www.boaa.net.au/tickets Tickets from $25 BALLARAT 21Sep-6Nov (2 daypass) 2018 solo exhibitionsover6weeks. ever. 50artists65curated showcase ofAustralianArt BOAA willbethelargest

Image: Pimpisa Tinpalit - Victoria A r t Almanac October 2018 $6

Rob McHaffie Oceans From Here Halinka Orszulok

, 1995, metal, wire, enamel paint, synthetic polymer 9.6 x 9 4.7cm Untitled #083b

ROBERT KLIPPEL

Suite 4, 8 Soudan Lane poetically microscopic Paddington NSW 2021 sculptures and works on paper t+6193324614 e [email protected] 18 October - 17 November 2018 w annettelarkin.com

Art Almanac October 2018

We acknowledge and pay our respect to the many Subscribe Aboriginal nations across this land, traditional custodians, Elders past and present; in particular the (VWDEOLVKHG LQ  ZH DUH $XVWUDOLDnV ORQJHVW UXQQLQJ PRQWKO\ DUW JXLGH DQG WKH VLQJOH SULQW Guringai people of the Eora Nation where Art Almanac GHVWLQDWLRQ IRU DUWLVWV JDOOHULHV DQG DXGLHQFHV has been produced.

$UW $OPDQDF SXEOLVKHV  LVVXHV HDFK \HDU :K\DUHZHKHUH"%HLQJDKXPDQRQSODQHW 9LVLW RXU ZHEVLWH WR VLJQXS IRU RXU IUHH ZHHNO\ H1HZVOHWWHU (DUWKVHHPVWRSUHRFFXS\WKHDUWLVWVLQWKLV LVVXHIURPWKHSDVVDJHRIWLPHLQWKHZRUNRI 7R VXEVFULEH JR WR DUWDOPDQDFFRPDX -HQQ\6DJHVWR+DOLQND2UV]XORNnVREVHUYDWLRQ RU P\PDJD]LQHVFRPDX WKDWWKHWUDQVLWLRQRIQLJKWIDOODOWHUVVSDFHLQ P\VWHULRXVZD\V5RE0F+DIíHKDVFUHDWHG VRPHRIKLVPRVWOLWHUDOSDLQWLQJVWRGDWH DVKHVD\Vm,GRQnWWKLQNVXUUHDOLVPUHDOO\ WRXFKHVXSRQWKHZHLUGQHVVRIHYHU\GD\OLIH :KDWZHnYHFRQVWUXFWHGDVKXPDQVLVZRUWK Deadline for November 2018 issue: ORRNLQJDWDQGUHîHFWLQJXSRQn:HDOVR Wednesday 3 October, 2018. FRQVLGHUWKHJURXQGZKHUHOLIHXQIROGVLQ m2FHDQV)URP+HUHnDQG$OLFLD)UDQNRYLFKnV VKRZm([RSODQHWnZKLFKLQYHVWLJDWHWKH $QWKURSRFHQH

Contact

(GLWRUr&KORH0DQGU\N FPDQGU\N#DUWDOPDQDFFRPDX 'HSXW\(GLWRUr.LUVW\0XOKROODQG LQIR#DUWDOPDQDFFRPDX $UW'LUHFWRUr3DXO6DLQW 1DWLRQDO$GYHUWLVLQJr/DUDLQH'HHU OGHHU#DUWDOPDQDFFRPDX Cover 'LJLWDO(GLWRUr0HOLVVD3HVD 5RE 0F+DIíH Word of mouth (Half Moon Bay) PSHVD#DUWDOPDQDFFRPDX GHWDLO   RLO RQ OLQHQ  [ FP (GLWRULDO$VVLVWDQWr3HQQ\0F&XOORFK &RXUWHV\ WKH DUWLVW DQG 7KH *DOOHU\ DW %D\VLGH OLVWLQJ#DUWDOPDQDFFRPDX $UWV &XOWXUDO &HQWUH 0HOERXUQH (GLWRULDO,QWHUQr6DLUD.ULVKDQ $FFRXQWVr3HQQ\0F&XOORFK DFFRXQWV#DUWDOPDQDFFRPDX 7 ) /RFNHG%DJ6W/HRQDUGV16: DUWDOPDQDFFRPDX

5 Art in Australia 1HZVDQG%RRNVr$UW$OPDQDFWHDP

Oceans From Herer1DRPL5LGGOH 5RE0F+DIíHThis is livingr&KORH0DQGU\N +DOLQND2UV]XORNr+DQQDK5REVRQ-HQNLQV $OLFLD)UDQNRYLFKExoplanetsr7HVV0DXQGHU -HQQ\6DJHVLest I Forgetr=R\D3DWHO

6HOHFWH[KLELWLRQSUHYLHZVr$UW$OPDQDFWHDP

Art & Industry $UWLVW2SSRUWXQLWLHVDQG$ZDUGV 6XEPLVVLRQVDQG3URSRVDOV 0DWHULDOV 6HUYLFHV &RQVXOWDQWVDQG9DOXHUV 0HPEHU2UJDQLVDWLRQV 7UDLQLQJ 3XEOLFDWLRQV

What’s On *DOOHU\,QGH[ 0HOERXUQH 9LFWRULD 6\GQH\ 1HZ6RXWK:DOHV $XVWUDOLDQ&DSLWDO7HUULWRU\ 7DVPDQLD 6RXWK$XVWUDOLD :HVWHUQ$XVWUDOLD 1RUWKHUQ7HUULWRU\ 4XHHQVODQG $UWLVW,QGH[

6 GLENN MORGAN

35 Derby Street Collingwood VIC 3066 Open 7 days 10am to 6pm Fletcher Jones Project T 03 9417 4303 melbourne@australiangalleries.com.au 23 October - 11 November 2018 australiangalleries.com.au A USTRALIAN G ALLERIES Member Art Galleries Association of Australia MELBOURNE Male fashion parade 1930 2017 Vipond paint, wood, tin & screws 60 x 70 x 6 cm EXHIBITION AT LAKESIDE JOONDALUP SHOPPING CITY – MYER COURT Sunday 14 – Sunday 28 October 2018

FEATURING: Jennifer COCHRANE Sarah ELSON Caspar FAIRHALL Emily HORNUM Eveline KOTAI Leonie Ngahuia MANSBRIDGE Amanda MARSH Ellen NORRISH Mark PARFITT Andy QUILTY Trevor RICHARDS Susan ROUX Susannah SKINNER Sioux TEMPESTT Gera WOLTJER by Kimberley Pace, 2017 credit: Artwork For further information visit joondalup.wa.gov.au or call 9400 4924. As Seen on TV (detail) (detail) TV on Seen As

CATHERINE TRUMAN: NO SURFACE HOLDS - JAMFACTORY ICON 2017 21 SEPT – 18 NOV

A JamFactory touring exhibition

Catherine Truman’s practice incorporates contemporary jewellery, objects, digital image and film installation with a focus upon the parallels between artistic process and scientific method. Also on display: ANNE FERRAN: INTIMATE JOURNALS, Uncover stories within the pages of the Bundanon Library

Catherine Truman, Glove Dissection: Anatomise, 2015, Digital still image from experimental film. Depicting skilled biomedical researcher dissecting glove from my hand in the Autonomic Neuroscience laboratory, School of Medicine, Flinders University mprg.mornpen.vic.gov.au HERTHA KLUGE-POTT

35 Derby Street Collingwood VIC 3066 Open 7 days 10am to 6pm Recent Work T 03 9417 4303 23 October - 11 November 2018 [email protected]

australiangalleries.com.au A USTRALIAN G ALLERIES Member Art Galleries Association of Australia MELBOURNE

The other side of a time - he 2017 drypoint on Hahnemühle paper 64 x 44.5 cm edition 10

DFU\OLFRQFDQYDV[FP Earth and Sky

“The exhibition reveals my love of the gestural brush mark and moving EHWZHHQÀJXUDWLYHDQGQRQÀJXUDWLYHPRWLIV LQ VXEMHFW PDWWHU FRYHULQJ WKHSHULRGµ Exhibition: 26th September - 28th October 2018 Cessnock Regional Art Gallery 9LQFHQW6WUHHW&HVVQRFN16:    *DOOHU\ RSHQLQJ KRXUV 7XHVGD\  6XQGD\ DP  SP

FHVVQRFNUHJLRQDODUWJDOOHU\ LQIR#FUDJQHWDX FUDJQHWDX Art in Australia

14 Contour 556 6L[W\$XVWUDOLDQDQGLQWHUQDWLRQDODUWLVWVZLOOSDUWLFLSDWHLQ&DQEHUUDnVSXEOLFDUWELHQQLDO m&RQWRXUnIURPWR2FWREHU&XUDWHGE\ODQGVFDSHDUFKLWHFW1HLO+REEVWKHHYHQWZLOO VHHZRUNVE\(PPD%HHU$OH[$VFK%\UG$OH[DQGHU%R\QHV.DHO6WDVFH&KULV&DUPRG\ 'DQ/RUULPHU$OH[6HWRQ5RVDOLQG/HPRKDQGRWKHUVLQVSLUHGE\WKHORFDOHQYLURQPHQWDQG LWVKLVWRU\,QDGGLWLRQWRH[SORULQJWKHVLWHVSHFLíFLQVWDOODWLRQVDXGLHQFHVFDQDGGWRWKHLU H[SHULHQFHZLWKWDONVDQGSHUIRUPDQFHVRUDWWHQGDIRUXPRQSXEOLFDUWDQGVSDFHRQ)ULGD\ 2FWREHUZKLFKWLHVLQWRWKH JXLGLQJSULQFLSOHRIm&RQWRXU nmWRWUDQVIRUPKRZ YLHZHUVUHPHPEHURUUHFDOO WKH&DQEHUUDODQGVFDSHe VHDUFKLQJIRUDOLQNEHWZHHQ DUWDQGWKHSODFHWKH\ H[SHULHQFHGLWLQnVD\V+REEV contour556.com.au

+DULMV3LHNDOQVManifest Submersion ZHOGHGDQGIROGHGm6XSHU0LUURUn PPVWDLQOHVVVWHHORFKUH$XVWUDOLDQ KDUGZRRG )DEULFDWHGE\6WHHO

,PPHUVH\RXUVHOILQDVRQLFZDYH RISODVWLFNH\ERDUGVSOD\LQJLQ XQLVRQRUVWHSLQWRWKHVKRHVRID UHIXJHHKHOGLQGHWHQWLRQWKURXJKWKH FRQVROHVRIDYLGHRJDPH([SHULHQFH DVWUDQJHUnVHPEUDFHIHDUWKHULVHRI WKHPDFKLQHRUmIHPERWnRUHVFDSHWR DYLVLRQDU\PDWULDUFKDOIXWXUHLQVSLUHG E\)LUVW1DWLRQVFXOWXUDOSUDFWLFHV performancespace.com.au

6X:HQ&KL,QíQLW\0LQXV2QH 3KRWRJUDSK(WDQJ&KHQ &RXUWHV\WKHDUWLVWDQG3HUIRUPDQFH6SDFH6\GQH\ 15 Spectra m6SHFWUDnSUHVHQWHGE\WKH$XVWUDOLDQ1HWZRUNIRU$UWDQG7HFKQRORJ\GUDZVRQWKHLQWHUDFWLRQV RI$XVWUDOLDQDQG1HZ=HDODQGDUWLVWVDQGVFLHQWLVWVZKRKDYHFRPHWRJHWKHUWRVKDUHNQRZOHGJH DQGH[SORUHFUHDWLYLW\IURPWKHLUGLYHUVHSHUVSHFWLYHVZLWKDQLQWHUGLVFLSOLQDU\DSSURDFK

7KURXJKRXW2FWREHUDFURVVYDULRXV$GHODLGHYHQXHVm6SHFWUDnVKRZVXVQHZZD\VRIVHHLQJ H[SHULHQFLQJDQGLQWHUSUHWLQJWKHZRUOGZHOLYHLQ+LJKOLJKWVLQFOXGHm7KH$UWDQG&RQVHTXHQFH RI&ROODERUDWLRQnDQH[KLELWLRQFXUDWHGE\([SHULPHQWD0HGLD$UWVLOOXVWUDWLQJWKHFUHDWLYH SRWHQWLDORIFROODERUDWLYH LQYHVWLJDWLRQDW6RXWK$XVWUDOLDQ 6FKRRORI$UW*DOOHU\ 6$6$ $ WKUHHGD\V\PSRVLXPKRVWHGE\DUW DQGVFLHQFHLQGXVWU\GHOHJDWHVDW WKH8QLYHUVLW\RI6RXWK$XVWUDOLD DQGDOLYHO\SXEOLFSURJUDPRIWDONV VFUHHQLQJVVSHFLDOHYHQWVDQGDRQH QLJKWRQO\SHUIRUPDQFHE\$*DOD[\ RI6XQV

spectra.org.au

'HVLJQHGE\/HDK+HLVVIRU%ODPH\6DXQGHUVKHDUV Facett 3KRWRJUDSK0DWW+DUYH\ &RXUWHV\WKHDUWLVWDQG$XVWUDOLDQ1HWZRUNIRU$UW  7HFKQRORJ\6RXWK$XVWUDOLD This Wild Song ,ORQD1HOVRQnVODWHVWH[KLELWLRQm7KLV:LOG6RQJnFXUUHQWO\RQVKRZDW7RZQ+DOO*DOOHU\ +DZWKRUQLQ0HOERXUQHXQWLO2FWREHULVDYLEUDQWFHOHEUDWLRQRIZRPHQLQWKHDUWV$VSDUWRI DORQJWHUPSURMHFWWRSKRWRJUDSK$XVWUDOLDQIHPDOHDUWLVWV1HOVRQSUHVHQWVRYHUSRUWUDLWV RIZRPHQDUWLVWVIURPGLYHUVHEDFNJURXQGVZRUNLQJDFURVVDUDQJHRIFUHDWLYHPHGLXPVFKRVHQ IRUWKHLUXQLTXHDUWLVWLFVW\OHVrFKDQQHOHGWKURXJKWKHIHPDOHOHQV1HOVRQFDSWXUHVWKHHVVHQFH RIKHUVXEMHFWVE\LQIXVLQJYLVXDO DVSHFWVPRWLIVDQGODQJXDJH GUDZQIURPWKHLULQGLYLGXDO DUWVSUDFWLFH7KHJDOOHU\nV$IWHU 'DUNHYHQWRQ)ULGD\2FWREHU IURPSPSDLUVWKHH[KLELWLRQ ZLWKOLYHHQWHUWDLQPHQWE\ORFDO PXVLFLDQVDQGRIIHUVYLVLWRUV WKHFKDQFHWRPHHWWKHDUWLVWV DQGFXUDWRUV

boroondara.vic.gov.au

Megan EvansLQNMHWSULQWRQ&DQVRQ 3ODWLQHSDSHUPRXQWHGRQ'LERQG[FP ƒWKHDUWLVW &RXUWHV\WKHDUWLVWDQG7RZQ+DOO*DOOHU\ 0HOERXUQH

16 Biennale of Australian Art 7KHm%LHQQDOHRI$XVWUDOLDQ$UWn %2$$ VKRZFDVHVRYHUFRQWHPSRUDU\DUWLVWVIURPDURXQG WKHFRXQWU\DFURVVWKUHHGHVLJQDWHGDUWYLOODJHVLQWKH9LFWRULDQWRZQRI%DOODUDW2QXQWLO 1RYHPEHUWKHIHVWLYDOFRYHUVH[KLELWLRQVWDONVPXVLFYLGHRSURMHFWLRQSHUIRUPDQFHDQGWKH ZULWHUnVIHVWLYDO+LJKOLJKWV$UW&DPSSURMHFWVDWWKH0LQLQJ([FKDQJHZKHUHHDFKZHHNWZR DUWLVWVZLOOFUHDWHODUJHVFDOHZRUNVWKURXJKGUDZLQJSDLQWLQJDQGLQVWDOODWLRQ7KH$UW*DOOHU\ RI%DOODUDWnVm%2$$$UWnH[KLELWLRQSUHVHQWVZRUNVE\0DUOHQH*LOVRQ1XPLQD6LVWHUV 3LS 3RS'DYLG-HQV]*HUZ\Q'DYLHV-DVRQ6LPVWRQDPHDIHZ:KLOH6W$QGUHZnV+DOOWKH *HRUJH)DUPHU%XLOGLQJ%DOODUDW:HOFRPH&HQWUHWKH(XUHND6WRFNDGHDQGVHYHUDORWKHU YHQXHVDOVRKRVWDGLYHUVHOLQHXSRIDUWLVWVLQFOXGLQJ0DULQD3XPDQL%URZQZLWKSDLQWLQJZRUN ZKLFKFDSWXUHVFXOWXUDONQRZOHGJH

0DULQD3XPDQL%URZQ 6$ Ngayuku Ngura Kuwari (My Home Now)DFU\OLFRQOLQHQ[FP &RXUWHV\WKHDUWLVWDQG%LHQQDOHRI$XVWUDOLDQ$UW9LFWRULD 17 Clare Belfrage: Rhythms of Necessity Kay Lawrence and Sera Waters

m5K\WKPVRI1HFHVVLW\nLVWKHíUVWPDMRUƒ‡ϐ‹‡Ž†”‡•• SXEOLFDWLRQIRUDUWLVW&ODUH%HOIUDJH %HJLQQLQJZLWKUHîHFWLRQVRQFKLOGKRRG DQGIDPLO\OLIHWKLVPRQRJUDSKWUDFHVKHU MRXUQH\IURPmIDOOLQJLQWRDUWnDWD\RXQJDJH WRDVLJQLíFDQWFDUHHULQWKHíHOGRIVWXGLR JODVVDUW

&RPELQLQJDVHULHVRIWH[WVE\.D\/DZUHQFH DQG6HUD:DWHUVZLWKDVHOHFWLRQRI SKRWRJUDSKVRIWKHDUWLVWDVZHOODVLPDJHV RIKHUXQLTXHJODVVZRUNHGYHVVHOVDQGJODVV GUDZLQJVWKLVERRNFKDUWVWKHGHYHORSPHQW RI%HOIUDJHnVWHFKQLTXHVDQGSUDFWLFHRYHU \HDUVDQGUHYHDOVKHUGHHSIHOWVHQWLPHQWVIRU WKHUK\WKPVDQGîRZVRIOLIHDQGWKHQDWXUDO ZRUOGWKDWLQVSLUHKHUZRUN

Helen Johnson: Warm Ties

†‹–‡†„› —Ž‹‡––‡‡•‘”‰—‡• ƒ†ƒŽ‹ƒ‹œ •–‹–—–‡‘ˆ‘–‡’‘”ƒ”›”–•ǡ‘†‘ +HOHQ-RKQVRQnVGHQVHO\OD\HUHGODUJHVFDOHƒ†”–•’ƒ ‡ǡ›†‡› FDQYDVHVH[SORUHWKHFRPSOH[LW\RIWKHFRORQLDO UHODWLRQVKLSEHWZHHQ$XVWUDOLDDQG%ULWDLQ +HUH[KLELWLRQm:DUP7LHVnZDVFRPSULVHGRI VL[QHZO\FRPPLVVLRQHGZRUNVWKDWUHVLWXDWH WKFHQWXU\LPDJHVRIWKHZKLWHPDQDVDQ LPSHULDOLVWEUXWHDV\FRSKDQWDQGDJUHHG\ VROLSVLVW,QRQHSDLQWLQJDPDQSOHDVXUHV KLPVHOIDVWKHO\ULFVWRWKH$XVWUDOLDQQDWLRQDO DQWKHPDUHZKLVSHUHGLQWRKLVHDUDSRUWUDLW RI4XHHQ9LFWRULDFORDNHGLQVKDFNOHVORRNV RQZKLOHLQDQRWKHUWKHZRUNLQJFODVV JHWmVFUHZHGnE\WKHZHDOWK\HOLWHIXUWKHU HPSKDVLVHGE\GROHOLQHVPRQH\QRWHVDQG VXEWOH\HWSURYRFDWLYHOHJVSUHDGV,QVWDOO VKRWVDQGGHWDLOHGYLHZVíOOWKHSDJHVRIWKLV DFFRPSDQ\LQJSXEOLFDWLRQH[SODLQHGLQWH[WV E\6WHSKHQ*LOFKULVWDQG+HOHQ+XJKHV

18 Ryan Presley

”‘•’‡”‹–› m3URVSHULW\UHPLQGVXVWKDWWKH:HVWHUQ •–‹–—–‡‘ˆ‘†‡””–ǡ”‹•„ƒ‡ QDUUDWLYHRIFDSLWDOLVPDQGWKHFORVHO\ DVVRFLDWHGOLEHUDOLGHDVRIVRFLDOSURJUHVV GHPRFUDF\DQGVHOIGHWHUPLQDWLRQKDYH EHHQEXLOWRQWKHH[FOXVLRQRI,QGLJHQRXV HFRQRPLHVnZULWHV0DGHOHLQH.LQJZKR FXUDWHG5\DQ3UHVOH\nVíUVWPDMRUVROR H[KLELWLRQDW,QVWLWXWHRI0RGHUQ$UWHDUOLHU WKLV\HDU,QWKHVHSDJHVZHVHHWKHVKRZ GRFXPHQWHGZLWKUHSURGXFWLRQVRIKLVíQHO\ SDLQWHGDQGLQFLVLYHO\FRPSRVHGBlood Money VHULHV  DVZHOODVIXOOSDJHGHWDLOV DOORZLQJWKHYLHZHUJUHDWHULQVLJKWLQWRWKH SDWWHUQLQJDQGWKRXJKWIXOV\PEROLVPRIWKHVH ZRUNVZKLFKGHSLFWLFRQVRIWKH$ERULJLQDO UHVLVWDQFH&RQWULEXWLRQVIURP7LQD%DXP 'DQLHO%URZQLQJ6XYHQGULQL3HUHUDDQGWKH DUWLVWH[SORUHWKHKLVWRULFDOJURXQGLQJDQG FDSWLYDWLQJDHVWKHWLFRIWKHZRUN

Gemma Smith

‘—† ”‘—† m'RJHDUHGnSDJHVDUHQnWXVXDOO\V\QRQ\PRXV ‘”‹•–†‹–‹‘• ZLWKKLJKHQGDUWSXEOLFDWLRQV+RZHYHU m)RXQG*URXQGnVnHOHJDQWDQGFOHYHUGHVLJQ FHOHEUDWHVWKHIRUPDODQGFRQFHSWXDO XQGHUSLQQLQJVRI*HPPD6PLWKnVSUDFWLFH ZLWKHQHUJ\WKDWLVH[FLWLQJIRUWKHLQLWLDWHG DQGWKRVHGLVFRYHULQJWKHDUWLVWnVDSSURDFK WRSDLQWLQJ)ROGHGFRUQHUVGLYLGHWKHOLPLWHG HGLWLRQWLWOHnVFKDSWHUVZKLFKWUDYHUVH UHSURGXFWLRQVDQGDQHVVD\E\-XOLH(ZLQJWRQ VXUYH\LQJWKHQXDQFHDQGYLJRXURI6PLWKnV ZRUN(ZLQJWRQZULWHVm7KHSULPDU\SOHDVXUH WKDW6PLWKRIIHUVZLWKKHUSDLQWLQJVeLVWKH VXUSULVHRISHUFHLYLQJFRORXULPPHGLDWHO\ DQGGLUHFWO\e:HDUHMROWHGLQWRIUHVKZD\V RIORRNLQJLQWRDFWXDOO\ZRUNLQJDWWKH EXVLQHVVRISHUFHLYLQJWKHZRUOG,WnVDZD\RI EHLQJDOLYHn

19

Master of Stillness: Jeffrey Smart

†‹–‡†„›ƒ””›‡ƒ” ‡ m0DVWHURI6WLOOQHVVnGRFXPHQWVWKHSUDFWLFHƒ‡ϐ‹‡Ž†”‡•• RIH[SDWULDWH$XVWUDOLDQSDLQWHU-HIIUH\6PDUW IURPKLVEHJLQQLQJVLQ$GHODLGHXQWLOKLVODVW PDMRUFRPSRVLWLRQLabyrinth  SDLQWHG LQ,WDO\ZKHUHKHOLYHGXQWLOKLVGHDWKLQ ,OOXVWUDWHGZLWKSDLQWLQJVRIXUEDQODQGVFDSHV VWXGLRVKRWVZLWKWKHDUWLVWDWZRUNDVZHOO DVSHUVRQDODQGSURIHVVLRQDOSKRWRJUDSKV WKLVERRNSURYLGHVDXQLTXHLQVLJKWDQG XQGHUVWDQGLQJRI6PDUWnVFDUHHU&XUDWRU %DUU\3HDUFHTXHVWLRQVm:KDWZDVWKHJHQHVLV RI6PDUWnVSUHRFFXSDWLRQZLWKSDUDOOHOOLQHV FXEHVVSKHUHVFXUYHVDQGUHFWDQJOHV DVWKHIRXQGDWLRQRIKLVYLVXDOODQJXDJH" $QGIURPZKHUHFDPHKLVLQFOLQDWLRQWR WUDQVIRUPDFRROG\VWRSLDQYLVLRQRIWKH WKFHQWXU\FLW\DQGLWnVWHFKQRORJLHVLQWRD VWDUWOLQJQHZDHVWKHWLF"n

