College Private Bag X9048 Private Bag X5 Private Bag X07 ERMELO LANGLAAGTE KEMPTON PARK 2350 2102 1620 Tel.: (01781) 5824 Tel.: (011) 474-2080 Tel.: (011) 972-4247 Evander Technical College Hillside View College Kimberley College Private Bag X1007 Private Bag X20-509 Private Bag X5028 EVANDER BLOEMFONTEIN KIMBERLEY 2280 9300 8300 Tel.: (0136) 22388 Tel.: (051) 35-2828 Tel.: (0531) 711-056 Fax: (051) 35-7602 Fax: (0531) 711-177 Ezakheni Technical College Private Bag X10022 Ighayiya College King William's Town Tech College LADYSMITH PO Box 14038 Private Bag X7409 3370 SIDWELL KING WILLIAM'S TOWN Tel.: (0361) 341020 6016 5600 Tel.: (041) 42-2085 Tel.: (0433) 23152 Ezibeleni Technical College PO Box 277 Isidingo Technical College Klerksdorp College EZIBELENI Private Bag X01 Private Bag X5013 5321 DAVEYTON 'CLERKS DORP Tel.: (0479) 32106 1507 2570 Tel.: (011) 424-2107 Tel.: (018) 462-8923 George Tabor Tech College Fax: (011) 424-2107 PO Box 895 Kroonstad College ROODEPOORT Itemoheleng Tech College Private Bag X22 1725 Private Bag X07 KROONSTAD Tel.: (011) 982-1002 PHUTHADITJHABA 9500 9866 Tel.: (0562) 25157 George Tech College Tel.: (058) 713-0296 Fax: (0562) 27815 Private Bag X6548 GEORGE Johannesburg Tech College Krugersdorp College 6350 PO Box 17000 Private Bag X2004 Tel,: (0441) 74-2360 DOORNFONTEIN KRUGERSDORP 2028 1740 Germiston College Tel.: (011) 402-2990 Tel.: (011) 953-1140 Private Bag X1030 Fax: (011) 402-2991 GERMISTON Kudube Manpower Centre 1400 John Knox Bokwe Careers College Private Bag X494 Tel.: (011) 825-3524 Private Bag X024 HAMMANSKRAAL MDANTSANE 0400 Giyani Technical College 5219 Tel.: (01464)2151 Private Bag X9570 Tel.: (0403) 61-1792 GIYANI Kwa Nobuhle College 0826 Jouberton Technical College Private Bag X72 Tel.: (0158) 23221 Private Bag X7 UITENHAGE FREEMANVILLE 6230 Grahamstown Technical College 2573 Tel.: (041) 992-3460 PO Box 142 Tel.: (018) 465-3133 GRAHAMSTOWN Kwazulu-Natal Midlands 6140 Kathu Technical College Technical College (Midtech) Tel.: (0461) 24939 Private Bag X504 Private Bag KATHU CUMBERWOOD H.B. Tsengwa Technical College 8446 3235 Private Bag X505 Tel.: (05376) 33281 Tel.: (0331) 457-062 WILLOWVALE Fax: (05376) 33091 Fax: (0331) 429-172 5040 Tel.: (047492) 25 (contrm-77 Kwetlisong College Manu Technical College Namakwaland College Private Bag X837 PO Box 119 PO Box 88 WITSIESHOEK FLORIDA OKIEP 9870 1710 8270 Tel.: (058) 713-1330 Tel.: (011) 988-1047 Tel.: (0251) 41360 Fax: (0251) 41603 L.C. Johnson Tech College Mapuzi Technical College Private Bag Private Bag X579 Nelspruit Technical College DALBRIDGE MQANDULI Private Bag X11282 4014 5080 NELSPRUIT Tel.: (031) 301-6734 1200 Mavhoi Technical College Tel.: (013) 741-3016 Ladysmith College Private Bag X1017 Private Bag 9903 DZANANI Newcastle Tech College (Newtek) LADYSMITH 0955 Private Bag X6602 3370 NEWCASTLE Middelburg Technical College Tel.: (0361) 24-782 2940 Private Bag X251861 Fax: (0361) 31-0871 Tel.: (03431) 83041 MIDDELBURG Fax: (03431) 83041 Lazarus Nhlapo Tech College 1050 Private Bag X012 Tel.: (013) 243-2294 Ngqungqushe Tech College KEMPTON PARK Fax: (013) 282-7441 Private Bag X1011 1620 LUSIKISIKI Tel.: (011) 925-1005 Mlumati Technical College 4820 Private Bag X501 Tel.: (0473) 46-1059 Lebowakgomo College MALELANE Private Bag X23 1320 Nolita Technical College CHUENESPOORT Tel.: (01316) 85-0022 