Godwin Bradbeer

ƒ‡– ‡œ‹‡ (VVD\VE\-DQHW0F.HQ]LHíOWHUWKURXJKRXWŠƒ‡•Ƭ —†•‘ WKHSDJHVRIWKLVULFKO\LOOXVWUDWHGSXEOLFDWLRQ DVGRFXPHQWDWLRQRI0HOERXUQHEDVHG DUWLVW*RGZLQ%UDGEHHUnVFDUHHUDQGWKH GHYHORSPHQWRIKLVSUDFWLFHIURPWKHV XQWLOQRZ7KHERRNGLVSOD\VDPDJQLíFHQW VFUHHQLQJRI%UDGEHHUnVH[WUDRUGLQDU\ íJXUDWLYHZRUNVDQGLQFOXGHVWZRLQIRUPDWLYH LQWHUYLHZVEHWZHHQDUWLVWDQGDXWKRU UHJDUGLQJKLVLQVSLUDWLRQVREVHUYDWLRQVDQG PHWKRGVDQGWKHLPSRUWDQFHRIWHDFKLQJ ZLWKLQKLVíHOG0F.HQ]LHLQIRUPVDGHHSHU XQGHUVWDQGLQJRIWKHFRQWH[WRI%UDGEHHUnV XQLTXHGUDZLQJFRQFHSWVZKHUHE\KH SURGXFHVODUJHVFDOHUHSUHVHQWDWLRQVRIWKH KXPDQIRUPFUHDWHGZLWKDSUHGRPLQDQWXVH RIWKHPHGLXPV&KLQDJUDSKSHQFLOSDVWHO DQGVLOYHUR[LGH

21

Oceans From Here 1DRPL5LGGOH

m:DWHULVVRPHWKLQJ\RXFDQQRWKROGnZULWHVWKHSRHW$QQH &DUVRQDQGLQLWVQDWXUDOVWDWHZDWHUUXSWXUHVOLQHDUWLPHrLWLV DQHOHPHQWDOZD\VRQWKHFXVSRIWUDQVIRUPDWLRQF\FOLQJEHWZHHQ LFHOLTXLGVWHDPDQGYDSRXUm2FHDQV)URP+HUHnFXUDWHGE\ $OOLVRQ+ROODQGLVWKHVHFRQGLWHUDWLRQRIDWZRSDUWH[KLELWLRQDW WKH$XVWUDOLDQ&HQWUHIRU3KRWRJUDSK\DQGWDNHVWKHHOHPHQWRI ZDWHUDVLWVGHíQLQJIHDWXUH%ULQJLQJWRJHWKHUWKHZRUNRI&KULV %HQQLH'HDQ&URVV(PPD+DPLOWRQ+RQH\/RQJDQG3UXH6WHQW .DL:DVLNRZVNLDQG-RKQ

$VPXFKDVWKLVLWHUDWLRQWDNHVXSWKHPHWDSK\VLFDOVDFUHGDQG FXOWXUDOSURSHUWLHVRIZDWHUZKDWXQLWHVWKHZRUNVRQYLHZLVD IRFXVRQLWVYLVFHUDODQGWDQJLEOHDIIHFWVWKHERGLHVWKDWRFFXS\WKH ZRUNV ZKHWKHUKXPDQERGLHVRUERGLHVRIZDWHU DUHVXEVXPHG LQXQGDWHGLPPHUVHGPHOWHGH[FUHWHGDQGH[SHOOHG7KHVORZ GULSVWKHULSSOHVWKHUXVKHVRIFXUUHQWVDQGWKHVSODVKHVRIZDYHV FDQEHSK\VLFDOO\IHOWZKHQDSSUHKHQGLQJWKHVHZRUNVrLWLVDQ LQVWLQFWLYHNQRZLQJLQWKHIHHOLQJRIVDWXUDWLRQHYHQZKHQ UHPDLQLQJGU\

/RQJDQG6WHQWnVNeptune’s Necklace  GHSLFWVDFURXFKLQJíJXUH LQDVPDOORFHDQURFNSRRO,WLVXQFOHDUZKHWKHUWKHERG\LVWLSSLQJ IRUZDUGZHOFRPLQJDGURSLQWRZDWHURUHPHUJLQJIURPLW7KHIRUP LVVKURXGHGLQDZHWVRDNHGVKHHWWKDWFOLQJVKHDYLO\HQYHORSLQJDQG VXFNHULQJRQWRWKHVNLQ6HGXFWLYHLQLWVWDFWLOLW\WKHLPDJHLVHTXDOO\ XQFDQQ\LQLWVSUHVHQWDWLRQRIDQDPSKLELRXVKXPDQIRUP

&URVVnUntitled triptych (Looking West, Ochred and Life preserver)   UHFRUGVWKHDUWLVWV\PEROLFDOO\UHWXUQLQJWR&RXQWU\0DGHXSRIDFROOHFWLRQRI3RODURLGV&URVV LVGHSLFWHGGHOLFDWHO\DSSO\LQJDQGUHPRYLQJRFKUHWRKLVKDOIHPHUJHGERG\m0\DQFHVWRUVDUH 6DOWZDWHUSHRSOHnZULWHV&URVVmDQGLWLVVDOWZDWHUWKDWFRQQHFWVPHWRWKHPn:KHQYLHZLQJWKHVH LPDJHVZHEHFRPHZLWQHVVHVWRWKHDFWRILPPHUVLRQWKHSRLQWRIFRPPXQLRQEHWZHHQ&URVV KLVIDPLO\DQGWKHODQGVFDSH,QMood Swings  &KULV%HQQLHFRQVLGHUVRXUSV\FKRORJLFDO UHVSRQVHVWRWLGHVDQGOXQDUIRUFHVDQGKRZRXUHPRWLRQDOSHDNVDQGWURXJKVDUHRIWHQ GHWHUPLQHGE\WKHFRQFHDOHGJUDYLWDWLRQDOSXOORIDERG\RIZDWHU

+DPLOWRQ:DVLNRZVNLDQG

24 UHSKRWRJUDSKLQJDQDVVHPEODJHRIWKHVHSODQWVLQWKHVWXGLR7KHmQDWXUDOQHVVnRIWKHLQLWLDO ODQGVFDSHLVGHIHUUHGE\WKLVSURFHVVRIDUWLíFLDOWUDQVSRVLWLRQDQGDQXQWRXFKHG5RPDQWLF VXEOLPHLVH[SRVHGDVIDOVH

,IWKHUHLVDJKRVWRUDKDXQWLQJSUHVHQFHLQWKLVH[KLELWLRQrDQGLIZHDUHWREHOLHYH5RODQG %DUWKHVWKHUHLVDOZD\VDQDSSDULWLRQZKHQZHDUHGHDOLQJZLWKSKRWRJUDSK\DQGWKHLPDJHr LWLVLQWKHUHDOLVDWLRQWKDWRXUQDWXUDOUHODWLRQVKLSZLWKZDWHUZLOOYHU\VRRQQRORQJHUKROG ,QGHHGWKHH[KLELWLRQLVDSSHDULQJDWDWLPHZKHQZHDUHDFXWHO\DZDUHRIDODFNUDWKHUWKDQ DEXQGDQFHRIZDWHUWKHURXWLQHVRISUHFLSLWDWLRQQRZGLVUXSWHG 1HZ6RXWK:DOHVLVHQWLUHO\LQ GURXJKWDQGFOLPDWHLQGXFHGGU\VSHOOVDUHVHWWRFRQWLQXH 7KHH[KLELWLRQEHFRPHVDOPRVWD ODPHQWDPRQXPHQWWRDW\SHRIHOHPHQWDOVWDELOLW\WKDWLVUDSLGO\GLVDSSHDULQJXQGHUHFRORJLFDO VWUHVV,PDJHVRILFHDQGSRROVDQGRFHDQVDQGVWUHDPVEHFRPHOHVVRIDFRPIRUWDQGPRUHRID SRWHQWLDOWKUHDW

25 m2FHDQV)URP+HUHnUHPLQGVXVRIWKHFHQWUDOLW\RIZDWHUDQGKRZLWVUK\WKPVDQGîRZVDUH LQVWUXPHQWDOLQWKHVXVWHQDQFHRIOLIHrEXWLIZDWHUKDVDOZD\VEHHQXQVWDEOHLQLWVDELOLW\WR PXWDWHIURPVROLGLFHWROLTXLGWKHHIIHFWVRIFOLPDWHFKDQJHKDYHSXVKHGWKLVLQVWDELOLW\WRWKH H[WUHPHPRYLQJLWIURPDVORZGULSWRîRRG

1DRPL5LGGOHLVDZULWHUEDVHGLQ6\GQH\DQGWKHIRXQGLQJHGLWRURIWKHRQOLQHDUWVSXEOLFDWLRQ m5XQQLQJ'RJn

Australian Centre for Photography Until 20 October, 2018 6\GQH\

+RQH\/RQJDQG3UXH6WHQWNeptune’s Necklace ƒWKHDUWLVWV &RXUWHV\WKHDUWLVWV$5&21(*DOOHU\0HOERXUQHDQG$XVWUDOLDQ&HQWUHIRU3KRWRJUDSK\6\GQH\

-RKQ

26 ‘„ ƒˆϐ‹‡

&KORH0DQGU\N

Š‹•‹•Ž‹˜‹‰m/DXJKWHUDQGFU\LQJDUHPRVWOLNHO\WKHWZREHVWWKHUDSLHV,nYHIRXQGnVD\V5RE0F+DIíHZKRVH HEXOOLHQWSDLQWLQJVSHUVRQLI\VSOHQGRXULQWKHRUGLQDU\7KHDUWLVWnVVXUYH\VKRZLVRQYLHZQRZDW 7KH*DOOHU\DW%D\VLGH$UWV &XOWXUDO&HQWUHDQGFRPSULVHVSDLQWLQJVZDWHUFRORXUVDQGFHUDPLF VFXOSWXUHVIURPWKHSDVWíYH\HDUV

What’s so interesting about ‘everyday life’? )RUPH,JXHVVP\PLQG JHWVRFFXSLHGZLWKZKDWnV JRLQJRQEHQHDWKWKH VXUIDFHRIVLPSOHJHVWXUHV DQGFKDQFHHQFRXQWHUV m(YHU\GD\OLIHnRIIHUVD VWUXFWXUHWRSHUKDSV SDUDGHLQXQLVRQDV DQLQGLYLGXDOZLWKLQD FRPPXQLW\,nPIDVFLQDWHG E\WKHUROHVZHDOOSOD\LQ RUGHUWRSHUKDSVDYRLG UHDOFRQIURQWDWLRQRIYHU\ FHQWUDOKXPDQTXHVWLRQV :K\DUHZHKHUH"7KH DQVZHUFDQnWUHDOO\EHWR m1HWîL[DQGFKLOOnRUVHUYH FXVWRPHUVKRXUVDZHHN LQWKHSULQWVHFWLRQRI 2IíFHZRUNV

Is art a form of anthropology? Over the years what have you learnt from looking and then reproducing elements of Thai and now Victorian beachside suburban culture? $UWIRUPHLVP\TXLHW WLPH$UW,WKLQNLV FRPPXQLFDWLRQ,WnV VWUDQJHWKDWWKHVHDUH SHUKDSVVRPHRIP\PRVW OLWHUDOZRUNVEXW,IHHOWKH\ DUHVRVWUDQJH

27 ,GRQnWWKLQNVXUUHDOLVPUHDOO\WRXFKHVXSRQWKHZHLUGQHVVRIHYHU\GD\OLIH:KDWZHnYH FRQVWUXFWHGDVKXPDQVLVZRUWKORRNLQJDWDQGUHîHFWLQJXSRQ,WFDQSRLQWXVLQDJRRG GLUHFWLRQIRUH[DPSOHZHFDQOHDUQIURPWKHKRUURUVRIZDULQ3LFDVVRnVGuernica  RUWKH VLPSOHSHDFHDYDLODEOHLQ0DWLVVHnVLPDJHRIWKH0RURFFDQEORNHVO\LQJRQWKHJURXQGVWDULQJDW JROGíVK+HDGDZD\IURPWKLVDQGWRZDUGVWKDW

7KDLFXOWXUHLVFKDQJLQJUDSLGO\9LFWRULDQEHDFKVLGHVXEXUEDQFXOWXUHLVDOLWWOHPRUHVWXEERUQ EXWZHnUHDOOKHDGLQJWRJHWKHUWRZDUGVWKLVJOREDOFXOWXUHZKLFKLVEXEEOLQJZLOGO\ZLWKPDQ\ GLIIHUHQWîDYRXUVDOOPL[LQJZLWKWKHKHOSRIWKH,QWHUQHWDQGFKHDSîLJKWV

8QLTXHO\\RXUSDLQWLQJVRIIHUWKHYLHZHUDîDVKRIHFFHQWULFLW\WHQGHUQHVVDQGVRFLDOFRPPHQWDOODW once, what motivates you to create? 3ORSSLQJSDLQWRQDEUXVKDQGWLFNOLQJWKHFDQYDVZLWKLWLVP\SULPHPRWLYDWLRQ7KHVXEMHFWVLQ WKHSDLQWLQJVUHDOO\RIIHUWKHIUDPHZRUNIRUKRZ,nOOSDLQW,nYHIRXQGSDLQWLQJEULFNZDOOVUHDOO\ PHGLWDWLYH,nYHIRXQGSDLQWLQJMRJJHUnVOHJJLQJVDOVRTXLWHVDWLVI\LQJDV\RXUH\HVVKLIWIURPîRUDO SDWWHUQWROLQHWRWKHFXUYHRIWKHKXPDQERG\$VWKHH\HVIROORZWKHIROGVLQDQLJKWJRZQFORVHO\ WKH\JHWORVWLQWKHULSSOHVRIFRORXURUUK\WKPVRIQDWXUHDV\RXSDLQWQDWXUH,WVORZVPHGRZQWR DSRLQW,QRORQJHUH[LVWRU,H[LVWMXVWDVDZDUHQHVV7KHE\SURGXFW,KRSHLVZRUWKVKDULQJDVLW VXVWDLQVZKDWLVHVVHQWLDOO\DSURIHVVLRQDOKREE\

&DQ\RXWHOOXVDERXW\RXUUHFHQWLQîXHQFHVRUQHZLQVSLUDWLRQV" .HUU\-DPHV0DUVKDOOKLWPHZLWKDELJZKDFNWKLVODVW\HDU,VDZDKXJHVXUYH\RIKLVZRUNLQ &KLFDJRLQPD\EHDQGLWnVRQO\MXVWFUHSWXSRQPHZKDWDQLPSRUWDQWDUWLVWKHLV7KHUHnV DORWRIWUHQG\íJXUDWLYHDUWEXWQRWPXFKZLWKUHDOSRWHQF\WKDWFDQDFWXDOO\OLIWWKRVHZKRKDYH EHHQUHSUHVVHGLQWKHZRUOG'DQD6FKXW]GRHVDPD]LQJWKLQJVZLWKSDLQW1LFROH(LVHQPDQLV LQVSLULQJIRUWKHODFNRIDGKHULQJWRDQ\RQHVW\OHRISDLQWLQJ6KHíQGVDQHZIRUPWRíWHDFK XQLTXHPRGHUQVFHQDULRVKHKDV,ZHQWEDFNWRWKDW0R0$VKRZDWWKH1*9WZLFHDQGIHOWWKH SRZHURIDUWHDUO\ODVWFHQWXU\WREHDOLWWOHPRUHSRZHUIXOWKDQUHFHQWWLPHV7KHUHVHHPHGWREHD FORVHQHVV,FRXOGIHHOWKURXJKWKHDUWLVWVDQGWKHLUVXEMHFWV(YHQWKDWWLQ\OLWWOHRQHRI)ULGD.DKOR DIWHUVKHnGFXWRIIDOOKHUKDLUUHDOO\WRXFKHGPHIRULWVLQWLPDF\6KHFRXOGQnWKDYHIRUHVHHQWKDW KHUVWUXJJOHDQGGHíDQFHZRXOGULSSOHRQWKURXJKRXWWKHZRUOGXQWLOQRZ

How has your process, pre painting collage or drawing, as well as working with oils changed or evolved in the last few years? ,ZDVDOZD\VVRQHUY\SDLQWLQJSHRSOHIURPOLIH,JXHVV,QHHGHGWRFRQVWUXFWSRUWUDLWVRXWRI VFXOSWXUDOPDWHULDORUFROODJHEHIRUHSDLQWLQJWKHP7KHZRUNVKDYHEHHQEHFRPLQJDOLWWOHPRUH GLUHFWO\DERXWZKDWnVDURXQGPHGXHWRDODFNRIWLPHIDFWRU,nPEXV\ZLWKWZRNLGVVHVVLRQDO WHDFKLQJDQGZRUNLQJWKUHHGD\VDZHHNDW$UWV3URMHFW$XVWUDOLD7KLVKDVPHDQW,nYHEHHQ JUDEELQJLPDJHU\IURPYHU\FORVHWRKRPHDVWKHEDFNGURSDQGXVLQJDFWRUVIURPWKH,QWHUQHW WRSOD\WKHSDUWVRIYDULRXVQHLJKERXUVIULHQGVDQGIDPLO\7KH\nUHIDUDZD\HQRXJKIURPWKH RULJLQVWKDW,FDQWKHQUHSUHVHQWWKHPDQGVD\m,IHHOZKDW\RXnUHIHHOLQJnRUm,ORYHWKHIDFWWKDW\RX KDYHSXUVXHGOLIHDVDIXOOWLPHGRXEOHEDVVSOD\HUZKLOHHYHU\ERG\HOVHKDVMXVWJLYHQXSRQWKHLU GUHDPn

The Gallery at Bayside Arts & Cultural Centre Until 11 November, 2018

‡Ž„‘—”‡BeachcomberRLORQOLQHQ[FP

Mother and Daughter comboRLORQOLQHQ[FP

&RXUWHV\WKHDUWLVWDQG7KH*DOOHU\DW%D\VLGH$UWV &XOWXUDO&HQWUH0HOERXUQH

28 29

Halinka Orszulok +DQQDK5REVRQ-HQNLQV

,QKHUSKRWRUHDOODQGVFDSHV+DOLQND2UV]XORNLQYRNHVWKHKDXQWLQJ ZLVWIXOQHVVRIQLJKWWLPHHQYLURQPHQWVWKDWRIWHQDSSHDUZHOFRPLQJRUEDQDO GXULQJWKHGD\+HUIDVFLQDWLRQZLWKWKHGLVVRQDQFHRIDUWLíFLDOOLJKWLQQDWXUH WKHXQFRPIRUWDEOHOLQHEHWZHHQSXEOLFDQGGRPHVWLFVSDFHVDVZHOODVWKH SV\FKRORJLFDOUHVSRQVHVGDUNQHVVEULQJVFXOPLQDWHVLQGHHSO\UHîHFWLYH\HW XQVHWWOLQJZRUNV

%HJLQQLQJZLWKKHURZQSKRWRJUDSK\2UV]XORNSDLQVWDNLQJO\UHFUHDWHV WKHDUUHVWLQJORQHO\VFHQHVLQRLORQFDQYDVLPEXLQJWKHPZLWKWKHGXDO WHPSRUDOLW\RIDVLQJOHLQVWDQWVQDSVKRWDQGWKHFRQWHPSODWLYHORQJWHUP SURFHVVRISDLQWLQJ,WnVWKLVDVSHFWWKDWJLYHVKHUZRUNVXFKDFKDULVPDWLF DXUDLQZKLFKWKHDFWRIREVHUYLQJRWKHUZLVHXQUHPDUNDEOHVSDFHFDQLQVWHDG JHQHUDWHDQLQWURVSHFWLYHPRPHQW

m,WKDVDQDOLYHQHVVWRLWnVD\V2UV]XORNmZKHUHWKHZRUNKRYHUVEHWZHHQWKRVH GXDOLWLHVRIWLPHDQGWKDWJLYHVLWDOLIHWKDWnVGLIIHUHQWWRMXVWDSKRWRJUDSK RUDSDLQWLQJrLWnVERWKOD\HUHGRYHUHDFKRWKHUn7KLVGXDOLW\RIIRUPDGURLWO\ PLUURUVWKHGXDOLW\RI2UV]XORNnVVXEXUEDQVXEMHFWVm

6LQFHZLQQLQJWKH*ORYHU3UL]HZLWKPonies  rDVLQLVWHU\HWSOD\IXO GHSLFWLRQRID7DVPDQLDQSOD\JURXQGVKURXGHGLQGDUNQHVVrHDUOLHUWKLV \HDU2UV]XORNKDVEHHQKDUGDWZRUNLQKHU6RXWKHUQ+LJKODQGVVWXGLR+HUVRORVKRZDW)OLQGHUV 6WUHHW*DOOHU\FRPSULVHVDOOQHZZRUNVWKDWZKLOHQRWSDLQWHGIURPDVLQJOHORFDWLRQSUHVHQW DXQLWHGQDUUDWLYHRIWKHQRVWDOJLDRUGLVTXLHWWKDWRIWHQFRPHVZLWKWUDYHOOLQJWKURXJK SHULSKHUDOVSDFHV

7KHDUWLVWVKDUHGm7KHUHnVWKDWVHQVHRIEHLQJRQWKHHGJHRIWRZQRIWUDYHOOLQJWKURXJKWKH RXWVNLUWVRIVRPHZKHUH0D\EHWKHUHnVWKHLGHDRIPRYLQJWKURXJKWKDWODQGVFDSHDQGQRWLFLQJ KRZ\RXSDVVWKURXJKWKHZRUOG,WnVWKHVHWKRXJKWVWKDW,KDYHWRP\VHOIZKLOH,nPPDNLQJZRUN VR,GROLNHWRIHHOWKDWWKHUHLVDFRQQHFWLRQEHWZHHQWKHZRUNVe7UDYHOOLQJLVXQVHWWOLQJEHFDXVH \RXWDNHDZD\ZKDWnVIDPLOLDUEXWWKHUHnVDOVRVRPHWKLQJQLFHLQWKHVHQVHRIZLVWIXOORQJLQJDQG WKHZD\\RXH[SHULHQFHVSDFHWKDWPDNHV\RXORRNLQVLGHRUEHFRPHPRUHLQWRXFKZLWK\RXUVHOIn

)LWWLQJO\DVDEEDWLFDO\HDUVSHQWWUDYHOOLQJZKLOHVWXG\LQJDW6\GQH\&ROOHJHRIWKH$UWVLVKRZ 2UV]XORNíUVWGHYHORSHGKHUSUDFWLFHm,WRRNDFDPHUDDVDIRUPRIQRWHWDNLQJZKLOHWUDYHOOLQJn VKHH[SODLQVmDQGLWUHDOO\PDGHVHQVHWRPH7KHUHnVDOZD\VWKDWHOHPHQWRIORRNLQJRXWWKH ZLQGRZZKLOHWUDYHOOLQJ,ZDVLQ(QJODQGDWWKHWLPHZKHUHLWJHWVGDUNDWWKUHHLQWKH DIWHUQRRQVRWKHUHnVDORWRIORRNLQJRXWDWQLJKWWLPHODQGVFDSHV7KHUHZDVVRPHWKLQJ DERXWWKDW(QJOLVKODQGVFDSHLQSDUWLFXODUWKH\nUHYHU\JRRGDWGHíQLQJVSDFHHVSHFLDOO\WKH VHSDUDWLRQEHWZHHQSXEOLFDQGSULYDWHVSDFHV7KHUHLVDGHHSVHQVHRIOD\HULQJRIWKHKXPDQRYHU WKHODQGVFDSH,UHPHPEHUORRNLQJDWZLQGRZVLQKRXVLQJHVWDWHVDQGWKHQHWFXUWDLQVDQG,ZDV IDVFLQDWHGZLWKKRZOLJKWLQVLGHDFFHQWXDWHGWKHGDUNQHVVRXWVLGHn

32 7KLVLQWHQVHLQWHUHVWLQWKHGLYLGHEHWZHHQKXPDQHQYLURQPHQWVDQGQDWXUHKDVVXVWDLQHGLWVHOI IRURYHUDGHFDGHRISUDFWLFHZLWK2UV]XORNFRQWLQXLQJWRH[SORUHWKLVSV\FKRORJLFDOWKUHVKROG EHWZHHQWDPHDQGZLOGVSDFHV1RZIRFXVLQJRQVSDFHVGLVFRYHUHGLQ7DVPDQLDWKH+XQWHU 9DOOH\DQGWKH1HZ6RXWK:DOHV6RXWK&RDVW2UV]XORNXVHVWKLVVSDWLDOWHQVLRQWRUHSUHVHQW WKHXUEDQ$XVWUDOLDQODQGVFDSHFUHDWLQJZRUNVWKDWIHHODWRQFHRIWKHPRPHQWDQGVWUDQJHO\ WLPHOHVV:LWKWKHWURXEOLQJVROLWXGHRIGDUNQHVVVRHYLGHQWLQKHUPHWLFXORXVZRUNWKH ODQGVFDSHVEHDUDVWULNLQJOHYHORIUHVWUDLQWWKDWEHOLHVWKHLUGHHSO\H[SUHVVLYHXQGHUWRQHV m,nPUHDOO\WU\LQJWRVKDUHDSRLQWRIYLHZnFRQíUPV2UV]XORNm$QG,WKLQNWKHUHnVDQ XQGHUVWDQGLQJWKDWLWnVIURPDKXPDQSHUVSHFWLYH:LWKVRPDQ\FDWHJRULHVIRUWKHVSDFHVZH LQKDELW,WU\WRXQSLFNWKHWKLQJVZHPD\EHWDNHIRUJUDQWHGDQGXQGHUVWDQGZK\ZHH[SHULHQFH FHUWDLQSODFHVLQFHUWDLQZD\Vn

+DQQDK5REVRQ-HQNLQVLVDQDUWVZULWHUEDVHGLQ6\GQH\

Flinders Street Gallery 4 October to 8 December, 2018 Sydney

Night in the AnthropoceneRLORQFDQYDV[FP

&RXUWHV\WKHDUWLVWDQG)OLQGHUV6WUHHW*DOOHU\6\GQH\

33

Alicia Frankovich

7HVV0DXQGHU š‘’Žƒ‡–• 3RWHQWLDOO\WKHPRVWXUJHQWLVVXHRIRXUWLPHLVWKDWRIWKH$QWKURSRFHQH7KHUHKDVEHHQPXFK GLVFRXUVHHQJDJLQJZLWKWKHLQWHUVHFWLRQRIRXUSODQHWnVQHZHSRFKDQGWKDWRIFUHDWLYHSUDFWLFH $UWLVWVDUHVWUDGGOLQJDUDQJHRIGLIIHUHQWPHWKRGRORJLHVIRUKRZWRFRQIURQWWKHLVVXHIURP HQYLURQPHQWDOFRQVLGHUDWLRQVLQWKHLUDFWXDOPDWHULDOSUDFWLFHIURQWOLQHDFWLYLVPWRDOD\HUHG DSSURDFKWRDOOWKHFRPSRQHQWVWKDWPDNHXSRUmOLYHLQWKHVKDGRZnRIWKH$QWKURSRFHQHVXFKDV FDSLWDOLVPWHUULWRULHVJOREDOLVDWLRQWR[LFLW\WHFKQRORJ\VRYHUHLJQW\DQGPRUH$OLFLD)UDQNRYLFK LVDQDUWLVWZKRLVHQJDJLQJZLWKFKDOOHQJLQJDQGTXHVWLRQLQJWKHVHFROOHFWLYHUHDOLWLHVLQFOXGLQJ WKH$QWKURSRFHQHDQGZKHUHLWDVDQHSRFKFRQQHFWVDQGLQWHUUHODWHVWRRWKHUIDFHWVRIVRFLHW\

)UDQNRYLFKLVLQWHUHVWHGLQEULQJLQJRXUDWWHQWLRQWRWKHQXDQFHVSUHVHQWLQWKLVDJHIRUH[DPSOH RXUFRQQHFWLRQWRWHFKQRORJ\DQGZKDWWKDWIRXQGDWLRQPHDQVIRUZKDWDQGZKRLVYLHZHGDV KXPDQDORQJVLGHWKHLQKHUHQWYDOXHV\VWHPVWKDWVXSSRUWWKHFRQGLWLRQLQJRIZKDWLVQRUPDOLQ WHUPVRIKXPDQOLIH

7KLVQHZLQWHUVHFWLRQRILGHDVLVWLWOHGm([RSODQHWVnDQGZLOOEHRQVKRZDW0RQDVK8QLYHUVLW\ 0XVHXPRI$UWFXUDWHGE\0RQDVKnV+DQQDK0DWWKHZVDQGLVODUJHO\DFRPPLVVLRQHGVWDJLQJ DORQJVLGHDWHPSRUDOH[KLELWLRQH[SHULHQFHIURP)UDQNRYLFKnVUHFHQWPDMRUVRORVKRZDWWKH .XQVWYHUHLQIÕUGLH5HLQODQGHXQG:HVWIDOHQ'ÕVVHOGRUIm2876,'(%()25(%(<21'n $HVWKHWLFDOO\)UDQNRYLFKnVSUDFWLFHKDVDVWURQJFRQQHFWLRQWRLGHDVRIPRYHPHQWDQGWKLV VSDWLDOO\DZDUHDSSURDFKWRSUDFWLFHZLOOEHH[SHULHQFHGDWDQLQWHUSHUVRQDOOHYHOZKHQQDYLJDWLQJ WKHVSDFH$XGLHQFHVFDQH[SHFWWRVHHZRUNVWKDWIDOOEHWZHHQWKHPHGLXPVRIVFXOSWXUHYLGHR DQLPDWLRQVDQGLQVWUXPHQWV

)UDQNRYLFKZDVERUQLQ1HZ=HDODQGDQGQRZOLYHVDQGZRUNVLQ%HUOLQDQG&DQEHUUD6KH REWDLQHGD%9$LQVFXOSWXUHDW$87LQ$XFNODQGLQDQGJUDGXDWHGIURP0RQDVK8QLYHUVLW\ ZLWKDQ0)$LQPDNLQJWKLVH[KLELWLRQDKRPHFRPLQJRIVRUWV7KHDUWLVWKDVWUDYHOOHG DQGH[KLELWHGZLGHO\LQVKHZDVVKRUWOLVWHGIRUWKH:DOWHUV3UL]H1HZ=HDODQGnVSUHPLHU DUWVSUL]HDQGLQZDVDíQDOLVWLQWKH.XQVWSUHLVGHU%ÏWWFKHUVWUD¸HLQ%UHPHQ)UDQNRYLFK KDVXQGHUWDNHQYDULRXVUHVLGHQFLHVDWWKH,6&31HZ

,QGHHGZKDW)UDQNRYLFKDUJXHVLVWUXHKXPDQLW\LVDZHDOWKRIPXOWLSOLFLWLHVDQGHYHQDWWKH LQGLYLGXDOOD\HUZHPD\SHUIRUPDQGDGRSWPXOWLSOHLGHQWLWLHVWRQDYLJDWHWKURXJKWKHVSDFHRI OLIH&UXFLDOO\WRRQRZQRWRQO\DUHWKHVHSHUIRUPHGEXWDOVRSURMHFWHGDQGYLVLEOHZLWKLQZLGHU FXOWXUHLQDZD\WKDWZDVQnWSRVVLEOHLQWKHSDVWGXHWRKRPRJHQRXVSURMHFWLRQVRIUHDOLW\

7HVV0DXQGHULVDZULWHUFXUDWRUDQGUHVHDUFKHUEDVHGLQ%ULVEDQH

Monash University Museum of Art 6 October to 15 December, 2018

36 ‡Ž„‘—”‡ Outside Before BeyondYLGHRVWLOO

Outside Before BeyondYLGHRVWLOO

&RXUWHV\WKHDUWLVWDQG0RQDVK8QLYHUVLW\0XVHXPRI$UW0HOERXUQH

37 Jenny Sages

=R\D3DWHO ‡•– ˆ‘”‰‡–,QKHUWKVKRZDW.LQJ6WUHHW*DOOHU\-HQQ\6DJHVDGGUHVVHVWKHPDJLFRIPHPRU\DQGWKH HIIHFWRIIRUJHWIXOQHVVRQWKHVHOI7KHWZHQW\WLPH$UFKLEDOG3UL]HVKRUWOLVWHGDUWLVWKDVD UHSXWDWLRQIRUH[SORULQJWKHGHHSO\SHUVRQDOLQKHUZRUNAfter JackDVHOISRUWUDLWRIJULHIZRQWKH 3HRSOHnV&KRLFH$ZDUGLQ7KHSDLQWLQJZDVVWULNLQJDQGPRYLQJZLWK6DJHVSUHVHQWHGLQD PRPHQWRIKHOSOHVVQHVVKHUORVVHYLGHQWLQWKHíQHOLQHVDQGPXWHGFRORXUVRIWKHFRPSRVLWLRQ

m/HVW,)RUJHWnFRQWLQXHVWKLVWKHPHKLQJLQJLWVDSSURDFKRQWKHH[SHULHQFHRIDJHLQJDQGWKH LPSDFWRQKHUPHPRU\$FFRUGLQJWR.LQJ6WUHHW*DOOHU\m-HQQ\LVHQWHULQJDVWDJHLQOLIHZKHUHVKH LVDZDUHWKDWWKLQJVDUHQRWDOZD\VDVWKH\ZHUHrVKHQRORQJHUGULYHVDQGLVDELWPRUHIRUJHWIXO WKDQVKHRQFHZDV7KHZRUNVUHIHUHQFHKHUIRUJHWIXOQHVVLQDQLFHZD\DQGVRPHWLPHVDUH KXPRURXVWRRn

m/HVW,IRUJHWnUHOLHVRQYXOQHUDELOLW\ DQGWKLVLVIXUWKHUUHîHFWHGLQ WKHSK\VLFDOLW\RIWKHSLHFHVRQ YLHZDOORIZKLFKDUHYHU\VPDOO mGHOLFDWHDQGVXEWOHnrFRQQHFWLQJ WRWKHQDWXUHRIPHPRU\LWVHOIDV EHLQJERWKLQWULFDWHO\GHWDLOHGDQG HDVLO\GDPDJHG7KHZRUNVZLOOEH OHDQWRQWKHZDOOVRIWKHJDOOHU\ XQIUDPHGHQKDQFLQJWKHVLPSOLFLW\ DQGUDZQHVVRIWKHH[KLELWLRQ )XUWKHUPRUHWKHDUWLVWnVSULPDU\ PHGLXPRIHQFDXVWLFRQFDQYDV RUERDUGVLVDPHUFXULDODQGíQH SURFHVVWKDWVXLWVWKLVWRQH+HU SLJPHQWVKDYHEHHQFROOHFWHGIURP DFURVVWKHJOREHDQGWKHSURFHVVRI UXEELQJWKHPLQWRWKHZD[JURXQG DQGWKHQFDUYLQJUHSOLFDWHVWKH DHVWKHWLFRIZHDYLQJ$VVXFKWKH SLHFHVKDYHDUHFXUULQJPRWLIRI WKUHDGVDQGWDQJOHVLQWRQHVRI RUDQJHDQGEOXHKLQWLQJDWWKHZD\ RXULGHQWLWLHVDUHWDQJOHGZLWKRXU PHPRULHVHDFKUHOLDQWRQWKHRWKHU IRUFRQWLQXLW\RIWKHVHOI

.QRZQIRUKHUSRUWUDLWXUH6DJHVKDV RWKHUZLVHIRFXVHGRQODQGVFDSHV m/HVW,)RUJHWnZLOOUHWXUQWKHIRFXV WRWKHVWXGLRDQGLVPRUHLQWHUQDOO\ GULYHQE\WKHDUWLVWnVRZQUHîHFWLRQV RQDQGH[SHULHQFHVRIPHPRU\

38 :KLOVWWKHUHLVVWLOOH[SDQVLYHQHVV WRWKHZRUNVWKHVHQHZZRUNV UHSUHVHQWLQQHUVDQFWXPVDQG WKHIDOOLELOLW\RIWKHLUSRZHUVRI UHFROOHFWLRQ m-HQQ\LVRQHRIWKRVHUDUHWDOHQWV ZKRKDVVXFFHHGHGLQFUHDWLQJD YLVXDOLPDJHU\VRXQLTXHLWZLOO PDLQWDLQLWVEHDXW\DQGHOHJDQFH IRUHYHUn5DQGL/LQQHJDU&R 'LUHFWRURI.LQJ6WUHHW*DOOHU\ VDLG

7KHVLQJOHVHOISRUWUDLWWKDWZLOO EHLQFOXGHGLQWKHVKRZLVGLVWLQFW IURPKHURWKHUVHOISRUWUDLWVLQ WKDWWKHLPDJHIHHOVUHPRYHG IURPWKHYLHZHU5DWKHUWKDQ EHLQJDGHWDLOHGUHQGHULQJRI SHUVRQDJHZLWKWKHDWWHQWLRQ WRWKHLQWULFDFLHVRIVNLQDQG H[SUHVVLRQWKDWZHnYHVHHQLQ WKHSDVWWKLVSLHFHLVVWURQJLQ FRQWUDVWVDQGOHVVGHWDLORULHQWHG $VLOKRXHWWHRIKHUVKDGRZVSDQV XSIURPWKHIRRWRIWKHFDQYDVD SRLQWRIVROLGLW\DQGíUPQHVVLQ DGDQFLQJODQGVFDSHRISDWWHUQV DVLQJOHOLQHPDUNLQJZKDWVHHPV OLNHDV\PEROLFSDWKIURP6DJHnV KHDGWRLQWRWKHIXWXUH7KHLPDJH LVDUUHVWLQJLQLWVVLPSOLFLW\DQG WKHSRVHRIWKHíJXUHRQHKDQGKHOGXSDWWKHEURZDVLISHHULQJGRZQWKLVURDGRIPXOWLWXGHV KDUNVWRWKHQRWLRQRIPHPRU\DVVRPHWKLQJWREHIRXQGDQGFDSWXUHGVRPHWKLQJHOXVLYHDQG HYHUFKDQJLQJ

7KHUHLVQRGRXEWWKDW-HQQ\6DJHVLVRQHRIWKH$XVWUDOLDQJUHDWVDQDUWLVWZKRVHZRUNLV FRQVWDQWO\HYROYLQJDQGWKDWDOUHDG\KROGVDQLPSRUWDQWSODFHLQWKHFDQQRQRI$XVWUDOLDQDUW m/HVW,)RUJHWnSURPLVHVWREHDQRWKHUFRPSHOOLQJH[KLELWLRQWKDWVHHNVWRGUDZYLHZHUVLQWRWKH WHQXRXVQHVVRIRXUPRVWLPSRUWDQWFRQQHFWLRQVWRWKHZRUOGDURXQGXVrWKDWRISDVWH[SHULHQFHV DQGWKHPHPRULHVWKH\FUHDWH

=R\D3DWHOLVDZULWHUDQGHGLWRUEDVHGLQ&DQEHUUD

King Street Gallery on William 9 October to 3 November, 2018 Sydney

Tangled up in blueHQFDXVWLFDQGSLJPHQWRQERDUG[FP

Lest we forgetHQFDXVWLFDQGSLJPHQWRQERDUG[FP

&RXUWHV\WKHDUWLVWDQG.LQJ6WUHHW*DOOHU\RQ:LOOLDP6\GQH\

39 — BALLARAT 21 SEPT – 6 NOV

150 ARTISTS | 65 SOLO EXHIBITIONS | LAKESIDE SCULPTURE WALK | PERFORMANCE ART PROJECTS OUTDOOR INSTALLATIONS | MUSIC EVENTS

The inaugural Biennale of Australian Art (BOAA) will tell Australian stories, stories

ARTISTS AT THE ART GALLERY OF BALLARAT: KIM ANDERSON | ASHER BILU | FARIDAH CAMERON | GERWYN DAVIES | PHILLIP GEORGE | MARLENE GILSON | DAVID JENSZ LOUISEANN KING | NUMINA SISTERS | PIP & POP | JASON SIMS boaa.net.au

ART GALLERY OF BALLARAT FUNDING PARTNERS

image: Gerwyn Davies, Prawn (Subtrop- ics) 2016 (detial) © Gerwyn Davies Jo Darvall This is an insightful overview of Jo’s practice taking in key works from several of her major solo exhibitions held in Australia and Singapore. 27 October - 11 November 2018

391 Canning Highway, Melville-Palmyra WA 6156 nyisztorstudio.com.au Bohemian Harbour: Josh Muir Artists of Lavender Bay

Museum of Sydney ‘•Š—‹”Koorie Heritage Trust Until 25 November, 2018 6 October to 24 November, 2018 Sydney

‡Ž„‘—”‡ 7KLVH[KLELWLRQIHDWXUHV$XVWUDOLDQDUWLVWV 0HOERXUQHEDVHGPXOWLPHGLDDUWLVW-RVK ZKRGXULQJWKHVDQGVQXUWXUHGDQ 0XLUGUDZVLQVSLUDWLRQIRUKLVSUDFWLFHIURP H[WUDRUGLQDU\ERKHPLDQDUWVFRPPXQLW\ KLSKRSDQGVWUHHWDUWFXOWXUH+HVKDUHV DW/DYHQGHU%D\RQ6\GQH\nVQRUWKVLGH WLPHVRIVWUXJJOHDQGPRPHQWVRIMR\ZLWKD 3DLQWLQJVGUDZLQJVSULQWVVFXOSWXUHDQG VHULHVRIVHOISRUWUDLWVVXVSHQGHGIURPWKH H[SHULPHQWDOíOPZRUNVE\3HWHU.LQJVWRQ FHLOLQJRIWKH.RRULH+HULWDJH7UXVWJDOOHU\ 7RP&DUPHQW3KLOLS&R[-RHO(OHQEHUJ &UHDWHGHVSHFLDOO\IRUWKLVH[KLELWLRQWKHVH 5REHUW-DFNV5ROOLQ6FKOLFKW*DUU\6KHDG QHZZRUNVSULQWHGRQDOXPLQLXPFRQWLQXH DQG7LP6WRUULHUDUHRQGLVSOD\ZLWKUDUHO\ 0XLUnVMRXUQH\RIVHOIH[SORUDWLRQDQGSUHVHQW VHHQDUWZRUNVE\%UHWW:KLWHOH\m%RKHPLDQ DNDOHLGRVFRSLFOD\HULQJRIYLEUDQWFRORXUV +DUERXUnUHîHFWVRQWKHFUHDWLYHHQHUJ\DQG VKDSHVDQGV\PEROVGLVSOD\HGDORQJVLGHKLV VRFLDOFRQQHFWLRQVWKDWîRXULVKHGGXULQJ LPPHUVLYHZDOOSDSHUQHRQLQVWDOODWLRQDQG WKRVH\HDUV WKUHHFKDQQHODQLPDWLRQ

3HWHU.LQJVWRQLast train to Coney IslandRLORQFDQYDV TongGLJLWDOSULQWRQDOXPLQLXP[FP [FP &RXUWHV\WKHDUWLVWDQG.RRULH+HULWDJH7UXVW0HOERXUQH ƒ3HWHU.LQJVWRQ &RXUWHV\WKHDUWLVWDQG6\GQH\/LYLQJ0XVHXPV6\GQH\ 42 Bridgette McNnab Petrina Hicks

‡†ǡ‡ŽŽ‘™ǡŽ—‡Boom Gallery –‹ŽŽ‹ˆ‡–—†‹‘THIS IS NO FANTASY + dianne tanzer 11 October to 3 November, 2018 + nicola stein 3 to 30 October, 2018

‹ –‘”‹ƒ %ULGJHWWH0F1DEnVSDLQWLQJSUDFWLFHLVIRFXVHG m,DPIDVFLQDWHGE\WKHLPPHGLDF\RIV\PEROV‡Ž„‘—”‡ RQSRUWUDLWXUHDQGVWLOOOLIHHOHPHQWVZKLFK DQGORQJHYLW\RIP\WKVUHLQWHUSUHWHGWKURXJK FRPSULVHKHUVHFRQGVRORH[KLELWLRQWLWOHG WKHOHQVRIKLVWRU\DQGFXOWXUHRYHUDQGRYHU m5HG

FootRLORQSRO\FRWWRQ[FP BluebirdSLJPHQWSULQWHGLWLRQRI$3[FP &RXUWHV\WKHDUWLVWDQG%RRP*DOOHU\9LFWRULD &RXUWHV\WKHDUWLVWDQG7+,6,612)$17$6<GLDQQHWDQ]HU QLFRODVWHLQ0HOERXUQH

43 Biomess: The Tissue Bob Jenyns Culture & Art Project

Art Gallery of Western Australia Š‡”–‘ˆ–Š‡”ƒ˜‡ŽŽ‡”Ballarat – Gallery on Sturt Until 3 December, 2018 5 October to 14 November, 2018

‡•–‡”—•–”ƒŽ‹ƒ ‹ –‘”‹ƒ m%LRPHVVnFXUDWHGE\5REHUW&RRNLVD %RE-HQ\QV  ZDVDSUROLíFDUWLVW FROODERUDWLYHSURMHFWEHWZHHQ6\PELRWLF$ ZKRSUDFWLFHGIRUPRUHWKDQIRXUGHFDGHV DWWKH8QLYHUVLW\RI:HVWHUQ$XVWUDOLD LQZKLFKWLPHKHSURGXFHGDQRHXYUHRI :HVWHUQ$XVWUDOLDQ0XVHXPDQGWKH$UW VFXOSWXUHVWDSHVWULHVSULQWVGUDZLQJVDQG *DOOHU\RI:HVWHUQ$XVWUDOLD6LQFHWKH SDLQWLQJV-HQ\QVnZRUNLVGLVWLQFWLYHLQVW\OH DUWLVWV2URQ&DWWVDQG,RQDW=XUUKDYHEHHQ DQGUHPDLQHGUHODWLYHO\FRQVLVWHQWWKURXJKRXW H[SORULQJWKHUHODWLRQVKLSEHWZHHQDUWDQG KLVFDUHHUPDUNHGE\KLVGLVWLQFWZLWW\ VFLHQFH7RGD\WKH\SUHVHQWRGGLWLHVIURP VHQVHRIKXPRXUDQGDHVWKHWLFFHOHEUDWLRQ WKHQDWXUDOZRUOGm)UDQNHQVWHLQVnLI\RXZLOO RIHYHU\GD\DQGIUHTXHQWUHIHUHQFHWR 7KLVLQWHUHVWLQRUJDQLVPVDQGWHPSRUDU\ SROLWLFDOFXOWXUDODQGVRFLDOHYHQWVDQG ELRORJLFDOVWUXFWXUHVFRPSOHPHQWVWKHIHVWLYDO SHUVRQDOH[SHULHQFH7KLVH[KLELWLRQ m8QKDOORZHG$UWVnFHOHEUDWLQJWKHWK\HDU LQFOXGHVOLWKRJUDSKVDQGVFXOSWXUHVWKDW VLQFHWKHSXEOLFDWLRQRI0DU\6KHOOH\nVJRWKLF LOOXVWUDWH-HQ\QVnLQWHUHVWVLQ)RON1DLYHDQG KRUURUQRYHO)UDQNHQVWHLQ RXWVLGHUDUW

2URQ&DWWV ,RQDW=XUUSponge – Biomess Jesus will soon return, Mathew 24OLWKRJUDSK[FP &RXUWHV\WKHDUWLVWVDQG$UW*DOOHU\RI:HVWHUQ$XVWUDOLD3HUWK &RXUWHV\WKHDUWLVWDQG%DOODUDWr*DOOHU\RQ6WXUW9LFWRULD

44 Talia Smith and Void

Zainab Hikmet UTS Gallery Until 16 November, 2018 Sydney †Š‡›ŽŽƒ›‘—”ƒ‡BLINDSIDE 3 to 20 October, 2018