PO Box 301 0745 BUTTERWORTH Mmabatho Manpower Centre Tel.: (015) 633-6770 4960 Private Bag X2024 Fax: (015) 633-6589 Tel.: (0474) 62-0700 MMABATHO Lekoa Technical College 8681 Nongoma Technical College Private Bag X3703 Tel.: (0140) 22094 Private Bag X5060 DRIE RIVIERE NONGOMA Molapo Technical College 1935 3940 Tel.: (016) 88-1276 PO Box 164 Tel.: (0358) 31-0358 FLORIDA Lichtenburg College 1710 Northdale Technical College PO Box 55 Tel.:(011) 984-4059 Private Bag X503 LICHTENBURG LAXMI Mount Frere Tech College 2740 3207 Private Bag X9001 (0331) 71-251 Tel.: (01441) 24317 Tel.: Fax: (01441) 23364 MOUNT FRERE 5090 Northern Cape Tech College Maake Technical College Tel.: (04772) 52 Private Bag X5031 Private Bag X4035 Fax: (037) 727-3256 KIMBERLEY TZANEEN 8300 Mpondozankomo Tech College (0531) 31-418 0850 Tel.: Private Bag X7259 (0531) 821-713 Tel.: (0152) 355-3430 Fax: WITBANK Madadeni Technical College 1035 Ntunzuma Technical College Private Bag X5020 Tel.: (0135) 96-1170 Private Bag X506 MADADENI RED HILL Msunduzi College 4071 2951 Private Bag X9032 Tel.: (031) 509-1924/3516 Tel.: (03431) 91182 PIETERMARITZBURG 3200 Tel.: (0331) 94-0235 Fax: (0331) 42-7446 263 Addresses 249 TocimilatrAdleasiciammit, Odi Manpower Centre Potchefstroom Tech College Roodepoort College Private Bag X564 Private Bag X1252 Private Bag X2 MABOPANE POTCHEFSTROOM WESTGATE 0100 2520 1734 Tel.: (01461) 23-380/9 Tel.: (0148) 293-0352 Tel.: (011) 760-1538 Fax: (01461) 25752 Fax: (0148) 294-7683 Fax: (011) 763-5937 Oudtshoorn Tech College Potgietersrus Tech College Russel Road College PO Box 534 PO Box 659 Private Bag X6040 OUDTSHOORN POTGIETERSRUS PORT ELIZABETH 6620 0600 6001 Tel.: (0443) 22-2119 Tel.: (0154) 3054 Tel.: (041) 55-7771 Fax: (041) 55-5436 Paarl College Pretoria College Private Bag X3027 PO Box 26193 Rustenburg Technical College PAARL ARCADIA Private Bag 82086 7620 0007 RUSTENBURG Tel.: (02211) 23-323 Tel.: (012) 326-5241 0300 Fax: (02211) 25-944 Fax: (012) 326-5298 Tel.: (0142) 28-461 Parktown College Pretoria West College of Engineering Sasolburg College Private Bag 2336 Private Bag X03 Private Bag X2009 HOUGHTON PRETORIA-WEST SASOLBURG 2041 0117 9570 Tel.: (011) 643-8421 Tel.: (012) 386-1251/5 Tel.: (061) 76-0463/4 Fax: (011) 643-1020 Protea College Shikoane Matlala Tech College Phalaborwa College Private Bag 9060 Private Bag X4010 Private Bag X01038 CAPE TOWN SESGEGO PHALABORWA 8000 0742 1390 Tel.: (021) 24-4380 Tel.: (01521) 92-1187 Tel.: (01524) 3377 Fax: (021) 23-2589 Fax: (01524) 3379 Sir Val Duncan Tech College Queenstown Technical College Private Bag X1101 Pietersburg Tech College Private Bag X7110 NAMAKGALE PO Box 205 QUEENSTOWN 1391 PIETERSBURG 5320 Tel.: (01524) 69-1529 0700 Tel.: (0451) 82593 Tel.: (0152) 297-2182/3 Fax: (0451) 81406 Siteto Tech College Private Bag X502 Pinetek R.M. Mshuqwana Tech College BIZANA PO Box 304 Private Bag X1247 4800 PINETOWN MOUNT FLETCHER 3600 4770 Sivananda Tech College Tel.: (031) 72-3260 Fax: (0373) 737-3833 Private Bag X507 RED HILL Plessislaer College Randfontein College 4071 Private Bag X9088 Private Bag X17 Tel.: (031) 503-9708 PIETERMARITZBURG RANDFONTEIN 3200 1760 Sivuyile College Tel.: (0331) 98-1177/8 Tel.: (011) 693-3608 Private Bag X1 DURRHEIM Port Shepstone Tech College Richards Bay Tech College 7491 Private Bag X892 Private Bag X5023 Tel.: (021) 637-0606 PORT SHEPSTONE RICHARDS BAY Fax: (021) 633-4539 4240 3900 Tel.: (0391) 4824/5 Tel.: (0351) 41101/2 _ . Tad'turaCollecieslcontisisled) Soshanguve Tech College Swinton Road Tech College Tygerberg College Private Bag X12 Private Bag X32050 Private Bag X1 ROSSLYN MOBENI PANORAMA 0200 4060 7506 Tel.: (01214) 8-9208/9 Tel.: (031) 42-2333 Tel.: (021) 58-1050 Fax: (021) 58-1120 South Cape Tech Inst Technical College of South Africa PO Box 9272 (Technisa) Distance Education Tzaneen College GEORGE Private Bag X7 PO Box 192 6530 PINEGOWRIE TZANEEN Tel.: (0441) 734-903 2123 0850 Fax: (0441) 734-903 Tel.: (011) 886-1531 Tel.: (0152) 307-4438 Fax: (011) 886-7718 Fax: (0152) 307-4439 South Peninsula College Private Bag X003 Techniven College Uitenhage College MUIZENBERG Private Bag X2201 Private Bag X35 7950 SIBASA UITENHAGE Tel.: (021) 788-8373 0970 6230 Fax: (021) 788-2417 Tel.: (0159) 32-489 Tel.: (041) 922-7132 Springs College Teko Technical College Umlazi Technical College Private Bag X21 Private Bag X3018 Private Bag X04 SPRINGS BUTTERWORTH ISIPINGO 1560 4960 4110 Tel.: (011) 815-4804 Tel.: (0474) 62-0711 Tel.: (031) 907-2666 Fax: (031) 907-3141 St Oswald's Tech College Thaba N'Chu Manpower Centre PO Box 1919 Private Bag X10 Umtata Tech College NEWCASTLE THABA N'CHU Private Bag X5011 2940 9780 UMTATA Tel.: (03431) 8-1206 Tel.: (051871) 2136/7/8 5100 Fax: (03431) 8-1262 Tel.: (0471) 35-0937 Thuto Mathale Tech College Standerton Technical College PO Box 114 Upington College Private Bag X2042 SILVERTON Private Bag X5975 STANDERTON 0127 UP1NGTON 2430 Tel.: (012) 801-1010 8800 Tel.: (01331) 2-2180 Tel.: (054) 25-711 Fax: (01331) 2-2159 Tlamoha Tech College Private Bag X79 Usizo College Stellenbosch College SPRINGS PO Box 11662 Private Bag 5012 1560 RANDHART STELLENBOSCH Tel.: (011) 736-4408/6555 1457 7599 Tel.: (011) 905-3531/3562 (021) 887-3027 Tosa Technical College Tel.: Van Der Bijlpark College Fax: (021) 887-0774 Private Bag X95 WELKOM Private Bag X05 Sterkspruit Tech College 9460 VANDERBIJLPARK PO Box 99 Tel.: (057) 395;1301 1900 STERKSPRUIT Fax: (057) 395-1304 Tel.: (016) 33-5644/5 5560 Tseke Mabooe Tech College Vereeniging College Tel.: (04762) 82 Private Bag X4008 Private Bag X035 Strand Technical College SESHEGO VEREENIGING Private Bag X3010 0742 1930 STRAND Tel.: (0152) 232-1261 Tel.: (016) 42-1115 7139 Fax: (016) 22-0746 Tel.: (021) 853-7611 Fax: (021) 854-8756 265 Addresses 261 Technical Co Ile es Vryheid College Western Province Tech College Witbank Tech College PO Box 725 Private Bag X6 Private Bag X7215 VRYHEID HOWARD PLACE WITBANK 3100 7405 1035 Tel.: (0381) 5337 Tel.: (021) 531-2105 Tel.: (0135) 656-2997 Fax: (021) 531-0361 Welkom College Worcester College Private Bag X21 Westlake Technical College Private Bag X3060 WELKOM Private Bag X17 WORCESTER 9460 TOKAI 6849 Tel.: (057) 353-2597/8/9 7966 Tel.: (0231) 70379 Tel.: (021) 701-1340 Fax: (0231) 26769 Fax: (021) 701-1855 Zwelethemba Tech College Wingfield Technical College Private Bag X510 Private Bag X16 ZWETLETHEMBA GOODWOOD 5608 7460 Tel.: (0401) 954-1516 Tel.: (021) 591-3181 Fax: (021) 592-3923 Agricultural Co Ilees The College Head The College Head The College Head Cedara College of Agriculture Glen College of Agriculture Lowveld College of Agriculture Private Bag X9059 Private Bag X01 Private Bag X11283 PIETERMARITZBURG GLEN