‡Ž„‘—”‡7DOLD6PLWKDQG=DLQDE+LNPHWXQLWHLQWKLV 7KHQRWLRQRImYRLGnLVH[SORUHGE\ H[KLELWLRQLQZKLFKWKHLUWLPHEDVHGSUDFWLFHV FRQWHPSRUDU\$ERULJLQDODUWLVWVZKRZRUN H[SORUHWKHIHHOLQJRIORQJLQJIRUDPRPHQW LQDUDQJHRIPHGLDIURPFHUDPLFVWRYLGHR RUSODFH%RWKDUWLVWVFUHDWHSHUVRQDOZRUNV SDLQWLQJVFXOSWXUHDQGSKRWRJUDSK\&XUDWRU WKDWUHIHUHQFHWKHSDVWSUHVHQWDQGSRVVLEOH (PLO\0F'DQLHOH[SODLQVm,QGLJHQRXVDUWLVWV IXWXUHZLWKmOLJKWnDVDJXLGLQJPHGLXPDQG DUHLQQRYDWLYHFRQVWDQWO\FKDQJLQJDQG HPEOHPEHFDXVHRILWVSRWHQWLDOWRFRQYH\ íQGLQJQHZZD\VWRDUWLFXODWHROGZD\Ve îHHWLQJHQHUJ\7KHWHPSRUDOTXDOLW\RIOLJKW 7KHVHDUWLVWVDUHHQJDJLQJZLWKDUWDVDYLVXDO LVWKHFRUQHUVWRQHRIWKLVVKRZZKLFKVWDJHV DQGDPHWDSKRULFDOPHDQVWRDUWLFXODWHWKH mRSSRVLWLRQDOVWUXFWXUHVWRPHHWWKHSDVVLQJ FRPSOH[LW\RIWKHLUH[SHULHQFHVn(GXFDWLRQDO RIWLPHDQGPHPRU\WKHVSDFHVEHWZHHQ SURJUDPPLQJZLOOFRPSOHPHQWWKHZRUNV DQGWKHJURZLQJGLVWDQFHQDWXUDOO\FUHDWHG RQVKRZIURP0DEHO-XOL-RKQ0DZXUQGMXO EHWZHHQSHRSOHn $0-RQDWKDQ-RQHV'U7KDQFRXSLH*ORULD )OHWFKHU$2-DPHV7\ORU+D\OH\0LOODU%DNHU 'DQLÁOH+URPHNDQG$QG\6QHOJDU

=DLQDE+LNPHWDrink DeepF\DQRW\SHRQZDWHUFRORXU -DPHV7\ORU (Erased) From an Untouched Landscape #10 SDSHUGLPHQVLRQVYDULDEOH &RXUWHV\WKHDUWLVWDQG876*DOOHU\6\GQH\ &RXUWHV\WKHDUWLVWDQG%/,1'6,'(0HOERXUQH 45 In a World of Wounds Maz Dixon

Artbank Until 9 November, 2018 Sydney Š‡‹ˆ‡š‘–‹ Fox Galleries 18 October to 17 November, 2018

7DOLD6PLWKKDVFRQFHSWXDOLVHGWKLVH[KLELWLRQ 0D]'L[RQnVSDLQWLQJVLQm7KH/LIH([RWLFn‡Ž„‘—”‡ GUDZQIURPWKHFROOHFWLRQRI$UWEDQNDQG GUDZRQYLQWDJHSRVWFDUGVDQGFKLOGKRRG ZRUNVRQORDQDVSDUWRIWKHLUQHZ(PHUJLQJ PHPRULHVWRH[SORUHDSDUWLFXODU$XVWUDOLDQ &XUDWRUVSURJUDP:LWKSKRWRDQGYLGHR H[SHULHQFHRIWKHODQGVFDSHDHVWKHWLFDOO\ SUDFWLFHV6PLWKH[SORUHVWKHRQJRLQJLPSDFW GHíQHGE\EHDFKHVEDEHV%LJ7KLQJV RIKXPDQDFWLRQRQWKHSODQHWZLWKSDUWLFXODU URDGVLGHVLJQDJHDQGFKHDSPRWHOV'L[RQ UHIHUHQFHWRWKHGHOXVLRQRIGLVDVVRFLDWLQJ H[DPLQHVWKLVmLGHDOLVHGn$XVWUDOLDQLGHQWLW\ IURPRXUUROHLQLWVVXIIHULQJ6PLWKKDV DQGWKHIDQWDV\FRQMXUHGE\WKHSHUVXDVLYH FKRVHQZRUNVE\7DULN$KOLS-XOLH*RXJK DGYHUWLVLQJRIWKHVHOHWWHUER[LPDJHV5DLQERZ 0DULD.RQWLV6SHQFH0HVVLK6DUDK0RVFD FRORXUHGVFHQHVGHSLFWGLYLQJGROSKLQVDQG 3KXRQJ1JR1DELODK1RUGLQ$QJHOD7LDWLD VXQNLVVHGDGPLUHUVHQWKXVLDVWLFDOO\SRVLQJ DQG6KDQQRQ7H$RWRQDPHDIHZ DQGSHUIRUPLQJIRUWKHFDPHUDWKHLUVXQEXUQW FRPSOH[LRQVDQGPLVSODFHGFRPSRVLWLRQV VXJJHVWDQXQGHUO\LQJGLVFRPIRUWLQWKHLU VXUURXQGLQJV

$QJHOD7LDWLDLickKLJKGHíQLWLRQGLJLWDOYLGHR Coral Gardens #1RLODQGJUDSKLWHRQERDUG[FP $UWEDQNFROOHFWLRQSXUFKDVHG &RXUWHV\WKHDUWLVWDQG)R[*DOOHULHV0HOERXUQH &RXUWHV\WKHDUWLVWDQG$UWEDQN6\GQH\

46 State of the Union Jasmine Targett

The Ian Potter Museum of Art Until 28 October, 2018 —’‡” ‘Ž‘‰›Stockroom Gallery 13 October to 4 November, 2018 ‡Ž„‘—”‡ m6WDWHRIWKH8QLRQnKLJKOLJKWVWKH\HDUVZKHQ -DVPLQH7DUJHWWH[SORUHVWKHLPSDFWRI‹ –‘”‹ƒ LQWHUDFWLRQVEHWZHHQDUWLVWVDQGWKHODERXU KXPDQH[LVWHQFHDQGFRQVXPHULVPRQWKH PRYHPHQWLQ$XVWUDOLDZHUHVWURQJZKHQ HQYLURQPHQW7DJJHGWKH$QWKURSRFHQHHUD LQWKHVDQGVSROLWLFDOFRQYLFWLRQV LWKDVOHIWDIDUJUHDWHUIRRWSULQWRQXQLYHUVDO RIVRFLDOUHDOLVWDUWLVWVZHUHUHîHFWHGLQ HFRORJLHVWKDQDQWLFLSDWHG DUWZRUNVGHíQLQJWKHKDUGVKLSVRIZRUNHUV DQGWKHLUIDPLOLHVDQGWKHVDQGV 5HIHUHQFLQJFU\VWDOOLVHG&RNHERWWOHVDQG1LNH ZKHQYLVXDODUWLVWVZHUHIXQGHGWRXQGHUWDNH VKRHVIURPKHUFuture FossilVHULHV7DUJHWW UHVLGHQFLHVDWWUDGHVKDOOVDQGXQLRQDIíOLDWHG VD\Vm,QKLQGVLJKWFRQVXPHULVPZLOODSSHDU ZRUNSODFHVDURXQGWKHFRXQWU\2YHUDUWLVWV WREHDFXOWXUHVRFRQWDJLRXVLWFUHDWHGDQ DQGFROOHFWLYHVH[KLELWFRQWHPSRUDU\DQG XQTXHQFKDEOHWKLUVWWKDWKDOWHGQDWXUDOOLIH KLVWRULFDOZRUNVZKLOHSDQHOGLVFXVVLRQVZLOO F\FOHVFKDQJLQJWKHFRXUVHRIQDWXUHDQGLWV IXUWKHUH[SORUHWKHLUWKHPHV JRYHUQDQFHRYHUWKHQDWXUDOZRUOGKHUDOGLQJ WKHEHJLQQLQJRIWKH$QWKURSRJHQLFHUDn

,P+HXQJ6RRQFactory ComplexYLGHRVWLOO Thirst Knows No SeasonJODVVFU\VWDO'LFKURLF/HQV &RXUWHV\WKHDUWLVW%$1'$/6HRXODQG7KH,DQ3RWWHU0XVHXP LQVWDOODWLRQVL]H[[FPJODVV[[FP RI$UW0HOERXUQH 3KRWRJUDSK5XVVHOO:DWVRQ &RXUWHV\WKHDUWLVWDQG6WRFNURRP*DOOHU\9LFWRULD 47 Catriona Pollard William Mackinnon

—”ˆƒ ‹‰Sydney Road Gallery Š‡— ›‘—–”›ǫHugo Michell Gallery Until 21 October, 2018 18 October to 10 November, 2018 Sydney 6RXWK$XVWUDOLD

7DNLQJLQVSLUDWLRQIURPWKHQDWXUDOZRUOG %HWZHHQDQG:LOOLDP0DFNLQQRQ &DWULRQD3ROODUGFRPELQHVWUDGLWLRQDOEDVNHW VSHQWWLPHLQWKH.LPEHUOH\DQG&HQWUDO PDNLQJDQGDVVHPEODJHWHFKQLTXHVZLWK $XVWUDOLDrDQH[SHULHQFHWKDWKHOSHGKLPWR IRUDJHGSODQWPDWHULDOVYLQHVEUDQFKHV míQGKLVRZQYRLFHDVDQDUWLVWn7KHODQGVFDSH OHDYHVDQGVHHGSRGVDQGRWKHUHDUWKO\ RIQRUWKHUQ:HVWHUQ$XVWUDOLDUHPRWH HOHPHQWVVXFKDVFKDUFRDOFOD\DQGDVKWR :HVWHUQ'HVHUWDQG3LQWXSLFRXQWU\KDGD FUHDWHLQWULFDWHO\ZRYHQDQGFRQVWUXFWHG SURIRXQGDIIHFWRQ0DFNLQQRQnVSK\VLFDODQG íEUHZRUNVVFXOSWXUHDQGEDVNHWU\3ROODUGnV PHQWDODWWLWXGHWRZDUGSDLQWLQJ:RUNLQJDV QHZLPDJLQDWLRQVFHOHEUDWHWKHEHDXW\DQG DQDUWLVWnVDVVLVWDQWDQGXQGHUWKHJXLGDQFHRI DEXQGDQFHRIQDWXUHKLJKOLJKWLQJWKHULFK PHQWRUV0DFNLQQRQZDVDEOHWRGLVFRYHUKLV FRORXUVWH[WXUHVDQGIRUPVWKDWLWSURGXFHV XQLTXHYLVXDOODQJXDJHVKRZFDVHGLQWKLVQHZ 0DQ\RIWKHVHZRUNVDUHPDGHSXUHO\IURP VHULHVRIZRUNV RUJDQLFPDWHULDOVZLWKRXWJOXHVG\HVRU V\QWKHWLFWKUHDGV

ReplenishedZRQJDZRQJDYLQHFKDUFRDO'UDFDHQD0DUJLQDWD Kintore HawksDFU\OLFRFKUHRLODQGDXWRPRWLYHSDLQWRQ [[FP FDQYDV[FP &RXUWHV\WKHDUWLVWDQG6\GQH\5RDG*DOOHU\6\GQH\ &RXUWHV\WKHDUWLVWDQG+XJR0LFKHOO*DOOHU\6RXWK$XVWUDOLD 48 Dave Sparkes Alexander McKenzie

—‹‘•‹–›Grafton Regional Gallery Š‡ƒ†˜‡–—”‘—•‰ƒ”†‡‡”Hazelhurst Regional Gallery & Arts Centre Until 21 October, 2018 Until 21 October, 2018 Sydney

)DVFLQDWHGE\VXQOLJKWVKDGRZDQG‡™‘—–ŠƒŽ‡• ,QKLVíUVWPDMRUVXUYH\$OH[DQGHU0F.HQ]LHnV UHîHFWLRQVRIWHQSDLQWLQJIURPWKHmFRQWUD m7KHDGYHQWXURXVJDUGHQHUnEULQJVWRJHWKHU MRXUn LQWRWKHOLJKW YLHZSRLQW%\URQ%D\DUWLVW RIWKHDUWLVWnVPRVWVLJQLíFDQWZRUNV 'DYH6SDUNHVVWULYHVWRFUHDWHDQDWPRVSKHULF DQDVVRUWPHQWRIFHOHEULW\SRUWUDLWVDQG PRRGLQKLVSDLQWLQJVWKURXJKWKHVKDGRZ KLVVLJQDWXUHODQGVFDSHSDLQWLQJV)RU SOD\RIWUHHWUXQNVDQGVXUURXQGLQJîRUD 0F.HQ]LHWKHODQGVFDSHLVERWKDSODFHIRU ,Qm/XPLQRVLW\n6SDUNHVHYRNHVDVHQVHRI VHOIUHîHFWLRQDQGDPHWDSKRUIRUSHUVRQDO ZKLPVLFDODOPRVWPHODQFKRO\UHDOLVPDQ MRXUQH\:KLOHKLVZRUNVKDYHDQXQGHUO\LQJ DOWHUQDWHZRUOGVXJJHVWLQJDWLPHEHIRUH VHQVHRIIDPLOLDULW\WKH\DUHPRUHHYRFDWLYHRI KXPDQLQWHUIHUHQFHZLWKWKHODQGVFDSH RWKHUQHVVWKDQDUHSUHVHQWDWLRQRIDVSHFLíF SODFHVDORQJWKH(DVW&RDVWRI1HZ6RXWK SODFHWKH\LQVWDQWO\WUDQVSRUWWKHYLHZHULQWR :DOHVXQWRXFKHGrmMXVWKXPPLQJDORQJLQ DGUHDPOLNHDQGRWKHUZLVHXQLQKDELWHGZRUOG WKHLUKHDUWEUHDNLQJO\SULVWLQHVWDWHn ODGHQZLWKXQGHUO\LQJQDUUDWLYHV

Evans Head TrailZDWHUFRORXU[FP The CuttingRLORQOLQHQ[FP &RXUWHV\WKHDUWLVWDQG*UDIWRQ5HJLRQDO*DOOHU\1HZ6RXWK:DOHV &RXUWHV\WKHDUWLVWDQG+D]HOKXUVW5HJLRQDO*DOOHU\ $UWV&HQWUH 6\GQH\ 49 Art & Industry

As we near celebrating 45 years of publishing Art Almanac continues to serve and be shaped by people who engage with art everyday. Our practice supports the sustainability of our arts community in all its forms. We have experience as artists, in critical writing, working in galleries and festivals, design, teaching, digital media and the curatorial ield.

Art Almanac is more than a magazine.

50 Artist Opportunities

We have selected a few galleries and funding bodies calling for submissions for Art Awards, Artist Engagements, Grants, Public Art, Residency Programs, Exhibition Proposals and more. Enjoy and good luck! ACE Open and Country Arts SA Residency and Touring Exhibition ACE Open, Adelaide and Country Arts SA have announced a new partnership, which aims to support artists and audiences in regional South Australia through the development of the inaugural Kerry Youde, recipient of the ACE Open x Country Arts SA Open ACE Open x Country Arts SA Open House Residency House Residency 2018 Courtesy the artist, ACE Open and Country Arts SA and a six-venue touring exhibition beginning in 2020 drawn from ‘ACE Open’s 2017 South Australian Artist Commission’. Chelsea International Photography Competition Photographer, digital illustrator and jewellery-maker, Entries close Tuesday 9 October 2018 Kerry Youde, is the successful recipient for the The Chelsea International Photography Competition is residency and will be undertaking a month-long marking its second year of celebrating photographers position at ACE Open’s CBD residential studio to work from around the globe on the renowned New York City on developing her practice. This opportunity awards art stage. Sponsored by Agora Gallery, the competition the artist a $6,000 fee and a mentorship with visual provides exposure of the work of all types of artist Sue Kneebone. photography. With a distinguished panel of jurors and ‘This is an amazing opportunity to focus on and prizes valued at more than $55,000, the competition develop my practice. I am also very much looking is an excellent opportunity for photographers seeking forward to developing new connections while national and international acclaim. Finalists will expanding my professional network,’ says Youde. participate in a collective exhibition from 20 to 28 February 2019 at Agora Gallery in NYC, and receive Youde’s application was commended by the selection valuable PR opportunities. panel for her ambition to create meaningful exchanges agora-gallery.com with metropolitan artists and to draw from and contribute to wider reciprocity between the broader Glover Prize industry. Entries close 6pm, 25 January 2019 ‘Domestic Arts’ by Sera Waters was the 2017 commission The John Glover Art Prize is an acquisitive award for and it will now tour the regional areas of Bordertown, the best contemporary landscape painting of Tasmania Seppeltsfield, Goolwa, Mount Gambier, Port Pirie and and offers the winning artist $50,000 plus a bronze Murray Bridge, from June 2020. This body of work maquette of colonial artist John Glover, designed by explores the contemporary significance of traditional Peter Corlett and valued at $5,000. All other exhibited home-crafts, drawn from the artist’s own history. entries are eligible for the (non-acquisitive) People’s Choice Award $3,000, the Children’s Choice Award ACE Open is thrilled to be extending its activities and $500 and the Hanger’s Choice Award $500. An impact into regional areas through these two new exhibition of 40 finalists’ paintings will be held over initiatives. ‘As the only contemporary art space in the March 2019 long-weekend in the historic Falls South Australia, ACE Open is committed to developing Park pavilion in Evandale, a village on the beautiful art and artists in and from our state. This commitment northern plains of Tasmania. extends far beyond Adelaide and our tour of Domestic johnglover.com.au Arts will offer regional audiences the chance to encounter work by an outstanding contemporary artist,’ said Liz Nowell, CEO ACE Open.

Art & Industry 51 Koorie Art Show Artspace Rent-free Studios Entries close 8 October 2018 Applications close midnight, 22 October 2018 The ‘Koorie Art Show’ presented by the Koorie Each year since 2015, Artspace has been offering Heritage Trust is one of the most important annual year-long, rent-free studios to assist artists with the exhibitions, which showcases the talent of Victoria’s development of new work and methodologies in an Aboriginal and Torres Strait Islander artists. This show open and critically-engaged environment, and is is an open-entry, non-acquisitive award exhibition part of a ten-year vision to support 70 artists across open to Koorie and Victorian-based Aboriginal and generations – from emerging to established, across Torres Strait Islander artists from emerging to senior, all media – to embrace risk and experimentation in for works in all visual art mediums including painting, their practice. A panel of Artspace staff and Board will drawing, photography, etching, sculpture and select seven artists to take up residence in 2019. installation. All entries will be eligible for numerous artspace.org.au prizes including the Creative Victoria Award for Excellence in Any Media $10,000; the Metro Tunnel Global Project Space Creative Program Award $5,000; and the Koorie Heritage Trust People’s Choice Award $500. The Creative Exchange exhibition opens at the Koorie Heritage Trust on Applications open 24 September 2018 Saturday 8 December and continues until Sunday The Asialink Arts Global Project Space Creative 24 February 2019. Exchange invites artists and arts professionals to apply koorieheritagetrust.com.au for 2019 opportunities which consist of Exchanges and project-based Targeted Exchanges co-curated by Asialink Arts and the Asian-based global collaborators Montalto Sculpture Prize 2019 who partner with the Exchange and Projects Program. Entries close 31 October 2018 Participating bodies include tertiary art schools This annual acquisitive prize for sculpture is offering and academies to public and private galleries and $40,000 from 2019, and is open to artists working in philanthropic institutions throughout the Asian region. any medium. The judging panel will select a shortlist Arts Management, Multi-Arts, Performing Arts, Visual of finalists in early November 2018 for exhibition Arts and Writing are supported through this program in the grounds of Montalto from February to August across 13 countries. Visit the Asialink website for 2019. An additional non-acquisitive prize of $1,000 profiles on collaborators and the practices they will for The Mitchell Family Award will also be awarded. be supporting. montalto.com.au asialink.unimelb.edu.au Sculpture at Scenic World Northern Tasmania Arts Submissions close 12 November 2018 Organisations Initiative Scenic World invites submissions for the eighth annual Sculpture at Scenic World exhibition, which Applications close 15 October 2018 transforms the ancient rainforest into an outdoor This program supports arts organisations based art gallery from 5 April to 5 May, 2019. The four- in Northern Tasmania to deliver high quality arts week exhibition features a prize pool of $30,000, activities that strengthen the regions arts sector, including the $20,000 Scenic World Major Award. engage and inspire audiences and the wider Selected artists will go in the running for a number community, and benefit Northern Tasmania’s of other awards; $5,000 Artist Peer Award, $3,000 professional artists and arts workers. This initiative is Environmental Award, $2,000 Scenic World Staff for programs commencing after 1 January 2019 and Choice Award, and $1,000 Carrington Hotel People’s can be for a duration up to 18 months. Choice Prize. Shortlisted artists will also receive a arts.tas.gov.au $1,000 grant for exhibiting in 2019. sculptureatscenicworld.com.au Arts Tasmania Roving Curator Program Arts Activities funding – Arts ACT Submissions close 15 October 2018 Round 2 is open Saturday 1 December 2018 to The Roving Curator program gives museums, Thursday 28 February 2019 galleries and collections access to Arts Tasmania’s The ACT Government has developed a new Arts museum professionals for up to 25 days. Eligibility: Funding Plan for the arts in Canberra. Artists can the applicant organisation must be Tasmanian-based now apply for up to $5,000, at any time of the year. and legally constituted, responsible for managing a Applications for up to $50,000, with two rounds publicly owned collection of movable cultural heritage. open each year, are also available. ACT-based artists The collection must be publicly accessible, and the at all levels, and organisations providing the Canberra organisation must have regular opening hours or community with opportunities to engage in the arts be working towards them. Before submitting are invited to apply. your application, it is recommended that you arts.act.gov.au contact an Arts Tasmania Roving Curator to discuss the planned activity. arts.tas.gov.au

52 Art & Industry ƒ•ϐ‹‡Ž†‹•–”‹ – ‘•’‹–ƒŽ Awards Auxiliary – 42nd Annual Art Exhibition and Sale A.M.E. Bale Travelling Entries are open for the 42nd Annual Mansfield District Hospital Auxiliary Art Exhibition Nov 2 to Scholarship and Art Prize 5. Rotary Prize $2,000 with 5 highly commended W www.gleneira.vic.gov.au/Bale Applications are open ($100 each), People’s Choice Award of $500 and to emerging Australian artists who have demonstrated The Harry & Clare Friday Foundation Award for local talent and achievement in traditional styles for this (Mansfield Shire) artists of $1,500. Judge: Geoff major $50,000 award. Exhibition Nov 24 to Dec 9 at Paynter, landscape artist. Entry forms are available Glen Eira City Council Gallery. Visit website for details from the Art Show Secretary: Susan Swan, and entry. Entries close Wed Oct 3. 130 Killarney lane, Boorolite, Victoria 3723. T (03) 5777-5605, 0411-316-150. Adelaide Perry Prize E [email protected] Entries close Fri Oct 19. for Drawing 2019 T (02) 9704-5693. Montalto Sculpture Prize 2019 E [email protected] T (03) 5989-8412. W www.plc.nsw.edu.au/microsites W www.montalto.com.au/sculpture-prize A $40,000 A $25,000 acquisitive award for Drawing. Exhibition acquisitive prize for sculpture. Exhibition Feb 24 to March 2 to 28, 2019. Visit website for details and Aug 25, 2019. Download entry form and details from entry form. Entries close Wed Jan 9, 2019. website. Entries close Wed Oct 31. See ad page 23. BAM Art Prize The North Sydney Art Prize The inaugural non-acquisitive BAM Art Prize for W northsydney.nsw.gov.au/artprize Call for artists works in any medium is open to all artists nation- to exhibit interior and exterior works across the wide, offering not only prize money but a unique renowned Coal Loader site at 2 Balls Head Drive, visibility opportunity, featuring the winner on the Waverton. Exhibition March 2 to 17, 2019. cover of Byron Arts Magazine. Winners of all Highly Visit website for details and online entry. Commended Awards will also be featured, and all Entries close Mon Oct 31. See ad page 22. finalists will be featured digitally. The prize will be presented on Nov 9, continuing with a three-week Sculpture at Scenic World 2019 finalists exhibition at Thomgallery, Byron Bay’s W www.sculptureatscenicworld.com.au Entries leading art gallery. www.thomgallery.info are invited for the eighth annual outdoor sculpture Visit www.byronartsmagazine.com.au for details and exhibition in the ancient Blue Mountains rainforest in entry form. Entries close Sat Oct 13. 2019. Opportunities for artists include the Major prize of $20,000 and the $5,000 Environmental Award. Burnie Print Prize Visit website for details and entry form. T (03) 6430-5875. E [email protected] Entries close Mon Nov 12. W www.burniearts.net Burnie Regional Art Gallery See ads pages 178 and 179. is calling artists to enter the 2019 Burnie Print Prize and is offering a major acquisitive award of $15,000. Exhibition March 22 to May 5, 2019. Entry forms are available online. Entries close Fri Oct 5. Ceramic Break Sculpture Park Sculpture Prize ‘Bondi’, Warialda 2402. T (02) 6729-4147. W form.jotform.co/81779289306875 Entries are open for this $12,000 acquisitive prize for sculpture. Exhibition Sept 7, 2019 to Jan 3, 2020. Submissions close Mon July 1, 2019. Contemporary Art Awards 2019 W contemporaryartawards.com Winner’s prize, $5,510 worth of cash and prizes, plus additional prizes for finalists. Apply online, or through the supplied hardcopy application form. Visit the website for details. Entries close Wed Nov 28.