NELSPRUIT 3200 9360 1200 Tel.: (0331) 33371 Tel.: (05214) 2051 Tel.: (01375) 33064 The College Head The College Head The College Head Potchefstroom College of Agriculture Elsenburg College of Agriculture Grootfontein College of Agriculture Private Bag X804 Private Bag X1 Private Bag X529 POTCHEFSTROOM ELSENBURG MIDDELBURG 2520 7607 5900 Tel.: (0148) 299-6556 Tel.: (021) 88404620 Tel.: (04924) 21113 a - (Address correspondence to The Baragwanath Nursing College Bophelong Nursing College Principal) Private Bag X05 Private Bag X2031 BERTSHAM MAFIKENG Ann Latsky College of Nursing 2013 2745 Private Bag X40 Bophuthatswana College of Nursing AUCKLAND PARK BG Alexander Nursing College Private Bag X2178 2006 Private Bag X43 JOHANNESBURG MAFIKENG Bafokeng Nursing College 2000 2745 Private Bag 363 Carinus Nursing College RUSTENBURG Bonalesedi Nursing College Private Bag X1 0300 Private Bag X7 ROODEPOORT GROOTE SCHUUR 1725 7937 266. Addresses NuriiniColleges (continued) Charlotte Searle Nursing College Groothoek College of Nursing Northdale Nursing College Private Bag X6047 Private Bag X1122 Private Bag 9006 PORT ELIZABETH SOVENGA PIETERMARITZBURG 6000 0727 3200 Ciskei College of Nursing Henrietta Stockdale Nursing College Nursing College of the Free State Private Bag 13303 Private Bag X5051 Private Bag X20520 CAMBRIDGE KIMBERLEY BLOEMFONTEIN 9300 5206 8300 Coronation College of Nursing Iris Marwick Nursing College Otto du Plessis Nursing College Private Bag X01 PO Box 400 Private Bag X7 NEWCLARE PIETERMARITZBURG TYGERBERG 2112 3200 7505 Eastern Cape College of Nursing KaNgwane Nursing College QwaQwa Nursing College Private Bag X6047 Private Bag X1005 Private Bag X833 PORT ELIZABETH KABOKWENI WITSIESHOEK 6000 1245 9870 Edendale Nursing College King Edward VIII Nursing College RI( Khan Nursing College Private Bag X9099 Private Bag Private Bag X004 CHATS WORTH PIETERMARITZBURG CONGELLA 4030 3200 4013 Ernest Oppenheimer Nursing College Lebone Nursing College S.A.M.S. Nursing College PO Box 87 Private Bag X751 1 Military Hospital Private Bag X1022 WELKOM PRETORIA VOORTREKKERHOOGTE 9460 0001 0143 Excelsius College of Nursing Lentegeur College for PS Nursing Private Bag A 19 Private Bag X1 Sarleh Dollie Nursing College Private Bag X14 KLERKSDORP MITCHELL'S PLAIN 2570 7785 TYGERBERG 7505 Frere Nursing College Mangaung Nursing College Private Bag X9023 Private Bag X20556 SG Lourens Nursing College Private Bag X755 EAST LONDON BLOEMFONTEIN PRETORIA 5200 9300 0001 Ga-Rankuwa Nursing College Michaelmas Nursing School Sharley Cribb Nursing College Private Bag X830 PO Box 75 Private Bag X6047 PRETORIA EDENDALE PORT ELIZABETH 0001 4505 6000 Gazankulu Nursing College Natal College of Nursing Private Bag X9658 Private Bag X9089 TARA The H Moross Nursing College GIYANI PIETERMARITZBURG Private Bag X7 0826 3200 RANDBURG Goldfields Nursing College Ngwelezana Nursing College 2125 PO Box 3146 Private Bag X20016 Transkei College of Nursing VALBLUM EMPANGENI Private Bag 1783 3880 UMTATA Grey's Nursing College Nico Malan Nursing College 5100 Private Bag X9001 Private Bag Venda Nursing College PIETERMARITZBURG SURWELL Private Bae X9I9 3200 7762 SHAYANDIMA 0945 2 6 Addresses 253 Welkom Nursing College Weskoppies College of Nursing WELKOM Private Bag X113 9460 PRETORIA 0001 Teacher Training Institutions (Prospective students