Art & Industry 53 Submissions Materials & Proposals Art Spectrum E [email protected] Editions 2019 – Call forEntries W www.artspectrum.com.au We are the makers of colour, dedicated to creating the finest possible artists’ T 0432 323 188. W www.tacitart.com.au colours. Visit website for more information on these Tacit Galleries invites entries from Victorian based quality products. See ad page 135. printmakers for the Editions 2019 exhibition to run Feb13to24. Entries close Sat Dec 1. ArtStretchers ‹ŽŽ † ”–‹•–• ‹ ‡•‹†‡ ‡ Art supplies and Program canvas stretching T (02) 6333 6555. W www.hillendart.com.au 309 311 High Street, Northcote VIC 3070. Applications are open for 2019. This residency T (03) 9486 4446. E [email protected] program is based in Hill End, managed by Bathurst W www.artstretchers.com.au H Mon Fri 9.00 to Regional Art Gallery in partnership with the 5.30, Sat 10.00 to 3.00. Also at 161 Morphett Department of Environment & Heritage NSW Parks Street, Adelaide SA 5000. T (08) 8212 2711. and Wildlife Services. E [email protected] See ad page95. Submissions close Wed Oct 31. See ad page 125. Arthouse Direct Maggie Wren’s Art Space W www.arthousedirect.com.au An extensive range Call Out for exhibitions ofart,graphic and craft supplies for students and professionals. Watercolour specials on Maimeri E [email protected] Venezia 15ml Single Tubes, and Daler Rowney W www.maggiesartspace.com.au Maggie’s art space Aquafine 1/2 Pans Single. See ad page 55. caters for contemporary and new media art. Low cost Fri, Sat and Sun shows. Starting at $450 for the complete space at 178 Johnston Street DeansArt Collingwood, 3066. E [email protected] W www.deansart.com.au Complete range of artists’ materials available. Project Gallery 90 90 Oxford Street, Paddington, Sydney 2021. Eckersley’s Art & Craft T 0402 144 350. E [email protected] W www.eckersleys.com.au Shop online and in-store. W www.projectgallery90.com Calling artists, Gift cards available. curators and designers to apply to exhibit in this new conceptspace. Fitzroy Stretches 63 Weston Street, Brunswick VIC 3056. Tacit Galleries 2019/20 T (03) 9380 9553. E [email protected] Proposals W www.fitzroystretches.com T 0432 323 188. W www.tacitart.com.au Exhibition proposals are open to exhibit in 2019/20. Jasco W www.jasco.com.au Your guidetothe best value art and craft supplies around! Kadmium Art + Design Supplies W www.kadmium.com.au 80b Bay Street, Broadway NSW 2007. T (02) 9212-2669.

54 Art & Industry Maimeri Venezia Daler-Rowney 15ml Single Tubes Aquafine 1/2 Pans Were $9.25 each Single

NOW $7.25 Were $5.25 each NOW $3.90

Bendigo Essendon Richmond Sunbury Nowra Thornleigh 159 McCrae St, 114 BuckleySt, 236 Swan St, 2B Old Bakery Walk, 6/68 North Street 9a/10 PioneerAve BendigoVIC 3550 EssendonVIC3040 Richmond VIC3121 Sunbury VIC 3429 Nowra NSW2541 ThornleighNSW 2120 Ph: (03) 5443 9700 Ph: (03) 9337 3594 Ph: (03) 9428 1511 Ph: (03) 9740 7487 Ph: (02) 4421 6821 Ph: (02) 9483 2418 www.arthousedirect.com.au Kerrie Lowe The Sydney Canvas Company Ceramic Art Supplies 9/79 Station Road, Seven Hills NSW 2147. 49 King Street, Newtown NSW 2042. T (02) 8854-5070. W www.tsccaus.com.au T (02) 9550-4433. W www.kerrielowe.com Superior quality artists’ cotton and linen canvas rolls. H Mon-Sat 10.00 to 5.30 (Thurs 10.00 to 7.00). Stretcher bars, stretching tools, gesso, easels. Order The only location in the inner city selling clay, your swatch book online or call us. See ad page 132. underglazes, glazes, tools and museum gel. Wholesale Canvas Australia Neil Wallace 29 Smith Street, Marrickville NSW 2204. Printmaking Supplies T (02) 9517-3025. W www.wholesalecanvasaustralia.com.au 409 Gore Street, Fitzroy VIC 3065. Wholesalers of fine primed and unprimed canvas and T (03) 9419-5949. E [email protected] linen rolls. A range of stretcher bars available. W www.e-artstore.net H Mon-Fri 9.30 to 5.30, Sat 10.00 to 5.00. Huge range of materials for printmakers and artists, also stocking a range of bookbinding accessories. Now stocking Sennelier watercolour half pans and tubes in 98 colours, and a Services range of sets. See ad page 101. A Brush with Jordan Newtown Art Supplies W www.abrushwithjordan.com Unique tours for art T (02) 9516-2339. W www.newtownartsupplies.com.au lovers. Experience the ancient country of Jordan from Online Australia-wide. the artists’ perspective. Visit website for details. See ad page 57. Parkers Sydney Fine Art Supplies ”– —–‡” W www.parkersartsupplies.com T 0404-434-008. E [email protected] Darlinghurst: Building 22, National Art School, Cnr W www.arthunter.com.au Art Hunter moves art, Forbes and Burton streets, Darlinghurst NSW 2010. quickly and safely offering affordable rates, regional T (02) 9339-8706. E [email protected] and interstate delivery, seven days, and at short The Rocks: 3 Cambridge Street, The Rocks NSW 2000. notice. Art installation. See ad page 96. T (02) 9252-3706. E [email protected] Art Production Services T 0404-280-768. Port Art Supplies E [email protected] 83 Commercial Road, Port Adelaide SA 5015. W www.artproductionservices.com T (08) 8241-0059, F 8241-0058. On-Site art documentation for print, publication and E [email protected] archive. Sydney, NSW and ACT. W www.portartsupplies.com.au H Mon-Fri 8.30 to 5.00, Sat 9.00 to 2.00. Stockists of quality fine art Art. Van. Go. Sydney materials. See ad page 157. T 0404-027-445. W www.artvango.com.au Affordable, professional fine art transport for galleries, S&S Creativity Unlimited artists, framers and you in Sydney and NSW. T 1300-731-529. W www.creativityunlimited.com.au Wholesalers of fine art supplies. Stocking a range Artist Moving Artists of art and craft materials with over 22,000 items in the range. Melbourne T 0437-214-402. E [email protected] W www.artistmovingartists.com.au Shades of Art Art courier Melbourne and regional Victoria. 74C Ovens Street, Wangaratta, VIC 3677. Affordable prices. See ad page 90. T (03) 5722-2296. W www.shadesofart.com.au Fine Art and Craft Supplies. Arts Accountant & Valuer Michael Fox 79 Langridge Street, Collingwood 3066. T (03) 8560-3583. E [email protected] W www.foxmichael.com.au H Tues-Sat 10.00 to 6.00. Michael Fox offers specialist tax advice to creative professionals. Registered with the Australian Tax Practitioners Board. 56 Art & Industry Artward Bound Kosnar’s Picture Framing T 0418-545-834. E [email protected] Ascot Vale, Melbourne W www.artwardbound.com.au Art hanging systems/ 488 Mount Alexander Road, Ascot Vale VIC 3020. art installation. Police and working with children T (03) 9370-5744. W www.kosnar.com.au check provided. We offer a large range of frame styles for the artist and collector. Expert advice in framing design for all types Belgrave Creative Space of artwork. 1658a Burwood Highway, Belgrave 3160. T 0425-831-425. W www.belgravecreativespace.com Lupo Bianco Photography Space for hire: workshops, forums, exhibitions, and Design classes, private tuition, performances, rehearsals and art projects. T 0439-675-240. E [email protected] W www.lupobianco.com.au Documentation of all Chapman & Bailey kinds of artworks. See ad page 69. 420 Johnston Street, Abbotsford VIC 3067. Mal Wood Foundry T (03) 9417-0500. E [email protected] W www.chapmanbailey.com.au 6 Kurnai Avenue, Reservoir VIC 3073. Custom framing,stretchers/stretching. Australia’s most T (03) 9462-3793. E [email protected] comprehensive professional art service. Best-quality W www.malwood.com.au artists materials, linens and stretchers. Omnus Framing Fine Art Restoration 409 Gore Street, Fitzroy VIC 3065. T 0415-482-686. E [email protected] T (03) 9419-2226. E [email protected] W www.laetitiawojtas.com Laetitia Wojtas professional W www.omnusframing.com.au H Mon-Fri 9.30 painting restoration in Sydney. Specialising in modern to 5.30, Sat 10.00 to 5.00. Archival framing – and contemporary art. Contact for a free quote. specialising in works on paper and beautifully hand- See ad page 53. crafted, sustainably-grown timber frames. See ad page 101. Fitzroy Stretches Parkers Framing Works 63 Weston Street, Brunswick VIC 3056. T (03) 9380-9553. E [email protected] 69 Renwick Street, Redfern NSW 2016. W www.fitzroystretches.com Framing, stretching and T (02) 9698-8591. E [email protected] printing. Fine art printing on rag paper and canvas. W www.parkersartsupplies.com All our prints are exhibition-quality and archival to museum standards. Gianna Rosica Accounting for the Arts T (03) 9428-3855. E [email protected] W www.giannarosica.com.au Chartered accountants specialising in the taxation and accounting needs of the arts community. See ad page 92. IAS – International Art Services W www.iasdas.com.au Sydney: (02) 9667-1077, Melbourne: (03) 9329-6262, Brisbane: (07) 3890-7422, Canberra: (02) 6232-9773, Perth: (08) 9249-5376. Fine Art Logistics.

Art & Industry 57 ‹ –—”‡ ƒ‰‹‰›•–‡• Stella Downer T 1300-883-645. Dealer, Consultant, Valuer E [email protected] T 0402-018-283. E [email protected] W www.picturehangingsystems.com.au W www.stelladownerfineart.com.au H Tues-Fri Manufacture, supply and installation of modern 10.00 to 5.00, Sat 11.00 to 5.00, or by appt at discreet picture hanging systems. Effortless art Stella Downer Fine Art 1/24 Wellington Street, installation. Australia-wide. Waterloo, 2017. Approved valuer for the Australian Government Cultural Gifts Program. Insurance/market Print 2 Metal value, authentication, consulting and collection T (03) 9571-2600. E [email protected] management. W www.print2metal.com Award winning Print 2 Metal specialises in the printing of photos, artwork and graphics onto metal. Five surfaces available. Member The Sydney Canvas Company 9/79 Station Road, Seven Hills NSW 2147. Organisations T (02) 8854-5070. W www.tsccaus.com.au Handmade custom stretched canvases. We stretch existing artwork of any size. See ad page 132. Art Gallery of New South Wales (AGNSW) T (02) 9225-1664. W www.artgallery.nsw.gov.au/ members Call or visit the website for information Consultants about gallery membership; discounts, free exhibition viewings, magazine and over than 400 lectures, & Valuers workshops and other events each year. Copyright Agency | Viscopy Louise Smith Fine Art T 1800-066-844 (toll free). W www.copyright.com.au Melbourne Copyright Agency | Viscopy are not-for-profit rights T 0418-519-747. E [email protected] management organisations and collection societies. W louisesmithfineart.com.au Approved valuer We enable the use of text and images in return for fair Australian Government Cultural Gifts Program and payment to visual artists, writers and publishers. member Art Consultants Association Australia. With over 30 years’ experience. National Association for the Visual Arts (NAVA) Noël Stott of Adam Galleries T (02) 9368-1900. E [email protected] Fine Art Valuer of Australian W www.visualarts.net.au NAVA is the peak body and European Art representing and advancing the professional interests of the Australian visual arts, craft and design sector. T 0407-338-538. E [email protected] See ad page 111. W www.adamgalleries.com Paintings, drawings, graphics, sculpture and photography. Fine art consultant and approved valuer for the Australian The Print Council of Australia Cultural Gifts Program. Member of Art Consultants (PCA) Association of Australia. Over 30 years experience. W www.printcouncil.org.au A national not-for-profit member organisation that promotes contemporary Private View Art Collections Australian fine art printmaking and print media, T 0409-505-628. E [email protected] including artist books, zines and works on paper, and W www.privateviewart.com Private and corporate provides support and advocacy for artists. Through collection development and advice. Offering publications, commissioned editions, exhibitions and assistance with sourcing, framing, conserving, and other events we work to foster a greater appreciation investing in art, with an extensive range of specialist of original prints and a knowledge of the history networks. of Australian printmaking amongst our members, collectors and the wider community.

58 Art & Industry Resale Royalty ƒ†•–—†‹‘”–Žƒ••‡• T 1800-066-844 (toll free). W www.catholiccarechoices.org.au Hands On Studio W www.resaleroyalty.org.au Copyright Agency has is a creative and inclusive art space that provides been appointed by the Australian Government to people with disabilities access to art education and manage the resale royalty scheme, which pays a facilities at the M16 studio and gallery complex share from eligible resales of artworks to artists. in Griffith. Classes include painting, drawing, printmaking, mixed media and clay. Contact Catholic Royal Queensland Art Society Care Choices (02) 6295-4300, or visit website. Unit 3, 162 Petrie Terrace, Brisbane QLD 4000. T (07) 3367-1977. E [email protected] Ku-ring-gai Art Centre W www.rqas.com.au/rqas-membership The Royal T (02) 9424-0310. W www.kmc.nsw.gov.au/artcentre Queensland Art Society Brisbane Branch welcomes Visual art, guitar, creative writing classes. Exhibitions/ all artists covering a diverse range of media. Social, events. Day, night and weekend classes available. Country, and Family memberships welcomed. Adult, children, teens. Beginner to advanced Networking and social events, exhibition opportunities welcome. Facebook @kuringgaiartcentre at Petrie Terrace Gallery and workshops. MAPart T 0425-831-425. E [email protected] W www.mapart.com.au High quality art workshops, Training tutoring, professional development and tertiary preparation for Schools and community. Art Folio Interview preparation for art and design Art Intensive: Workshops undergraduate studies, $60 per hour consultation. Qdos Arts Lorne Also reduced rate group consultations. Visit website T (03) 5289-1989. W www.qdosarts.com for details. See ad page 89. Oct 9, 10 and 11, Phil Doggett-Williams – QDOS Drawing Intensive: Technique, Process and Invention. MAS Gallery & Studio Oct 13, David Long – Dry Stone walling as sculpture Art Classes or plinth. Oct 20 and 21, Jock Clutterbuck – Drawing with the Mind’s Eye. Oct 27 and 28, Dianne Longley 1297-1299 High Street, Malvern VIC 3144. – Encaustic Workshop. Oct 30 and 31, and Nov T (03) 9822-7813. E [email protected] 1, Rimona Kedem – Conservations with Self. Nov W www.malvernartists.org.au Art classes including: 13, 14 and 15, Shona Wilson – Collaborations with life drawing, oils, acrylics, drawing, watercolour, Nature. For all Workshop details please call Qdos Arts mixed media and open studio. Beginners and all or visit website. levels invited. The Art Room Melbourne Sculpture School 125 Hyde Street, Footscray VIC 3011. T 0407-197- T 0407-509-758. 106. W www.the-art-room.com.au An art class, W www.melbournesculptureschool.com studio workshop and all round creative hub in the Sat mornings – Life Modelling, Mould Making and Inner West of Melbourne. Bronze Casting. Thurs evenings – Design, Mould and Foundry. Sat afternoons – Introduction to Sculpture. ARTCLASSCO Beginners welcome. Art Classes in Fitzroy Melbourne Melbourne Studio of Art W www.artclassco.com Visual artist Jacqui Stockdale 544 Glen Huntly Road, Elsternwick 3185. offers Short Courses and Masterclasses for all levels. T (03) 9528-3392. E [email protected] Painting, drawing, collage and mentoring. W studyart.com.au Choose from daytime or evening classes, as well as Sunday workshops and week-long Bayside Sculpture & Gallery intensives. Learn from professional tutors, many of 16B Advantage Road, Highett 3190. whom are award winning artists. See ad page 89. T (03) 9553-0661. W www.baysidesculpture.com.au H Daily 11.00 to 5.00. Term 4: eight-week sculpture Warringah Printmakers Studio classes beginning Oct 15, 16 and 17. Cnr Condamine and Lovett streets (entry on Condamine Street), Manly Vale NSW 2093. W www.printstudio.org.au Workshops and weekly printmaking classes available. Please see website for details. Bookings: [email protected]

Art & Industry 59 Dissect journal Art W www.dissectjournal.com An independent contemporary art publication with a focus on art and artists, and explores writing, editing, design and Publications publishing as artistic practice. Art + Australia eyeline W www.artandaustralia.com Art + Australia is T (07) 3138-5521. E [email protected] a publishing and research body that focuses on W www.eyelinepublishing.com Contemporary visual contemporary art and its relationship to broader arts magazine. Get free access to the eyeline digital theoretical, social and geo-political contexts. archive when you subscribe. See ad page 153. Art Almanac Imprint W www.art-almanac.com.au Australia’s monthly W www.printcouncil.org.au The quarterly journal of guide to galleries, news and awards. See ad page 61. the Print Council of Australia Inc. Subscribe now. See ad page 103. Art Monthly W www.artmonthly.org.au/subscribe Visual arts Museum essays, reviews and options – Australia, New Zealand W www.museum-magazine.com Museum is a and the Asia-Pacific region. magazine investigating contemporary art, fashion and photojournalism. ”–•‹ƒƒ ‹ϐ‹ W www.artasiapacific.com ArtAsiaPacific magazine Oberon is the leading English-language periodical covering W www.oberonmagazine.com Oberon is a periodical contemporary art and culture from the Middle East on art in the world. and Asia-Pacific. Pollen The Article W www.pollenmagazine.com In each issue POLLEN W thearticle.com.au The Article is a new forum for takes a theme from philosophy and explores it Australian and International cultural debate, reviews through a collision of photography, fiction, essay, and features by professional writers. poetry and more. ”–‹•–”‘ϐ‹Ž‡ Runway W www.artistprofile.com.au The artists behind W www.runway.org.au Runway is an independent the art. Artist interviews, essays, reviews, news. Australian experimental art journal run by a collective Subscribe online at mymagazines.com.au of Sydney-based and internationally-based artists, writers and curators. Artlink W www.artlink.com.au Contemporary art of Australia Sturgeon and the Asia-Pacific. Online reviews and archive. W www.sturgeonmagazine.com.au Produced by Artbank magazine surveys Australian art, culture, etc. Broadsheet Journal W www.cacsa.org.au Essays and reviews on un Magazine contemporary art practice supporting critical thinking. W www.unprojects.org.au Projects publishes essays, artists’ work and reviews with a focus on artists, Discipline writers, artist-run initiatives and independent projects. W www.discipline.net.au Discipline is a contemporary art journal publishing artist pages and interviews, Vault research essays on contemporary Australian art, and W www.vaultart.com.au New Art & Culture Magazine. histories and theories of contemporary art as a global industry or phenomenon.

60 Art & Industry Subscribe 11 issues for $59 Huge savings on the cover price Free delivery to your door Never miss an issue

artalmanac.com.au mymagazines.com.au Call 1300 361 146 or +61 2 9901 6111 for international callers

Gallery Index

63 A - C

Aboriginal & Pacific Art 123 Ballarat – Gallery on Sturt 109 Academy Gallery 155 Bank Art Museum Moree 142 ACE Open 157 BAROMETER Gallery 132 Adelaide Central Gallery 157 Barossa Regional Gallery 159 AIRspace Projects 125 Bathurst Regional Art Gallery 145 Alcaston Gallery 80 Bay of Whales Gallery 107 Alternating Current Art Space 88 Bayside Sculpture 98 ANCA Gallery 148 Beaver Galleries 150 Andrew Baker Art Dealer 169 Bega Valley Regional Gallery 143 Anna Schwartz Gallery 74 Belalie Art Gallery 159 Annandale Galleries 125 Belconnen Arts Centre 151 Anne & Gordon Samstag Museum of Art 157 Belgrave Creative Space 98 Annette Larkin Fine Art 131 Benalla Art Gallery 110 Anthea Polson Art 171 Bendigo Art Gallery 109 ANU Drill Hall Gallery 150 Bett Gallery Hobart 153 ANU School of Art Gallery 150 BlackCat Gallery 82 APY Gallery 118 Blacktown Arts Centre 136 Araluen Arts Centre 167 Blarney Books & Art 108 Ararat Gallery TAMA 108 Blender Gallery 132 ARC ONE Gallery 74 BLINDSIDE 74 arc Yinnar Gallery 106 Blue Mountains City Art Gallery 144 ARO 118 BOAA ART 2018 109 Art at Linden Gate 98 Bolin Bolin Gallery 98 Art at St Francis 69 Boom Gallery 108 Art Atrium 131 Boomalli Aboriginal Artists Co-operative 126 Art Gallery of Ballarat 109 Box Hill Community Arts Centre 98 Art Gallery of New South Wales 115 Bradley Hall Antiques & Art Gallery 112 Art Gallery of South Australia 158 Brett Whiteley Studio 124 Art Gallery of Western Australia 162 Bridget McDonnell Gallery 78 Art Gallery on Darling 125 Brightspace 90 Art Mob 153 Broken Hill Regional Art Gallery 145 The Art of Dr. Seuss 69, 115 Brunswick Street Gallery 82 Artarmon Galleries 128 Bunbury Regional Art Gallery 164 Artback NT 167 Bundaberg Regional Galleries 172 Artbank, Melbourne 92 Bundeena Maianbar Art Trail 136 Artbank, Sydney 123 Bundoora Homestead Art Centre 98 Artereal Gallery 125 Buratti Fine Art 163 Arthouse Gallery 120 Burnie Regional Art Gallery 155 Articulate project space 125 Burra Regional Art Gallery 159 Artitja Fine Art 161 Burrinja Gallery 98 Arts Academy, Post Office Gallery 109 Buxton Contemporary 77 Artsite Galleries 126 Cairns Art Gallery 172 Artspace 120 Cambridge Studio Gallery 82 Artspace Mackay 172 Campbelltown Arts Centre 137 ArtSpace Wonthaggi 106 Canberra Contemporary Art Space, Gorman Arts Centre 148 Ascot Theatre Gallery 159 Canberra Contemporary Art Space, Manuka 150 Australian By Design 69 Canberra Glassworks 150 Australian Centre for Contemporary Art 76 Canberra Museum and Gallery 148 Australian Centre for Photography 120 Carlisle Street Arts Space 90 Australian Centre for the Moving Image 69 Castlemaine Art Museum 110 Australian Galleries 80, 132 Casula Powerhouse Arts Centre 137 Australian Galleries 80 Central Goldfields Art Gallery 110 Australian Print Workshop 80 Ceramic Break Sculpture Park 145 Australian Tapestry Workshop 76 Cessnock Regional Art Gallery 141

64 Gallery Index C - J

Chapman & Bailey Gallery 82 Gab Titui Cultural Centre 172 Chapter House Lane 74 Gaffa Gallery 115 Charles Darwin University Art Gallery 166 GAGPROJECTS | Greenaway Art Gallery 158 Charles Nodrum Gallery 86 The Gallery at Bayside Arts & Cultural Centre 90 City of Joondalup 162 Gallery 139 141 Coffs Harbour Regional Gallery 142 Gallery 360 163 Collingwood Gallery 82 Gallery 9 122 Colville Gallery 153 Gallery at HOTA 171 The Commercial 118 Gallerysmith 78 Contemporary Art Awards Exhibitions 169 Gate 6 Gallery 100 Contemporary Art Society of Victoria Inc. 86 Gecko Studio Gallery 106 Contemporary Art Tasmania 155 Gee Lee-Wik Doleen Gallery 100 Contour 556 148 Geelong Gallery 108 Cool Change Contemporary 162 George Paton Gallery 78 Counihan Gallery In Brunswick 86 Geraldton Regional Art Gallery 164 Cowra Regional Art Gallery 146 Gippsland Art Gallery 106 Craft Victoria 74 Glass Artists’ Gallery 126 Craft ACT 148 Glen Eira City Council Gallery 97 The Cross Art Projects 120 The Goat Gallery 110 Crowther Contemporary 69 Godinymayin Yijard Rivers Arts and Cultural Centre 166 The Cullen 88 Gordon Studio Glassblowers 105 Davson Gallery 171 Gosford Regional Gallery 141 The Dax Centre 78 Goulburn Regional Art Gallery 146 Deakin University Art Gallery 98 Grace Cossington Smith Gallery 128 Deakin University Burwood Library Gallery Space 100 Grafton Regional Gallery 142 Defiance Gallery 124, 126 Graydon Gallery 169 Defiance Gallery at Mary Place 132 Griffith Regional Art Gallery 146 Despard Gallery 154 The Guild Assembly Point 77 Devonport Regional Gallery 155 Gympie Regional Gallery 171 Domain House 77 Handmark Gallery 154 Duck Print Fine Art 143 Harvey Galleries 128 Duldig Studio 92 Hawthorn Studio & Gallery 96 East & West Art 96 Eastgate Gallery 96 Hazelhurst Regional Gallery & Arts Centre 137 Elizabeth Arthur Fine Art Gallery & Sculpture Garden 108 Headland Artists and Sculpture Park 128 Eltham Library Community Gallery 100 Heartland Studio 158 Factory 49 126 Heathcote Museum and Gallery 161 Falkner Gallery 110 Heide Museum of Modern Art 100 Fellia Melas Gallery 132 The Henry Jones Art Hotel 154 FELTspace 158 Heritage Hill Museum and Gardens 100 Fine Arts, Sydney 120 Horsham Regional Art Gallery 112 Finite Gallery 141 Hugo Michell Gallery 158 Firestation Print Studio Gallery 92 Hurstville Museum and Gallery 137 FireWorks Gallery 169 The Ian Potter Museum of Art 78 Firstdraft 120 in.cube8r gallery & emporium 82 Flinders Lane Gallery 74 Incinerator Gallery 100 Flinders Street Gallery 124 Islamic Museum of Australia 86 fortyfivedownstairs 74 Jahroc Galleries 164 4A Centre for Contemporary Asian Art 118 JamFactory 158, 159 Fox Galleries 82 Jan Manton Art 169 Fox Jensen Gallery 132 Jan Murphy Gallery 169 Frances Keevil Gallery 120 Japingka Gallery 161 Frankston Arts Centre and Cube 37 Galleries 105 Jervis Bay Maritime Museum & Gallery 143 Fremantle Arts Centre 161 Joel Gallery 100

Gallery Index 65 J - P

John Curtin Gallery 164 Melbourne Studio of Art 98 Justin Art House Museum 88 Merricks House Art Gallery 105 Kapunda Community Gallery 159 Metropolis Gallery 108 Kate Owen Gallery 126 Michael Reid Sydney 124 The Ken Done Gallery 115 Mildura Arts Centre 112 Kerrie Lowe Gallery 128 Millicent Gallery 159 Kerrie Warren, Artist & Pilgrim Creek Studios 112 The Mission to Seafarers 70 Kerry Packer Civic Gallery 158 Mitchell Fine Art 169 KickArts Contemporary Arts 172 Modern Times 82 King Street Gallery on William 122 Mona – Museum of Old and New Art 154 Koorie Heritage Trust 69 Monash Gallery of Art 102 Korean Cultural Centre Australia Gallery 115 Monash University Museum of Art 97 Kosnar’s Picture Framing 102 MONDO ART 110 La Trobe Art Institute 110 Montalto Sculpture park 105 Lake Macquarie City Art Gallery 141 Montville Art Gallery 171 Langford 120 78 Moores Building Contemporary Art Gallery 162 The Larwill Studio 80 Mornington Peninsula Regional Gallery 103 Latrobe Regional Gallery 106 Mosman Art Gallery 130 Lauraine Diggins Fine Art 97 Mu Studio Gallery 131 Laurent Gallery 77 Mundaring Arts Centre 164 Lawrence Wilson Art Gallery 163 Murray Art Museum Albury 146 Lesley Kehoe Galleries 70 Museum and Art Gallery of the Northern Territory 166 Linden New Art 88 Museum of Brisbane 169 Linton & Kay Galleries 163, 164 Museum of Contemporary Art Australia 115 Lismore Regional Art Gallery 143 Museum of Sydney 116 Liverpool Street Gallery 122 Muswellbrook Regional Arts Centre 143 The Lock Up 141 Nancy Sever Gallery 148 Lorraine Pilgrim Gallery 171 NAS Gallery 122 Lost Bear Gallery 145 National Association for the Visual Arts 122 Lynn Jaanz Art Gallery 77 National Gallery of Australia 151 M16 Artspace 150 National Gallery of Victoria 70, 77 Macquarie University Art Gallery 137 National Library of Australia 151 MADA Gallery 97 Maffra Exhibition Space 107 National Portrait Gallery 151 Maitland Regional Art Gallery 141 Neon Parc 70 Manly Art Gallery & Museum 130 New England Regional Art Museum 146 Manning Regional Art Gallery 143 Newcastle Art Gallery 141 Manningham Art Gallery 102 Niagara Galleries 86 Manyung Gallery Malvern 94 Nicholas Thompson Gallery 82 Manyung Gallery Mount Eliza 105 Nolan on Lovel Gallery 145 March Space 98 Noosa Regional Gallery 171 Margaret Lawrence Gallery 77 Norman Lindsay Gallery & Museum 145 Margaret River Gallery 164 Northern Centre for Contemporary Art 166 Margaret Whitlam Galleries, Female Orphan School 137 NSW Parliament 116 Margot Hardy Gallery 137 Nyisztor Studio 164 Maroondah Access Gallery 102 Oak Hill Gallery 105 Martin Browne Contemporary 134 The Olsen 88 MAS Gallery 94 Olsen Gallery 134 Maunsell Wickes Gallery 134 Orange Regional Gallery 146 MAY SPACE 124 Outstation Gallery 167 McClelland Sculpture Park + Gallery 105 Pan Pacific Melbourne 72 McGlade Gallery at the Australian Catholic University 128 Parramatta Artists Studios 137 Media House Gallery, The Age 70 Peacock Gallery and Auburn Arts Studio 138 Megalo Print Studio + Gallery 151 Penrith Regional Gallery & The Lewers Bequest 138

66 Gallery Index P - Z

Performance Space 118 Sullivan+Strumpf 124 Perth Institute of Contemporary Arts 162 Suzanne O’Connell Gallery 170 Phil Henshall Studio 112 Swan Hill Regional Art Gallery 112 Philip Bacon Galleries 170 Sydney Road Gallery 131 Plimsoll Gallery 154 Sydney Sculpture Conference: a universal language 116 Port Hedland Courthouse Gallery 164 Tacit Galleries 83 Port Jackson Press Print Gallery 83 Tactile Arts 167 Port Pirie Regional Art Gallery 159 Tandanya 159 Post Office Gallery 110 TarraWarra Museum of Art 103 PROJECT [504] 131 Tasmanian Museum and Art Gallery 154 Project Gallery 90 134 Ten Cubed 94 Qdos Arts + Sculpture Park 108 Thienny Lee Gallery 136 Quadrant Gallery 96 THIS IS NO FANTASY + dianne tanzer + nicola stein 83 Queen Victoria Museum & Art Gallery 155 Tinning Street Presents 86 Queensland Art Gallery | Gallery of Modern Art 170 Tolarno Galleries 72 QUT Art Museum 170 Toorak Village Art Walk 90 red gallery 83 Toowoomba Regional Art Gallery 171 Red Tree Gallery Jindivick 112 Town Hall Gallery 96 Redland Art Gallery 170 Tributary Projects 151 Retrospect Galleries 143 The University Gallery and Senta Taft-Hendry Museum 142 Rex-Livingston Art + Objects 145 University of Queensland Art Museum 170 RMIT Gallery 72 UNSW Galleries 123 RMIT Project Space / Spare Room 80 Utopia Art Sydney 125 Robin Gibson Gallery 122 UTS Gallery 118 Roslyn Oxley9 Gallery 134 Vermilion Contemporary Chinese Art 116 Sabbia Gallery 134 Victorian Artists’ Society 83 Saint Cloche 134 Vivien Anderson Gallery 92 Salamanca Arts Centre 154 Wagner Contemporary 136 SASA Gallery 159 Wagner Framemakers 154 Sawtooth ARI 155 Walker Street Gallery & Arts Centre 103 SCA Galleries 128 Wallarobba Arts and Cultural Centre 131 SCOPE Galleries 108 Wangaratta Art Gallery 112 Scott Livesey Galleries 94 Wanneroo Gallery 163 Sculpture among the Tulips 112 Warrnambool Art Gallery 108 Sculpture by the Sea: Bondi 2018 136 Watch This Space ARI 167 S.H. Ervin Gallery 116 Watt Space 142 Sheffer Gallery 118 Watters Gallery 123 Shepparton Art Museum 112 West End Art Space 74 The Shop Gallery 128 Western Plains Cultural Centre 146 Sister Gallery 159 Western Sydney University Art Gallery 138 Soho Waterloo 124 WHISTLEWOOD Contemporary Australian Art 106 STACKS Projects 122 White Rabbit Gallery 118 Stanley Street Gallery 123 Whitehorse Artspace 103 State Library of NSW 116 William Holt Gallery 77 State Library of South Australia 159 William Mora Galleries 87 STATION 88 Wishart Gallery 108 Stella Downer Fine Art 124 Wollongong Art Gallery 144 Stephen McLaughlan Gallery 74 Women’s Art Register 1975-2015 87 Steps Gallery 80 The Woollahra Small Sculpture Prize 136 Stockroom Gallery 110 Yandina Historic House 171 Strathnairn Arts 151 Yarra Ranges Regional Museum 103 Studio B Gallery 88 Yarra Sculpture Gallery 87 Sturt Gallery & Studios 143 Yellow Dot Art Gallery 128 Suki & Hugh Gallery 146 Yuill/Crowley 123

Gallery Index 67 Melbourne

68 Australian Centre Federation for the Moving Image (ACMI) Federation Square, Flinders Street, Melbourne 3000. Square T (03) 8663-2200. W www.acmi.net.au H Daily 10.00 to 5.00. CBD Crowther Contemporary 440 Docklands Drive (last tram stop on the 86, 70 and 35 City Circle Tram lines), Docklands 3008. Art at St Francis E [email protected] Contemporary Art W www.crowthercontemporary.com H Mon-Fri 9.30 to 4.30. Nov 2 to 20 (opening Thurs Nov 2, 6-9pm) 326 Lonsdale Street, Melbourne 3000. Face of a Woman by Zelman Lew. See ad page 93. T (03) 9663-2495. E [email protected] Contact: Brigitte Remmen. H Mon-Fri 9.00 to 5.00, Sun 9.00 to 3.00. Oct 9 to Nov 13 Sotto Voce; Koorie Heritage Trust Streetscapes of North Italy a selection of photographs Yarra Building, Federation Square, Melbourne 3000. by Robert Babic. T (03) 8622-2600. E [email protected] W www.koorieheritagetrust.com CEO Tom Mosby. The Art of Dr. Seuss H Daily 10.00 to 5.00. Oct 6 to Nov 24 Josh X Muir – a solo exhibition of new works by Josh Muir presented by Harvey Galleries, featuring animations, digital prints on aluminium, Block Arcade wallpaper and neon installations. The Block Arcade, 19-18/282 Collins Street, Melbourne 3000. E [email protected] W www.harveygalleries.com.au H Mon-Thurs 10.00 to 6.00, Fri 10.00 to 7.00, Sat 10.00 to 6.00, Sun 9.00 to 5.00. Authorised editions from the Seuss Estate. Australian By Design Room 303e, 3rd Floor, Lift 1 opposite The Hopetoun Tea Rooms, The Block Arcade, 282 Collins Street, Melbourne 3000. T (03) 9663-9883, Terrence 0404-699-033. E [email protected] W www.australianbydesign.com.au H Open daily.

Josh Muir, Moob, 2018, digital print on aluminium Courtesy the artist and Koorie Heritage Trust

Melbourne 69 Lesley Kehoe Galleries The Mission to Seafarers Ground Floor, 101 Collins Street, Melbourne 3000. 717 Flinders Street, Docklands 3008. T (03) 9671-4311. E [email protected] W www.missiontoseafarers.com.au/art-prize W www.kehoe.com.au H Open by appt. To make an Gold coin donation. H Daily 10am to 10pm. appointment, or request an invite to 2018 viewings Oct 5 to 26, 2018 Maritime Art Prize & Exhibition. and events email, or call the gallery. Lesley Kehoe Explorations of the relationship between humanity Galleries is an internationally recognised gallery for and the sea. An exhibition aimed at raising awareness contemporary and historical Japanese artworks. of the experience of 1.5 million merchant seafarers The Galleries provide visitors with an immersive responsible for transporting more than 90 per cent of experience underpinned by beauty and intellect. trade to Australia. See ad page 70. Media House Gallery, The Age National Gallery of Victoria 655 Collins Street (opp. Southern Cross Station), The Ian Potter Centre: Melbourne 3000. Free entry. H Mon-Fri 7am to 7pm, NGV Australia closed weekends and public holidays. Oct 8 to Jan 31, 2019 MARVELLOUS MELBOURNE: Its Art & Federation Square, cnr Russell and Flinders streets, Soul. Prominent Victorian artists capture Australia’s Melbourne 3000. T (03) 8620-2222. most liveable city’s uniqueness through a delightful W www.ngv.vic.gov.au H Daily 10.00 to 5.00. array of paintings, drawings, prints and photographs. To Jan 28, 2019 Baldessin / Whiteley: Contact: Jacqueline Taylor OAM, 0418-357-814 Parallel Visions. To Feb, 2019 Design Storytellers: [email protected] The Work Of Broached Commissions. To Feb 17, 2019 Ken Unsworth: Truly, Madly. Sept 28 to Feb 3, 2019 Polly Borland: Polyverse. Oct 12 to Feb 24, 2019 Rigg Design Prize.

Brett Whiteley, Evening coming in on Sydney Harbour, 1975 National Gallery of Victoria, Melbourne Presented by Mrs Adrian Gibson as the winner of the 1975 Sir William Angliss Memorial Art Prize © Wendy Whiteley Courtesy National Gallery of Victoria Neon Parc 1/53 Bourke Street, Melbourne 3000. T (03) 9663- 0911, Also at 15 Tinning Street, Brunswick 3056. E [email protected] W www.neonparc.com.au H Wed-Sat 12.00 to 5.00, or by appt. Oct 4 to Nov 10 John Meade, and Brent Harris.

70 Melbourne

ƒƒ ‹ϐ‹ ‡Ž„‘—”‡ Watkins. Micro Flight Vehicle Performance: Thurs Oct 25, 5.30-6.30pm White Clouds of Sugar – Mikael 2 Convention Centre Place, South Wharf 3000. Mikael & Friedrich von Borries. Performance and artist Free entry. H Open daily/nightly. Oct 8 to Jan 31, talk: Thurs Nov 1, 5.30-6.30pm Explorations of Air – 2019 MARVELLOUS MELBOURNE: Its Art & Soul Malte Wagenfeld and Jane Burry. Curator’s talk: Thurs – 38 prominent Victorian artists capture Australia’s Nov 8, 6-7.30pm Wind generated drawing systems most liveable City’s uniqueness through a delightful – Cameron Robbins in conversation with Malte array of paintings, drawings, prints and photographs. Wagenfeld and Jan van Schaik. See ad page 12. Enquiries: Jacqueline Taylor OAM, Exhibition Manager/Curator 0418-357-814 [email protected] RMIT Gallery 344 Swanston Street, Melbourne 3000. T (03) 9925-1717. E [email protected] W www.rmit.edu.au/rmitgallery Free admission. Lift access. H Mon-Fri 11.00 to 5.00, Thurs 11.00 to 7.00, Sat 12.00 to 5.00, closed Sun and public hols. Like RMIT Gallery on Facebook. Follow @RMITGallery on Twitter. To Nov 17 Dynamics of Air – capturing the beauty, dynamics and sensuality of air in our built environment and its critical role in designing for a zero carbon future, Dynamics of Air features specially commissioned works that explore radical innovations for creative sustainability. Artists and designers – Transsolar: Thomas Auer (Germany); Breathe Earth Collective: Lisa Maria Enzenhofer, Markus Jeschaunig, Bernhard König (Austria); Friedrich von Borries (Germany); CITA: Phil Ayres (England), Danica Testing Cloudscapes Pistekova (Slovakia), Maria Teudt (Denmark), Petras Transsolar, Courtesy Transsolar and RMIT Gallery Vestartas (Lithuania); Chris Cottrell (New Zealand); Edith Kollath (Germany); Mikael Mikael (Germany); Philippe Rahm Architects (France / Switzerland); Tolarno Galleries Enric Ruiz-Geli (Spain); Little Wonder: Gyungju Level 4, 104 Exhibition Street, Melbourne 3000. Chyon (Korea), John Sadar (Canada). From Australia T (03) 9654-6000 F 9654-7000. – Jane Burry, Helen Dilkes, Leslie Eastman, Natasha E [email protected] Johns-Messenger, Mehrnoush Latifi, Phred Petersen, W www.tolarnogalleries.com Director: Jan Minchin Daniel Prohasky, Cameron Robbins, Malte Wagenfeld (member of ACGA). H Tues-Fri 10.00 to 5.00, Sat and Simon Watkins. Public programs: Tues Oct 1.00 to 5.00. Oct 4 to Nov 3 Dawn Chorus by 9, 12.30-1.30pm Scientific Photography – Phred Nicholas Folland. Petersen. Artist talk: Thurs Oct 11, 5.30-6.30pm Speak Percussion – Polar Force (Eugene Ughetti and Philip Samartzis). Performance and talk: Thurs Oct 18, 5.30-6.30pm Drones & biomimicry – Simon

‘Of Colour & Light’ Victoria Biennial Abstractionist show curated by Anna Prifti Opening: Sat Oct 6th 2-5 pm Exhibition Dates: Oct 5-27 2018 H: Wed - Fri 11am - 4pm Sat 10am - 3pm 185 Rosslyn Street Melbourne VIC 3003 westendartspace.com.au

ARTSPACE

72 Melbourne Destinations 2018

16 – 21 October 2018 62 Lygon Street, Carlton South Vic 3053 The Greek Australian Culture League (GACL) is proud to announce its first multicultural exhibition with the theme “Destinations”. This art exhibition has attracted an eclectic group of local and regional established and emerging artists of diverse cultural backgrounds to meet as a collective and introduce their work to the broader audience. Art is a universal language. As we are becoming a ‘world community’, the wonder of differences in our art and culture must be celebrated. GACL’s “Destinations” aims to foster cross cultural awareness and community unity by building intercultural relationships through art to explore and better understand our common humanity.

Steps Gallery 03 9650 3577 • [email protected] miesf.com.au/steps-gallery The exhibition will also include culturally based entertainment, a creative workshop providing opportunities for audience participation and a poetry afternoon.

Opening Tuesday 16 October 6:30pm Monday - Friday 11:00am - 6:30pm • Saturday - Sunday 11:00am - 4:00pm www.gacl.com.au • [email protected] Instagram: @gaclmelbourne • Facebook: Greek-Australian Cultural League

Melbourne 73 West End Art Space Craft Victoria 175-185 Rosslyn Street, Melbourne 3003. Watson Place, off Flinders Lane behind Supernormal, T 0415-243-917. E [email protected] Melbourne 3000. T (03) 9650-7775. W www.westendartspace.com.au H Wed-Fi 11.00 E [email protected] W www.craft.org.au Free entry. to 4.00, Sat 10.00 to 3.00. Oct 5 to 27 (opening H Mon-Wed 11.00 to 6.00, Thurs-Fri 11.00 to 7.00, Sat Oct 6, 2-5pm) Of Colour & Light – 2018 Victoria Sat 10.00 to 5.00. Biennial Abstract Show. Curated by Anna Prifti. Flinders Lane Gallery 137 Flinders Lane, Melbourne 3000. T (03) 9654-3332. E [email protected] Flinders Lane W www.flg.com.au Director: Claire Harris. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 5.00. Please consult website for any opening hours changes. Our extensive Anna Schwartz Gallery stockroom can also be viewed on our website. 185 Flinders Lane, Melbourne 3000. To Oct 20 Gallery 1 & 2: The Nature of Landscape T (03) 9654-6131. E [email protected] by Jo Davenport. Oct 23 to Nov 10 Gallery 1: New W www.annaschwartzgallery.com Director: Anna Landscapes by William Breen. Gallery 2: The Eternal Schwartz. H Tues-Fri 12.00 to 5.00, Sat 1.00 to Youths by Rebecca Hastings. 5.00. From Oct 6 KINDNESS IS SO GANGSTER, (Specified Abstract Expressionism) by Mike Parr. ARC ONE Gallery 45 Flinders Lane, Melbourne 3000. T (03) 9650-0589. E [email protected] W arcone.com.au Directors: Fran Clark and Suzanne Hampel (member of ACGA). H Tues-Sat 11.00 to 5.00. To Oct 6 Joy Knows No Mercy by Imants Tillers. Oct 9 to Nov 10 Surface Zero by Peter Daverington. BLINDSIDE Nicholas Building, 714/37 Swanston Street (enter via Cathedral Arcade lifts, cnr Flinders Lane), Melbourne 3000. T (03) 9650-0093. E [email protected] W www.blindside.org.au H Tues-Sat 12.00 to 6.00. Oct3to20Unseen by Jan Murray. Also, And They All Say Your Name by Talia Smith + Zainab Hikmet. Rebecca Hastings, The Eternal Youths (The Fetish), 2017, oil on board, 120 x 120cm Courtesy the artist and Flinders Street Gallery

ˆ‘”–›ϐ‹˜‡†‘™•–ƒ‹”• 45 Flinders Lane, Melbourne 3000. T (03) 9662-9966. E [email protected] W www.fortyfivedownstairs.com H Tues-Fri 11.00 to 5.00, Sat 12.00 to 4.00. To Oct 20 Manhattan Dreaming painting and printmaking by Marco Luccio (see ad page 75). Oct 23 to Nov 3 The Far North painting by Allan Wolf-Tasker (see ad page 71).

Zainab Hikmet, Here and there, 2015, two incandescent bulbs Stephen McLaughlan Gallery synchronised to sun patterns in Baghdad and Auckland, dimensions Level 8, Room 16, 37 Swanston Street (cnr Flinders variable Lane), Melbourne 3000. T 0407-317-323. Photograph: Jessie Jane W www.stephenmclaughlangallery.com.au Director: Courtesy the artist and BLINDSIDE Stephen McLaughlan. H Wed-Fri 1.00 to 5.00, Sat 11.00 to 5.00 or by appt. Oct 3 to 20 Paul Zika. Chapter House Lane Oct 10 to Nov 10 South Gallery: Elizabeth Banfield. Entry via Flinders Lane, Melbourne 3000. W www.chapterhouselane.org.au To Oct 27 Sucking Breath, Jolly Lolly by Rafaella McDonald.

74 Melbourne Marco Luccio painting from the Chrysler Building, overlooking Manhattan and the Empire State Building. Photo: Sina Basila

MARCO LUCCIO MANHATTAN DREAMING PAINTINGS & PRINTS OF NEW YORK 25 Sep – 20 Oct 2018

New York Stories - Artist Talk: Sat 6 Oct 11am - 1pm

Free events. Bookings essential as places are limited. Please see full events calendar on website.