should take Bochum College of Education College of Continuing Education note that certain of the teacher Private Bg X508 Private Bag X616 training colleges are being investi- BOCHUM PRETORIA gated for purposes of phasing out or 0790 0001 transforming some of them into other training institutions.) Boland College of Education Daveyton College of Education Private Bag X8 Private Bag X47 (Address correspondence to The WELLINGTON BENONI Principal) 7655 1500 Adam's College of Education Bonamelo College of Education Dower College of Education Private Bag X20013 Private Bag X08 Private Bag 6059 AMANZIMTOTI PHUTHADITJHABA SALTVILLE 4125 9866 6059 Algoa College of Education Butterworth College of Education Dr CN Phatudi College of Education PO Box 14489 PO Box 311 Private Bag X1020 SIDWELL BUTTERWORTH BURGERSFORT 6061 4960 1150 Appelsbosch College of Education Cape College of Education Dr WB Rubusane College of Educa- Private Bag X202 Private Bag X2041 tion OZWATINI FORT BEAUFORT PO Box 140 3476 5720 MDANTSANE 5219 Arthur Tsengiwe College of Education Cape Town College of Education Private Bag X527 Private Bag Durban College of Education CALA MOWBRAY Private Bag 11 5455 7705 CONGELLA 4013 Bellville College of Education Cicita College of Education Private Bag X14 PO Box 5034 East Rand College of Education KUILSRIVIER UMTATA Private Bag X52 7580 5100 SPRINGS 1560 Bensonvale College of Education Clarkebury College of Education PO Box 6 PO Box 7 EC Mango College of Education BENSONVALE CLARKEBURY Private Bag X1004 5562 5024 KABOKWENI 1214 Bethel College of Education Clydesdale College of Education Private Bag X3095 Private Bag X5003 Edgewood College of Education BUTTERWORTH UMTATA Private Bag X03 4960 5100 ASHWOOD 360 Bloemfontein College of Education College for Further Education in SA 201 Zastron Street Private Bag X460 BLOEMFONTEIN PRETORIA 9301 0001 raining t bons riaiitinued W Mamokgalake Chuene College of Eshowe College of Education Kagisonong College of Education Private Bag X503 Private Bag X20523 Education ESHOWE BLOEMFONTEIN Private Bag X8629 3815 9300 GROBLERSDAL 0470 Esikhawini College of Education Kathorus College of Education Private Bag X8520 Private Bag X04 Mankwe College of Education ESIKHAWINI LEONDALE Private Bag X1014 3887 1424 MOGWASE 0302 Ezakheni College of Education KwaGqikazi College of Education Private Bag X20018 Private Bag X6059 Mapulaleng College of Education EZAKHENI NONGOMA Private Bag X9399 3381 3950 BUSHBUCKRIDGE 1280 Giyani College of Education Kwena Moloto College of Education Private Bag X9672 Private Bag X4015 Marapayane College of Education GIYANI SESHEGO PO Box 108 0826 0742 TUINPLAAS 0437 Good Hope College of Education Lehurutshe College of Education Private Bag X25 Private Bag X2024 Masibulele College of Education SOMERSET WEST LERATO Private Bag X338 7130 2865 WHITTLESEA 5360 Griffiths Mxenge College of Educa- Lemana College of Education tion Private Bag X310 Matluti College of Education Private Bag X503 ELIM HOSPITAL Private Bag X103 ZWELITSHA 0960 MATATIELE 3608 4730 Lennox Sebe College of Education Hebron College of Education PO Box 685 Mgwenya College of Education Private Bag X1084 KING WILLIAM'S TOWN Private Bag X1008 KANYAMAZAME GA-RANKUWA 5600 0208 1214 Lovedale College for Continuing Hewat College of Education Education Mlundisweni College of Education Kromboom Road Private Bag X1303 PO Mfundisweni CRAWFORD ALICE GLAGSTAFF 4810 7764 5700 Hoxane College of Education Lumko College of Education Modjadji College of Education Private Bag X1008 Private Bag X1173 Private Bag X746 HAZYVIEW LADY FRERE GA-KGAPANE 0838 1242 5100 Mokopane College of Education Indumiso College of Education Madadeni College of Education Private Bag X9077 Private Bag X5001 Private Bag X601 PIETERMARITZBURG MADADENI MAHWELERENG 0626 3200 2951 Johannesburg College of Education Makhado College of Education Moretele College of Education Private Bag X376 27 St Andrew Street Private Bag X1004 MAKAPANSTAD PARKTOWN DZANANI 0404 2193 0970 teacherigalsklekklithltiOasktcontinueck Mount Arthur College of Education Ramaano Mbulaheni Training Centre Sohnge College of Education Private Bag X1123 Private Bag X1303 Private Bag X3093 LADY FRERE TSHAICHUMA WORCESTER 5410 0950 6850 Mphohadi College of Education Rand College of Education South Cape College of Education Private Bag X66 Private Bag X6 Private Bag X646 KROONSTAD LANGLAAGTE OUDTSHOORN 9500 2102 6620 Mpumalanga College of Education Rogge Bay College of Education Soweto College of Education Private Bag X1004 Private Bag X4 PO Box 90064 HAMMERSDALE ROGGE BAY BERTSHAM 3700 8012 2013 Naphuno College of Education Sebokeng College of Education Springfield College of Education Private Bag X1409 Private Bag X095 Private Bag X1045 LENYENYE VEREENIGING DORMERTON 0857 1930. 4015 Natal College of Education Sefikeng College of Education Taung College of Education Private Bag X9007 Private Bag X872 Private Bag X03 PIETERMARITZBURG WITSIESHOEK PUDIMOE 3200 9870 8584 Ndebele College of Education Sekgosese College of Education Thaba Moopo College of Education Private Bag X4011 Private Bag X1375 Private Bag X56 SIYABUSWA SOEKMEKAAR LEBOWA KGOMO 0472 0810 0737 Ntuzuma College of Education Sekhuklume College of Education Thaba N'chu College of Education Private Bag X02 Private Bag X08 Private Bag X717 KWAMASHU APEL SELOSHESHA 43 60 0739 9785 Perseverance College of Education Setotolwane College of Education Tivumbeni College of Education Private Bag X5027 Private Bag X7372 Private Bag X1420 KIMBERLEY PIETERSBURG LETABA 8300 0700 0870 Phatsimang College of Education Shawbury College of Education Tlhabane College of Education Private Bag X5047 PO Shawbury Private Bag X2003 KIMBERLEY QUMBU TLHABANE 8300 5187 0305 Potchefstroom College of Education Shingwedzi College of Education Transkei College of Education 37 Borcher Street Private Bag X1156 Private Bag X5111 POTCHEFSTROOM MALAMULELE UMTATA 2520 0982 5100 Pretoria College of Education Sigean College of Education Transvaal College of Education Private Bag X382 Private Bag X514 Private Bag X11 PRETORIA FLAGSTAFF SOSHANGUVE 0001 4810 0152 256 Addresses: Teacher TrainitiInstitutions con 'nuedi Transvaal College of Education Tshiya College of Education Umlazi College for Further Education Private Bag X2 Private Bag X809 Private Bag X08 LAUDIUM WITSIESHOEK MOBENI 0037 9870 4060 Tshisimani College of Education Umbumbulu College of Education Venda College of Education Private Bag X1302 Private Bag X20012 Private Bag X2269 TSHAKHUMA AMANZIMTOTI SIBASA 0951 4125 0970 Addresses 271 257 STUDENT'S GUIDE TOHIGHER EDUCATION IN SOUTH AFRICA with occupations, study opportunities,bursaries R79.95 and / or STUDENT'S