Instagram @marcoluccioartist www.marcoluccio.com.au Australian Tapestry Workshop Southbank 262-266 Park Street, South Melbourne 3205. T (03) 9699-7885. E [email protected] W www.austapestry.com.au Gold coin entry to the galleries and workshop. H Tues-Fri 10.00 to 5.00. Sth Melbourne Guided tours Wed 11am and Thurs 2pm, $10 per person: bookings essential. View the weavers and Australian Centre for dyer at work on major contemporary art commissions and artists in residence. Tapestry being woven on the Contemporary Art (ACCA) looms designed by Justin Hill. To Oct 26 Tapestry 111 Sturt Street, Southbank 3006. Design Prize for Architects Finalists Exhibition – an T (03) 9697-9999. W www.acca.melbourne exhibition of the 15 finalists of the Tapestry Design Free admission. H Tues-Fri 10.00 to 5.00, Sat-Sun Prize for Architects 2018. Architects were invited 12.00 to 5.00, Mon by appt. Sept 28 to Nov 25 to respond to the brief written by MONA Founder, Eva Rothschild – the 2018 ACCA International David Walsh, and design a tapestry for Étienne-Louis exhibition presents a survey of works by Irish-born, Boullée’s mooted building that inspired the Pharos London-based artist Eva Rothschild, ahead of her Wing, MONA, Tasmania, Australia. The TDPA 2018 appearance at the 2019 Venice Biennale where is a partnership between the Australian Tapestry she will represent Ireland. Shaped by a myriad of Workshop, the Museum of Old and New Art (MONA) influences from minimal art of the 1960s and 70s and Architecture Media. to classical architecture, spiritualism and pop- culture, Rothschild has an international reputation for sculptural forms that are both striking and spare, as sharp geometric shapes morph into flamboyant, enigmatic compositions. Presented in association with Melbourne Festival, the exhibition brings together three new sculptural commissions created especially for ACCA’s galleries, alongside recent work spanning the last decade of Rothschild’s diverse yet distinctive practice.

Quadrant Gallery www.quadrantgallery.com.au

25th Oct - 17th Nov

72 Barkers Road Hawthorn 3122 www.quadrantgallery.com.au Tues - Sat 10am - 4pm Phone: 03 9079 0943

76 Melbourne Buxton Contemporary Cnr Dodds Street and Southbank Boulevard, Southbank T (03) 9035-3020. E [email protected] W www.buxtoncontemporary.com H Wed-Sun 11.00 to 5.00, Thurs to 8.00. The new purpose-built home for the Michael Buxton Collection of contemporary art. To Oct 21 No One Is Watching You: Ronnie van Hout – this ironically titled exhibition shines a spotlight on Ronnie van Hout, a Melbourne-based New Zealand- born artist best known for his distinctive brand of existential absurdism. Consuelo Cavaniglia, Untitled, 2015, acrylic and screws, Domain House installation view Courtesy the artist and Margaret Lawrence Gallery Dallas Brooks Drive (150m East of the Shrine of Remembrance), Melbourne 3004. T (03) 9650-6398. E [email protected] National Gallery of Victoria W www.rbgfriendsmelbourne.org H Daily 10.00 to NGV International 4.00. Oct 13 to 28 The Art of Botanical Illustration. 180 St Kilda Road, Melbourne 3004. Presented by the Friends of the Royal Botanic T (03) 8620-2222. W www.ngv.vic.gov.au Gardens, Melbourne. All works are for sale. H Daily 10.00 to 5.00. To Oct 7 MoMA at NGV: 130 See ad page 79. Years Of Modern and Contemporary Art. Also, Rirkrit Tiravanija, and New York! New York! For Kids. To Oct The Guild Assembly Point 28 Japonisme: Japan and the Birth of Modern Art. 152 Sturt Street (walkway to Moore Street), To Nov Guerrilla Girls: Portfolio Compleat. Southbank 3006. T 0431-996-609. Also, NGV International: 50th Anniversary. E [email protected] To Jan 27, 2019 A Modern Life: Tablewares W www.instagram.com/nancydeesculptures 1930s-1980s. Sept 28 to March 24, 2019 Hito H 24-hour viewing. Oct 26 to Nov 26 Upcycled from Steyerl: Factory of the Sun. Also, Designing Women. the City Streets – found object assemblage sculptures by Nancy D Lane with Julia Zoellner. Laurent Gallery 115 Thistlethwaite Street, South Melbourne 3205. T 0481-055-558 . E [email protected] W www.laurentgallery.com H By appointment only. Permanent exhibition BLACK IS by Titane Laurent. Lynn Jaanz Art Gallery Level 1, 216 York Street, South Melbourne 3205. T 0450-955-467. W www.yorkstreetartgallery.com Curator: Anne Ioannou. International artist Lynn Jaanz Exhibition image of MoMA at NGV: 130 Years of Modern and and guest artist advertised. Viewing by appt: email Contemporary Art, on display at NGV International [email protected] Photograph: Tom Ross Courtesy the National Gallery of Victoria Margaret Lawrence Gallery 40 Dodds Street, Southbank 3006. William Holt Gallery T (03) 9035-9400. E [email protected] In conjunction with 100th Gallery W www.vca.unimelb.edu.au/mlg H Tues-Sat 12.00 to 200 Normanby Road, Southbank 3006. 5.00. Oct 5 to Nov 3 (opening Thurs Oct 4, 5.30pm) T 0419-206-358. E [email protected] between and among objects by Consuelo Cavaniglia. W www.williamholtart.com H Mon-Fri 7.00 to 4.30, Cavaniglia is an interdisciplinary artist who makes or by appt. Permanent exhibition with regular new sculptural works that are at once both beautiful and works showing 25 large-scale paintings on display – unsettling. Ever mindful of the viewer’s interaction, William Holt. Cavaniglia’s installations have no single focal point. Her finely orchestrated arrangements of free standing screens and wall-based works form a choreographed encounter that encourages the consideration of the ways space is experienced and understood.

Melbourne 77 George Paton Gallery Carlton Second floor, Union House, University of Melbourne 3010. T (03) 8344-5418. E [email protected] W www.union.unimelb.edu.au/georgepaton Nth Melbourne H Mon-Fri 11.00 to 5.00. Oct 3 to 12 Entrance Gallery: Melbourne Lure by Stepanka Cervinkova. Bridget McDonnell Gallery Main Gallery: Grey Voices: Female Identity and Culture – Tahney Fosdike, Yumemi Hiraki, Jacinta Carlton Keefe, Yesol Ma, Leah Jing and Kelly Yoon. Curated 130 Faraday Street, Carlton 3053. by Tahney Fosdike and Kelly Yoon. Closing event: Wed T (03) 9347-1700. E [email protected] Oct 10, 5-7pm. Oct 17 to Nov 2 Everyday Utopia W www.bridgetmcdonnellgallery.com.au H During – Courtney Coombs, Briony Galligan, Dan Mccabe, exhibitions Tues-Fri 10.00 to 5.00, Sat 12.00 to Tita Salina & Irwan Ahmett, Athena Thebus and 5.00, or by appt. James Tylor. Curated by Callum Ross. Closing event: Wed Oct 31, 5-7pm. The Dax Centre Rear of 30 Royal Parade, Parkville 3010. The Ian Potter Museum of Art T (03) 9035-6258. E [email protected] The University of Melbourne, Swanston Street W www.daxcentre.org Entry by donation. (between Elgin and Faraday streets), Parkville 3010. H Wed-Fri 12.00 to 5.00, or by appt. The Dax Centre T (03) 8344-5148. E [email protected] exhibits selections of works from the Cunningham W www.art-museum.unimelb.edu.au Director: Kelly Dax Collection, all of which are created by people Gellatly. Free entry. H Tues-Fri 10.00 to 5.00, Sat-Sun with lived experience of mental illness or 12.00 to 5.00. To Oct 28 State of the Union, and psychological trauma. Eavesdropping. Also, Liquid Form: Ancient and contemporary glass. Gallerysmith 170-174 Abbotsford Street, North Melbourne 3051. T (03) 9329-1860. E [email protected] W www.gallerysmith.com.au H Tues-Sat 11.00 to 5.30. Oct 11 to Nov 10 (opening Sat Oct 13, 2-4pm) Recess by Martin King. Also, Navigate by Tim Allen. Project Space: Confluence by Julia Boros.

Richard Lewer, What is a Scab? A Traitor..., 2011, oil on canvas, 60 x 60cm Courtesy the artist, Hugo Michell Gallery, South Australia, and The Ian Potter Museum of Art Langford 120 120 Langford Street, North Melbourne 3051. T (03) 9328-8658. E [email protected] W www.langford120.com.au Directors: Irene Barberis and Wilma Tabacco. H Thurs-Sun 12.00 to 5.00. To Oct 7 …drifting off the plane by Nobby Seymour. Also, Angels, Ghosts and Demons by Stephen Spurrier. Oct 13 to Nov 11 (opening Sun Oct 14, 2-4pm) Witness Beast by Luciano Prisco, and Between Us 2 by Ede Horton (see ad page 73). Martin King, black thursday diaries I, 2018, etching, watercolour, wax, hard cover book, ribbon, 44 x 27cm Courtesy the artist and Gallerysmith

78 Melbourne

The Larwill Studio 48 Flemington Road, Parkville 3052. T (03) 9032 9111. W www.artserieshotels.com.au/larwill A boutique hotel in Melbourne’s north dedicated to the work of Australian artist David Larwill. RMIT Project Space / Spare Room RMIT Building 94.2, 23 27 Cardigan Street, Carlton 3053. T (03) 9925 4971. E [email protected] W intersect.rmit.edu.au Free entry, wheelchair access. H Wed Fri 10.00 to 5.00, Sat 12.00 to 4.00. Oct 5 to Nov 15 (opening Thurs Oct 4, 5 7pm) Significant Kawita Vatanajyankur, Shuttle, 2018, still from HD single-channel Velocities Jeremy Bakker, Catherine Evans, David video, 3:30 minutes Series commissioned by Dunedin Public Art Gallery, New Zealand Haines & Joyce Hinterding, Jacob Kirkegaard (DNK) © Kawita Vatanajyankur and Nova Contemporary Bangkokm and and Zoe Scoglio. Curated by Andrew Tetzlaff. Alamak! Project! / Clear Edition Gallery, Tokyo, and Alcaston Gallery Steps Gallery Australian Galleries 62 Lygon Street, Carlton South 3053. 35 Derby Street, Collingwood 3066. T (03) 9650 3577. W miesf.com.au/steps gallery T (03) 9417 4303 F 9419 7769. Oct 16 to 21 (opening Tues Oct 16, 6.30pm) E [email protected] Destinations 2018 the Greek Australian Culture W www.australiangalleries.com.au Director: Stuart League (GACL) presents its first multicultural Purves AM. H Daily 10.00 to 6.00. To Oct 14 The exhibition with the theme ‘Destinations’. Narrow Escape by Stu James. Also, Saturated Mon Fri 11.00 to 6.30, Sat Sun 11.00 to 4.00 Solitude by Maryanne Coutts. Oct 23 to Nov 11 www.gacl.com.au [email protected] George Baldessin. Also, Recent Workk by Hertha See ad page 73. Kluge-Pott (see ad page11). Australian Galleries StockRooms Fitzroy 28 Derby Street, Collingwood 3066. T (03) 9417 2422 F 94173433. E [email protected] Collingwood W www.australiangalleries.com.au Director: Stuart Purves AM. H Daily 10.00 to 6.00. To Oct 14 Revisitedd by Herman Hohaus. Oct 23 to Abbotsford Nov11Fletcher Jones Project by Glenn Morgan (see ad page7). Alcaston Gallery Australian Print Workshop 11 Brunswick Street, Fitzroy 3065. 210 Gertrude Street, Fitzroy 3065. T (03) 9418 6444 F 9418 6499. T (03) 9419 5466. E [email protected] E [email protected] W www.australianprintworkshop.com Director: Anne W www.alcastongallery.com.au Director: Beverly Virgo OAM. Free entry. H Tues Sat 10.00 to 5.00. Knight (approved to value Aboriginal paintings, To Nov 10 Birdlife a selection of original fine art ceramics, sculpture, textiles and artefacts for the prints exploring the representation of birds, produced Cultural Gifts Program). H Wed Sat 11.00 to 5.00, by leading contemporary artists incollaboration with or by appt. To Oct 6 Kunkamak Ngarrwoneng – APW Printers. Theexhibition includes works by Bruce Our House of Culture by Bob Burruwal and Lena Armstrong, Merce Cunningham, Kate Hudson, Tim Yarinkura.Also,Arrkutja Tharramala Purtala Etlaraka Jones, Janice Murray, Caroline Rothwell, Mervyn | Minyma Kutjara Kulinytja Katjura | Two women Street and Louise Weaver. Two ways of thinking by Beth Inkamala and Carlene Thompson. Oct 17 to Nov 10 Kawita Vatanajyankur. Nov 21 to Dec 21 Nonggirrnga Marawili.

80 Melbourne 109TH ANNUAL EXHIBITION

CHANGING PERSPECTIVES 2018 5-16 OCTOBER

Opening Sunday 7 October at 2:00pm

T‘„‡‘ˆϔ‹ ‹ƒŽŽ›‘’‡‡†by JocŽ—–terbuck, not‡†ƒ”–‹•–ƒ†Œ—†ge for the A‹‡ƒ˜‹•‘Ž‹˜‡”ƒ†ƒ•T”—•–Awar†•

Victorian Artists Society Galleries, 430 Albert Street, East Melbourne, VIC 3002 Gallery Hours: Mon-Fri 10am-4pm, Sat-Sun 1-4pm (closes 12 noon Tuesday 16th Oct)

MSWPS Melbourne Society of Women Painters & Sculptors www.mswps.com.au

Elegant Afternoon Tea & Guest ArtistTalk Š—”•†ƒ› ͷͷ  t „‡” ͷǣͶͶ’

DEBORAH KLEIN Deborah Klein Queen AŽexandrƒǯ• ‹r†™‹ged Woman. 2015 acrylic on wood, 20 cm x 20 cm Collection: the artist

Deborah Klein was born in Melbourne, Australia. Since 1987 she has held regular solo exhibitions and participated in numerous group exhibitionsin Australiaand internationall Although Klein’s reputation was initially founded on her relieffpr ints, her practice has expanded to encompass painting, drawing, artist’s books and digital prints.Her work has received numerous awards and is represented in public and university collections throughout Australia.

Thursday 11 October 1:00pm Admission: Non-members $25, Members $20 Please join us upstairs in the Hammond Gallery Bookings: Linda 03 9807 3187 BlackCat Gallery Fox Galleries 95 Johnston Street, Collingwood 3066. 79 Langridge Street, Collingwood 3066. T (03) 9913-5833 , 0413-584-829. T (03) 8560-5487. E [email protected] E [email protected] W www.foxgalleries.com.au H Tues-Sat 10.00 to W www.blackcatgallery.com.au H Wed-Sun 12.00 6.00. To Oct 13 An Internal Dialogue by Victor to 5.00. Oct 10 to 21 (opening Fri Oct 12, 6-8pm) Rubin. Also, Toni Warburton presents an online Jenny Hall, Brodie Colbourne and Chantelle Ferri. exhibition. Oct 18 to Nov 17 The Life Exotic by Oct 24 to Nov 4 (opening Fri Oct 26, 6-8pm) Maz Dixon. Also, Amanda Robins presents an Charlie Brophy, Kasarin & Krongkwan and online exhibition. Headache_Stencil. Brunswick Street Gallery Level 1, 322 Brunswick Street, Fitzroy 3065. T (03) 8596-0173. E [email protected] W www.brunswickstreetgallery.com.au H Tues-Fri 10.00 to 6.00. Cambridge Studio Gallery 52 Cambridge Street, Collingwood 3066. T (03) 9486-0169, 0413-537-532. E [email protected] W www.cambridgestudiogallery.com.au H Wed-Sun 12.00 to 5.00. To Oct 14 Internal/External by Gennet Makonnen – a series of oils from Makonnen’s private and public scenes. Working ‘en plein air’ Gennet focuses on the effects of Melbourne light. Featured artist: Jennifer Gough. Oct 17 to Nov 4 Each Thing has its Time /Chaque chose a son temps by Carolyn Roberts – visual narratives of time and place. Featured artist: Alison Russell. Maz Dixon, Paragon #1, 2018, oil and graphite on board, 50 x 45cm Courtesy the artist and Fox Galleries Chapman & Bailey Gallery in.cube8r gallery & emporium 350 Johnston Street, Abbotsford 3067. T (03) 9415-8666 F (03) 9415-8811. 321 Smith Street, Fitzroy 3065. T 0414-736-659. E [email protected] W incube8r.com.au H Mon-Wed 11.00 to 5.00, W www.chapmanbailey.com.au H Mon-Fri 10.00 to Thurs-Sat 11.00 to 6.00, Sun 12.00 to 4.00, closed 5.00, Sat 10.30 to 4.00. public hols. Oct 4 to 17 (opening Sat Oct 6, 6-8pm) Abstract – artworks from 10 Melbourne-based artists. Oct 18 to 31 (opening Thurs Oct 18, 6pm) Occult Collingwood Gallery – a collection of works which are esoteric, mystical, 292 Smith Street, Collingwood 3066. sensory and a little magical. T 0411-650-399. E [email protected] Modern Times W www.collingwoodgallery.com.au To Oct 4 Dirty Smokers by Dan O’Donovan. Oct 5 to 18 Synergy 311 Smith Street, Fitzroy 3065. T (03) 9913-8598. (the whole is greater than the sum of its parts) by E [email protected] Gillian Wright and Vanessa Welham. A melding of W www.moderntimes.com.au H Mon-Fri 10.00 to mediums expressing passionate energy, richness of 6.00, Sat 10.00 to 5.00, Sun 11.00 to 5.00. Sept life, colour, movement and deep connections. Oct 27 to Oct 7 Outdistance by Derek Swalwell. Oct 18 19 to Nov 1 (opening Sat Oct 20, 4-6pm) The 69 to 28 Verdant Ground by Ellie Malin. Collective. The horizontal line. It is envisaged that the line in each work, either inferred or explicit, will Nicholas Thompson Gallery gather this group exhibition as a whole. 155 Langridge Street, Collingwood 3066. T (03) 9415-7882. W www.nicholasthompsongallery.com.au H Wed-Sun, 11.00 to 6.00. To Oct 14 Logic by Genevieve Felix Reynolds. Oct 17 to Nov 4 Su Baker.

82 Melbourne Port Jackson Press Print Gallery THIS IS NO FANTASY 67 Cambridge Street, Collingwood 3066. + dianne tanzer + nicola stein T (03) 9419-8988. E [email protected] 108-110 Gertrude Street, Fitzroy 3065. W www.portjacksonpress.com.au H Wed-Sat 11.00 T (03) 9417-7172. E [email protected] to 5.00. Publishers and dealers in limited-edition fine- W www.thisisnofantasy.com H Tues-Fri 10.00 to art prints. Established 1975. 5.00, Sat 12.00 to 5.00, or by appt. Oct 3 to 30 Still Life Studio by Petrina Hicks. red gallery contemporary art space 157 St Georges Road, North Fitzroy 3068. T (03) 9482-3550. E [email protected] W www.redgallery.com.au H Thurs-Fri 11.00 to 6.00, Sat-Sun 12.00 to 5.00. To Oct 14 G1: Luminosity, Satin & Paper by Ri Ying Cai. G2: Archaeology of Practice 2 by Winsome Spiller. G3: New Works by Phil Sayers. Oct 17 to Nov 4 G1: No Place by Alan McGregor. G2: Curves Ahead by David Turner. G3: Polly Hollyoak and Nanou Dupois. Tacit Galleries 123a Gipps Street (cnr Gipps and Islington streets), Collingwood 3066. T 0423-323-188. E [email protected] W www.tacitart.com.au H Wed-Sun 11.00 to 5.00. To Oct 7 Brenda Walsh, Peter Ward, John Rabling and Katherine Westfold. To Oct 21 Linda Pickering, Myunghee Kim, Irene Wellm, Peter Summers, Mel Kerr, Eugene Von Petrina Hicks, Bruised Peaches, 2018, pigment print, edition of 8 + 2AP, 100 x 100cm Nagy and Ruth McIntosh. Oct 10 to Nov 4 (opening Courtesy the artist and THIS IS NO FANTASY + dianne tanzer + Wed Oct 10, 6.30-8pm) KAAM (Korean Artists, nicola stein Association, Melbourne), Susan Stevenson, Helen Oliver-Skuse, Lisa O’Keefe and Linda Weil. Oct 24 to Nov 18 (opening Wed Oct 24, 6.30-8pm) Meagan Victorian Artists’ Society Shelton, Helen McInnis, Helen Anderson, Dinusha 430 Albert Street, East Melbourne 3002. Joseph, Milos Pelikan and Leah Mariani. T (03) 9662-1484. See ads pages 84 and 85. E [email protected] W victorianartistssociety.com.au/exhibitions H Mon to Fri 10.00 to 4.00, Sat-Sun 1.00 to 4.00 (closes 12pm Tues Oct 16). Oct 5 to 16 (opening Sun Oct 7, 2pm) Changing Perspectives 2018 the 109th annual exhibition – Melbourne Society of Women Painters & Sculptors. Afternoon tea and guest artist talk with Deborah Klein: Thurs Oct 11, 1pm upstairs in the Hammond Gallery. Non-members $25, Members $20. www.mswps.com.au See ad page 81.

MARISA AVANO FROM THE GROUND UP

6 – 9 October 2018 11am – 4pm

MAS Gallery 1297 High Street, Malvern Victoria www.marisaavano.com

Melbourne 83

Brunswick Northcote Counihan Gallery In Brunswick 233 Sydney Road, Brunswick 3056. T (03) 9389- 8622. E [email protected] W www.moreland.vic.gov.au/counihan-gallery Free entry. H Gallery: Wed-Sat 11.00 to 5.00, Sun Kristin Headlam, Milena with fox and hedgehog, 2017, hand- 1.00 to 5.00. Office: Wed-Sat 11.00 to 5.00. Oct 12 coloured etching on Hahnmuhle paper, 38 x 56cm to Nov 11 (opening Thurs Oct 11, 6-8pm) Gallery © the artist one: Medium Density by Jessica Scott and Zoe Courtesy the artist and Charles Nodrum Gallery Diacolabrianos. Gallery two: True Estate, curated by Elvis Richardson. For free public programs please see Contemporary Art Society our website. of Victoria Inc. Islamic Museum of Australia CAS Inc. PO Box 283, Richmond 3121. T (03) 9428-0568, 0407-059-194. 15A Anderson Road, Thornbury 3071. E [email protected] T 1300-915-171. W islamicmuseum.org.au W www.contemporaryartsociety.org.au A non-profit H Tues-Sat 10.00 to 4.00. art society run by artists, for artists, established 1938. At Decoy Café & Gallery (map ref 12E), Tinning Street Presents 303 Exhibition Street, Melbourne: To Oct 18 Lot 5/29 Tinning Street, Brunswick 3056. Contemporary Showcase 23. Oct 22 to Jan 17, E [email protected] 2019 Blessings paintings by Cheryle Bannon. W tinningstreetpresents.com H Thurs-Sun 11.00 to 5.00. To Oct 7 Drawn In by Chris Humphries. Oct 11 Niagara Galleries to 21 Halo by Lily Holmes. Oct 25 to Nov 11 Tangled 245 Punt Road, Richmond 3121. T (03) 9429-3666. Love by Tom Civil. E [email protected] W www.niagaragalleries.com.au Director: William Nuttall (member of ACGA). H Tues-Fri 11.00 to 6.00, Sat 12.00 to 5.00 or by appt. To Oct 20 Richmond Ken Whisson. Also showing in our stockroom: Rick Amor, Glenn Barkley, Terry Batt, Stephen Benwell, Tony Bevan (UK), Angela Brennan, Robert Charles Nodrum Gallery Bridgewater, Paul Boston, Gunter Christmann, 267 Church Street, Richmond 3121. T (03) 9427- Julie Ciccarone, Brenda L. Croft, Harry Dixon 0140. E [email protected] Mptyane, Julie Dowling, Fiona Foley, Star Gossage W www.charlesnodrumgallery.com.au (NZ), Michelle Grabner (US), Malaluba Gumana, Director: Charles Nodrum (member of ACGA). Rubaba Haider, Euan Heng, Dale Hickey, Dianne H Tues-Sat 11.00 to 6.00. To Oct 13 ABSTRACTION Jones, Jennifer Joseph, David Keeling, Yvonne 18: Further a-Field, 1970s – a group exhibition. Kendall, Richard Larter, Kevin Lincoln, Song Ling Oct 20 to Nov 10 Kristin Headlam: The Universe (CN) Travis MacDonald, Euan Macleod, Helen Looks Down – a suite of 64 etchings commissioned Maudsley, Noel McKenna, Sean Meilak, Samuel by the University of Melbourne’s Rare Books Namunjdja, Lena Nyadbi, Martin Parr (UK), Angelina Collection, to accompany Chris Wallace-Crabbe’s Pwerle, HU Qinwu (CN), Steven Rendall, Andreas epic poem of the same title. Also showing at the Noel Ruthi (CH), Jan Senbergs, Neil Taylor, Savanhdary Shaw Gallery, Level 1, Baillieu Library, University of Vongpoothorn, Wukun Wanambi, Wolpa Wanambi, Melbourne, until Feb 17, 2019. Bradd Westmoreland, Helen Wright and Liu Zhuoquan (CN).