GUIDE TODISTANCE EDUCATION IN SOUTHAFRICA R49.95 Compiled by the Human Sciences Research Council ORDER FORM HUMAN SCIENCES RESEARCH COUNCIL HSRC PO Box 5556, PRETORIA 0001 Tel: (012) 302 2485/2004 RGN Fax: (012) 302 2933 E-mail: [email protected] Price inclusive of VAT All orders outside South Africa: Payment must be made in US dollars UNIT PRICE AMOUNT TITLE QUANTITY 25% overseas postage and handling fee (surface mail) TOTAL PAYMENT ENCLOSED: PLEASE DEBIT MY MASTERNISA CARD NO. EXPIRY DATE: SIGNATURE: NAME: ADDRESS: CODE: 27 2 TEL NO: STUDENT'S GUIDE TO HIGHER EDUCATION IN SOUTH AFRICA 1998 Everything a school leaver needs to know about making a decision to get tertiary training Information on how to choose a career Short descriptions on occupations according to field of interest Comprehensive course information on universities, technikons, technical and private colleges Address details for all categories of tertiary institutions Gmnpikr/ 14,7arb A list of bursaries available Useful indexes to occupations, fields of study and bursaries 1998 Information updated and published annually g3IPCiffoln,0933 ((71,14/td,fro STUDENT'S GUIDE TO DISTANCE. EDUCATION IN SOUTH AFRICA 1998 A comprehensive guide to distance courses and institutions Comprehensive course information for distance learning institutions Address details for distance learning institutions Useful indexes to fields of study and distance institutions showing courses listed Information updated and published annually VISIT SOUTH AFRICA'S MOST COMPREHENSIVE EDUCATION AND TRAINING WEB SITE http://www.careers.co.za Regular updating of course information National and international education links Easy searches for courses and bursaries , t r. Iscor Mining is really going,placbs.1Ne have set our sights on theongoing expansion of Iscor's reserves, both locally andinternationally and arein constant.: pie who -can helprrc alisemyr vision. Since we rely heavily milOration arkrreSearch, the training of prospe ctive Mining Engineers is p priority. We furthermore offer anually anumber oi bursaries to perfornts*.e diiveRcandidOtes interested in the followingdisciplines; B Eng Mining B Eng Civil B Eng Metallurgy B Eng Industrial B Eng Mechanical B Eng Geology B Eng E lectrical toe,'The skdy bursary uwers -registration ad dcIss fees as well as at adieu fees. Also included is a zuskl olinviume for books, a sdentific cofactor and computer :illicitly. Our first interest is in imikated people wito are son othieying 67/0 en Om highergrad/ifirMothematici End Physinui Sdente. p' RIM ger, HMO Resources Q ursaies), PO Box 9229, l!rtforito, Cr01 'De lei: QM 2) 672 6667, 672 6625 Fox: (012) 672 668 [email protected] (4. O U.S. DEPARTMENT OF EDUCATION Office of Educational Research and Improvement (OERI) Educational Resources information Center (ERIC) IC NOTICE REPRODUCTION BASIS This document is covered by a signed "Reproduction Release (Blanket)" form (on file within the ERIC system), encompassing all or classes of documents from its source organization and, therefore, does not require a "Specific Document" Release form. This document is Federally-funded, or carries its own permission to reproduce, or is otherwise in the public domain and, therefore, may be reproduced by ERIC without a signed Reproduction Release form (either "Specific Document" or "Blanket").