86 Melbourne Women’s Art Register 1975-2015 Richmond Library, 415 Church Street, Richmond 3121. E [email protected] W www.womensartregister.org Member organisation with information on 5,000+ women artists. Supported by the City of Yarra. Yarra Sculpture Gallery Contemporary Sculptors Association 117 Vere Street, Abbotsford 3067. T (03) 9419-6177. E [email protected] W yarrasculpturegallery.com.au H Thurs-Sun 11.00 Ken Whisson, Saturday, 26/1/18 & 4/2/18, oil on linen canvas, to 4.00. Oct 6 to 28 (opening Sun Oct 7, 2-4pm) 100 x 120cm Courtesy the artist and Niagara Galleries BONANZA the annual sculpture exhibition by members of the Contemporary Sculptors Association William Mora Galleries of Victoria. See ad page 87. 60 Tanner Street, Richmond 3121. T (03) 9429-1199. E [email protected] W www.moragalleries.com.au Director: William Mora. H Wed-Fri 10.00 to 4.00, or by appt.

BONANZA

BONANZA is the yearly extravaganza exhibition of the outstanding sculpture and spatial practice works from the members of the Contemporary Sculptors Association of Victoria.

6 – 28 October 2018 Opening Sunday 7 October 2-4 pm

. Photo: Dom Krupinski. YARRA SCULPTURE GALLERY 117 Vere Street, Abbotsford VIC 3067 (03) 9419 6177 Thursday - Sunday 11am to 4pm Falling Away Amanda Page,

Melbourne 87 The Olsen Toorak 637-641 Chapel Street, South Yarra 3141. T (03) 9040-1222. W www.artserieshotels.com.au/olsen The Olsen is an elegant hotel with suites featuring lyrical works of Sth Yarra Australian landscape artist John Olsen. STATION Prahran 9 Ellis Street, South Yarra 3141. T (03) 9826-2470. E [email protected] Alternating Current Art Space W www.stationgallery.com.au H Tues-Fri 11.00 to (map ref Melway 2L, K12) 248 High Street, Windsor 5.00, Sat 11.00 to 4.00. To Oct 13 People are bad 3181. T (03) 9528-2459. (for the economy) by Sven T’Jolle, and Things by E [email protected] Patrick Pound. W www.alternatingcurrentartspace.com H Thurs-Fri 12.00 to 7.00, Sat-Sun 12.00 to 5.00. Studio B Gallery Sept 27 to Oct 20 Gallery 1: Cut/Copy by Gregory 509 High Street, Prahran 3181. T (03) 9510-1607. Carosi. Gallery 2: Karinthy’s Conversation by Rose W www.studiobgallery.com.au Director: Tamsin Buic. Osborne. Gallery 3: Shapescape by Katrina Tyler. H Wed-Sun 11.00 to 5.00. Oct 3 to 14 Kagetsu Gallery 4: Something For...For Something? by Chen Buic’s second solo exhibition will showcase photos Hsu. The Cupboard: Clouds are not our bodies by from pole to pole, with images from Iceland to Hannah Beilharz. Antarctica, and for the first time, the photographs taken on his most recent expedition to the world’s highest desert – The Atacama. Nov 7 to 18 Nunzio Miano explores the traditional idea of tribes and the common elements of identity and unity. The collection features pieces in bold expressive colours contrasted with dark melancholy works. He is constantly in pursuit of his own identity within the tribe, and the context around him.

Gregory Carosi, Untitled, 2014, oil on board, 30 x 30cm Courtesy the artist and Alternating Current Art Space The Cullen 164 Commercial Road, Prahran 3181. T (03) 9098-1555. W www.artserieshotels.com.au/ cullen A boutique hotel featuring original artwork and prints by Australian contemporary artist Adam Cullen. Justin Art House Museum E [email protected] W www.jahm.com.au Bookings for guided tours of the exhibition and private collection of Charles and Leah Justin only by registration via the JAHM website. To Dec 2 A Body of Work – Photography of Adrian Boddy. Linden New Art Visit Linden New Art, back home in St Kilda, 26 Nunzio Miano, Bedda Siciliana (Beautiful Sicilian woman), 2018, Acland Street, St Kilda 3182. T (03) 9534-0099. acrylic on canvas, 60 x 50cm E [email protected] W www.lindenarts.org Courtesy the artist and Studio B Gallery Director: Melinda Martin. H Tue-Fri 10.00 to 3.00, Sat-Sun 10.00 to 4.00, closed public hols. To Nov 4 Wholeness and the Implicit Order by Julia deVille. Also, Imaging the Dead by Natalie Ryan.

88 Melbourne Melbourne 89 Toorak Village Art Walk The Gallery at Bayside Arts Toorak Road, Toorak 3142. W www.toorakvillage. & Cultural Centre com.au H Director: Tony Fialides 0419-005-052. (map ref Melway 67 F10) cnr Wilson and Carpenter Oct 15 to Nov 11 Original works of art displayed in streets, Brighton 3186. T (03) 9261-7111. shop windows of Toorak Village. All art is for sale. E [email protected] See ad page 95. W bayside.vic.gov.au/gallery www.facebook.com/thegalleryatbacc Free entry. H Wed-Fri 11.00 to 5.00, Sat-Sun 1.00 to 5.00. Closed public hols. To Nov 11 Rob McHaffie: This is living – a survey of the last five years of McHaffie’s practice. This period corresponds with McHaffie’s St Kilda return to the beachside suburb of Brighton, which offers a fertile ground for his witty and astute observations of the people and events that make Elwood up his world. Brighton Brightspace 8 Martin Street, St Kilda 3182. T (03) 9593-9366. W www.brightspace.com.au H Wed-Fri 11.00 to 5.00, Sat-Sun 12.00 to 4.00. Oct 4 to 7 Pasquale Giardino: New Paintings. Oct 10 to 14 St Michael’s Grammar Year 12 Show. Oct 19 to 21 Artists for Kids’ Culture exhibition. Auction: Thurs Oct 25, 8pm at The Park Melbourne, 36 Lakeside Drive, Albert Park (see ad page 99). Carlisle Street Arts Space 99a Carlisle Street, St Kilda 3182. T (03) 9209-6777. E [email protected] W www.portphillip.vic.gov.au/carlisle-st-arts-space.htm Free entry. H Mon-Fri 8.30 to 5.00, Thurs 8.30 to 7.00 (during exhibitions). To Oct 17 Private Archaeology by Deborah Walker and Richard Stringer – symbols and timepieces that form a navigational landscape for the viewer. Oct 24 to Nov 21 Vortex of Time sculptural works of contrasting textures by Salvatori Lolicato. Also, Diwan by James Cattell – Rob McHaffie, Study commerce and work part-time at Country works inspired by childhood and the artist’s travels. Road, 2015, oil on linen, 56 x 41cm Monash University Collection. Purchased by the Faculty of Science Courtesy the artist Monash University Museum of Art, Melbourne and The Gallery at Bayside Arts & Cultural Centre

Artist moving Artists - Art Courier

Affordable Prices • Melbourne and Regional Victoria Call Drasko 0437 214 402 • [email protected] www.artistmovingartists.com.au

90 Melbourne SUZY FRENCH 10 - 20 OCTOBER FOR THE LOVE OF COUNTRY Join us for Drinks Oils on Aluminium Saturday 13 October from 2 pm

www.hawthornstudiogallery.com.au 635 Burwood Rd, Hawthorn East. Vic. 3123 Tuesday - Saturday 11am - 4.30 pm (5 doors from Auburn Rd) P: 03 9882 5553

Presenting the work of realist artist Brett Jarrett, the Bay of Whales Gallery is an exceptional venue in its setting and world-class artwork. With commanding views of the Southwest coast, the Gallery showcases some of the finest natural history paintings in Australia. Brett’s works are based on nearly three decades of extensive field work dedicated to pursuing animals from the many remote regions of the world, creating a physical and emotional window into his world of art and nature. He is the 2017 winner of the Holmes Art Prize for excellence in bird art; exhibited with the prestigious Society of Animal Artists in the U.S.A. on its national tour and produced several groundbreaking books on marine mammals. Bay of Whales Gallery and Coffee Shop 47 Liebelts Road, Narrawong Victoria 3285 Gallery: Open Wed to Sun 10am - 4pm Coffee Shop: Open Sat and Sun 10am - 4pm T: 0415 464 572 E: [email protected] W: www.brettjarrettwildlifeart.com

Image: Mother and Son, Australian Kelpies, 2018 oil on canvas, 50 x 39 cm

Melbourne 91 Vivien Anderson Gallery Firestation Print Studio Gallery Ground Floor, 284-290 St Kilda Road, St Kilda 3182. (map ref Melway 59 A8) 2 Willis Street, Armadale T (03) 8598 9657. E [email protected] 3143. T (03) 9509-1782. E [email protected] W www.vivienandersongallery.com H Tue-Fri 11.00 to W www.fps.org.au H Wed-Sat 11.00 to 5.00. 5.00, Sat 12.00 to 4.00. Representing and exhibiting To Oct 31 Firestation Print Studio Gallery, is the Australian Indigenous artists for over 30 years. Oct selected Victorian gallery to host the Print Council 3 to 27 First Lady bark paintings by Dhuwarrwarr Australia Print Commissions Exhibition. Oct 17 to Marika, in association with Buku-Larrnggay Nov 3 (opening and announcements Thurs Oct 18, Mulka Centre, NT. Also, New Paintings by Hubert 6-8pm) Australian Monoprint Prize 2018. Judges Pareroultja and Kathy Inkamala, in association with Panel: Marian Crawford and Jazmina Cininas. Nov 7 Iltja Ntjarra Many Hands Art Centre, NT. to 24 Hard Pressed Three – Ilona Lasmanis, Robyn McAdam and Steve Tomlin. Armadale Malvern Artbank Melbourne 18-24 Down Street, Collingwood 3066. T 1800-251-651. E [email protected] W www.artbank.gov.au H Mon-Fri by appt. A Commonwealth Government art leasing program for contemporary art. Supporting Australian artists. Duldig Studio Museum + Sculpture Garden 92 Burke Road, East Malvern 3145. T (03) 9885-3358. E [email protected] W www.duldig.org.au H Tues, Thurs and second Sat of every month 1.00 to 3.00, or groups by appt. Through Oct SLAWA: modernist art and design – a Viennese modernist in Melbourne.

Ruth Thompson, Night Song, 2018, rust print on Japanese washi, and rolled ink and silver leaf on Somerset Velvet Black, 56 x 38cm Courtesy the artist and Firestation Print Studio Gallery

GIANNA ROSICA ACCOUNTING FOR THE ARTS

Tax and Business Advice

16 Hill Street, Cremorne 3121 (03) 9428 3855 www.giannarosica.com.au

92 Melbourne Bigmouth, Oil on Canvas, 80x80cm Manyung Gallery Malvern Ten Cubed 6-10 Claremont Avenue, Malvern 3144. 1489 Malvern Road, Glen Iris 3146. T (03) 9787-2953. W www.manyunggallery.com.au T (03) 9822-0833. E [email protected] H Tues-Sat 10.00 to 5.00. W www.tencubed.com.au H Tues-Sat 10.00 to Oct 11 to 27 Ember Fairbairn & Sussanne Morton. 4.00. A private collection of contemporary art, open to the general public. To Dec 1 Brook Andrew – Ten Cubed is excited to announce its final exhibition for 2018 will be artist Brook Andrew who was included in the Ten Cubed 2 Collection this year. Andrew is an interdisciplinary artist who examines dominant narratives, often relating to colonial and modernist legacies. Through museum and archival interventions, he aims to make forgotten stories visible and offer alternative narratives for interpreting history in the world today. This exhibition will feature works acquired by the collection including ‘Systems I’ and ‘Systems II’ – the first acquisition made at Spring1883 in 2016. Brook Andrew is represented by Tolarno Galleries, Melbourne; Roslyn Oxley9 Gallery, Sydney; and Galerie Nathalie Obadia, Paris and Brussels. Sussanne Morton, Spring Tulip, 2018, oil on linen, 120 x 152cm Courtesy the artist and Manyung Gallery MAS Gallery 1297-1299 High Street, Malvern 3144. T (03) 9822-7813. E [email protected] W malvernartists.org.au H Daily 11.00 to 4.00 during exhibitions. Oct 6 to 9 From the Ground Up by Marisa Avano www.marisaavano.com See ad page 83. Scott Livesey Galleries 909a High Street, Armadale 3143. T (03) 9824-7770. E [email protected] W www.scottliveseygalleries.com H Tues-Fri 11.00 to 5.30, Sat 11.00 to 4.00. Oct 10 to Nov 3 Reverence – Pastures to the Wild by Jennifer Riddle. Also, New Works by Aaron Kinnane.

Brook Andrew, Systems I, 2016, mixed media, 240 x 165cm Courtesy the artist, Tolarno Galleries, Melbourne, and Ten Cubed

Aaron Kinnane, Alluvium, 2018, 100 x 88cm Courtesy the artist and Scott Livesey Galleries

94 Melbourne Original works of art displayedinshop windows of Toorak Village. w Director: Tony Fialides 0419 005 052 Zelman Le

www.toorakvillage.com.au

Melbourne 95 Hawthorn Studio & Gallery Hawthorn 635 Burwood Road, Hawthorn East 3123. T (03) 9882-5553. E [email protected] East & West Art W www.hawthornstudiogallery.com.au 665 High Street, East Kew 3102. T (03) 9859 6277. H Tues-Sat 11.00 to 4.30. To Oct 6 Studio Clearance E [email protected] Of Ceramics and Sculptures by Graeme Foote and W www.eastwestart.com.au Director: Marjorie Ho. R.L. Foote Design Studio. Oct 10 to 20 (opening H Mon Fri 11.00 to 5.30, Sat 11.00 to 4.30. Sat Oct 13, 2pm) For The Love Of Country by Suzy Specialists in Asian Fine Arts and Antiques. French – stunning paintings of the remote Kimberley To Oct 27 Chinese and Japanese Woodblock prints region by Broome-based artist Suzy French. French Traditional and Contemporary. will be in attendance each day of the exhibition. Oct 24 to Nov 11 (opening Thurs Oct 25, 6.30-8.30pm) Eastgate Gallery Layers by Annette Saker. Saker has been a successful textile artist for many years, using fabrics in dramatic Dealers in Fine Art and sculptural ways. Saker has loved the opportunity 158 Burwood Road, Hawthorn 3122. of using diverse mediums with fabric, which has lead T (03) 9818 1656. E [email protected] to her more recent paintings on canvas. W www.eastgatejarman.com.au H Mon Fri 9.00 to 5.00, Sat 10.00 to 4.00. A Selection of traditional, Quadrant Gallery abstract, and contemporary art from leading Australian artists past and present. (map ref Melway 45 A8) 72 Barkers Road, Hawthorn Oct 13 to Nov 10 The Sea in Winter by Ian Parry. 3122. T (03) 9079-0943. E [email protected] W www.quadrantgallery.com.au H Tues-Sat 10.00 to 4.00. Oct 25 to Nov 17 Out of the Darkness by Graeme Myrteza – Myrteza’s works of vast and stunning landscapes express the drama and detail of the land. The works explore the quality and effects of light and shadow, depicting many of the places that he visited on his travels around Australia in 2017. This is as much a personal journey as well as an exploration of some of the beautiful and dramatic parts of Australia. See ad page 76. Town Hall Gallery 360 Burwood Road, Hawthorn 3122. T (03) 9278- 4626. E [email protected] W boroondara.vic.gov.au/arts H Tues-Fri 10.00 to 5.00, Sat-Sun 11.00 to 4.00, closed Mon and public hols. To Oct 21 Main Galleries: This Wild Song – a series of portraits of significant Australian female artists by Ilona Nelson. Featuring 26 portraits Ian Parry, Recherche Bay – Winter, oil on linen, 30 x 30cm Courtesy the artist and Eastgate Gallery from the series alongside an artwork by each artist pictured, this exhibition celebrates strong female leaders in the arts community and their

Moving Art, quickly & safely.

• Regional and interstate transport • Weekend bookings ART HUNTER • Short notice trips • Art Installation

0404 434 008 • arthunter.com.au • [email protected]

96 Melbourne creative vision. Community Project Wall: Taxonomy Lauraine Diggins Fine Art of Precious Plants by Kerri Wilson McConchie. 5 Malakoff Street, North Caulfield 3161. Researching and locating 19 plants that are T (03) 9509-9855. E [email protected] indigenous to the Boroondara area, McConchie uses W www.diggins.com.au H Tues-Fri 10.00 to 6.00, the plants as tools to draw and paint an abstract Sat 1.00 to 5.00, or by appt. Specialists in Australian taxonomy of the flora of Boroondara. The outcome colonial, impressionist, modern, contemporary and is a series of delicate ink drawings indicative of each Indigenous painting, sculpture and decorative art. species of plant, as well as an attempt to capture Sourcing European masterworks on request. Through their unique traits and essence. Oct 23 to Nov 18 Oct Aspects of Australian Modernism featuring works Community Project Wall: Fragments by Catherine by George Baldessin & Brett Whiteley, Blackman, Westerman – Westerman set herself strict parameters Boyd, Crooke, Davidson, Dobell, Drysdale, Friend, to create her artwork, working exclusively with found Gleeson, Nolan, Olsen, Onus, Tucker, Wakelin, materials and on a small scale. After creating over Williams and Vassilieff. 40 collages in the same format, she gradually added variations to the formula and the result is a series of process-driven collages, where the method is as important as the end result. Oct 27 to Dec 16 Main Galleries: Louise Saxton: The Linen Project –an immersive installation that pays homage to past lives and past labour, featuring unique two and three- dimensional assemblages created by Louise Saxton from discarded and disinherited domestic linens, which the artist has collected over several decades.

Ilona Nelson, Indigo O’Rourke (detail), 2018, inkjet print on Canson George Baldessin (1939-1978), Deux Personages, 1976, charcoal, Platine paper mounted on Dibond, 100 x 140cm conte, wash and synthetic polymer on paper, 73 x 60cm © the artist Courtesy Lauraine Diggins Fine Art Courtesy the artist and Town Hall Gallery MADA Gallery Monash University, ƒ—Žϐ‹‡Ž†ƒ’—• ƒ—Žϐ‹‡Ž† Building D, Ground Floor, 900 Dandenong Road, Caulfield East 3145. E [email protected] W www.artdes.monash.edu/gallery Free entry. Elsternwick H Wed-Fri 10.00 to 5.00, Sat 12.00 to 5.00 during exhibitions. Oct 6 to 27 In Prato – presents work Glen Eira City Council Gallery made by five practitioners – Stuart Ringholt, Laresa Kosloff, Pat Foster & Jen Berean and David Rosetzky, Cnr Glen Eira and Hawthorn roads, Caulfield 3162. who have all undertaken a three-month residency at T (03) 9524-3402. W www.gleneira.vic.gov.au the Monash University Prato Centre in Italy. Curator: Diane Soumilas. Free admission. H Mon-Fri 10.00 to 5.00, Sat-Sun 1.00 to 5.00, closed public hols. Oct 11 to 21, 2018 Youth Art Exhibition Monash University presented by Glen Eira City Council Youth Services. Museum of Art | MUMA Oct 25 to Nov 17 Be Persuaded-Jane Austen Ground Floor, Building F, Monash University, Caulfield presented by Dressing Australia-Museum of Costume. Campus, 900 Dandenong Road, Caulfield East 3145. Gallery annexe: The Art of Diversity – McKinnon T (03) 9905-4217. E [email protected] Secondary College. W www.monash.edu.au/muma Free admission. H Tues-Fri 10.00 to 5.00, Sat 12.00 to 5.00. Oct 6 to Dec 15 Exoplanets by Alicia Frankovich.

Melbourne 97 Melbourne Studio of Art Box Hill Community Arts Centre 544 Glen Huntly Road, Elsternwick 3185. 470 Station Street, Box Hill 3128. T (03) 9895-8888. T (03) 9528-3392. E [email protected] E [email protected] W bhcac.com.au W studyart.com.au Oct 5 to Nov 3 Cosmos by Troy H Mon-Thurs 9.00 to 7.30, Fri 9.00 to 5.00. Argyros. See ad page 89. Oct 8 to 14 Needlework Tapestry Guild – Nimble Needles. Oct 16 to 28 (opening Thurs Oct 18, 6-8pm) Life: Up Close and In Focus by Meaghan Lyon. Oct 30 to Nov 4 Clayworkers – Fired Up! Moorabbin Bundoora Homestead Art Centre Highett 7 Prospect Hill Drive, Bundoora 3083. T (03) 9496- 1060. E [email protected] W www.bundoorahomestead.com Free admission. Bayside Sculpture H Thurs-Sun 10.00 to 5.00. To Nov 11 Meaning and 16B Advantage Road, Highett 3190. T (03) 9553- Connection by Jessie Willow Tucker, Holding On by 0661. E [email protected] Angela Tiatia, and All Our Secrets Are the Same by W www.baysidesculpture.com.au H Daily 11.00 to Charlotte Watson. Also, I, of the Needle by Betty 5.00. Term 4: eight-week sculpture classes beginning Musgrove, Process Blue, Nature Trips, Corduroy, Oct 15, 16 and 17. Pine Shelving by Rozalind Drummond, and The Family Mantle – Sofi Basseghi, Katayoun Javan, March Space Janelle Low, Morganna Magee, Andy Mullens, Talia Smith and Pia Johnson. Curated by Pia Johnson. 5 Waltham Street, Sandringham 3191. To Jan 20, 2019 The Story of Bundoora Homestead. T 0413-685-488. E [email protected] Director: Gang Liu. H Tues-Sun 10.00 to 5.00. Facebook: @marchspacegallery To Oct 20 Blank Burrinja Gallery Image by Lei Zheng. (map ref Melway 75 B12) Burrinja Cultural Centre, 351 Glenfern Road, Upwey 3158. T (03) 9754-8723. E [email protected] W www.burrinja.org.au H Tues-Sun 10.00 to 4.00. Greater Deakin University Art Gallery at Melbourne Melbourne’s Burwood Campus 221 Burwood Hwy, Burwood 3125. T (03) 9244-5344. E [email protected] Art at Linden Gate W deakin.edu.au/art-collection/ Free admission. 899 Healesville-Yarra Glen Road, Yarra Glen 3775. H Tues-Fri 10.00 to 4.00 during exhibitions, T (03) 9730-1861. E [email protected] closed public hols. To Oct 19 Contemporary Small W www.artatlindengategallery.com.au H Fri-Mon Sculpture Award. In its tenth year, this annual 10.00 to 5.00 (including public hols, except Dec 24 acquisitive award and exhibition is organised by the and 25). Oct 12 to Nov 19 Steels Creek Art Group: Art Collection and Galleries Unit at Deakin University. Celebrating 25 Years. This exhibition of finalists’ work provides a fascinating snap shot of contemporary sculpture. Belgrave Creative Space 1658a Burwood Highway, Belgrave 3160. T 0425-831-425. W www.belgravecreativespace.com Oct 12 to 17 (opening Sat Oct 13, 5-11pm) Solipsism TV World by Jordan Sibley – a large-scale art installation creating an interactive and accessible Solipsism TV World theme park. Opening hours Fri Oct 12, 1-11pm and Sun Oct 14 to Wed Oct 17, 2-10pm. Bolin Bolin Gallery at Bulleen Art & Garden 6 Manningham Road West, Bulleen 3105. Deakin University Contemporary Small Sculpture Award 2017 T (03) 8850-3030. W www.gallery.baag.com.au Photograph: Simon Peter Fox H Daily 9.00 to 5.00. To Oct 21 Whimsical Courtesy Deakin University Art Gallery Fantasies sculpture by Melissa Thomas. Oct 26 to Nov 18 Monkey Tail Collection sculpture and drawings by Darren Gilbert.

98 Melbourne AKCKC nts our 25th Anniversary Art Auct n. 60 works roominent i Australian artistsill o under the hamme mer.r Fu Fundsnds raised give children experiencing hardship the opportunity to participate in cultural, artistic, musical, sporting and educational activities.

AUCTION NIGHT 7PM - Registration & drinks EXHIBITION 8PM - Auction THURSDAY 25TH OCTOBER MC - Brian Nankervis BRIGHTSPACE Friday 19–Sunday 21 AUCTIONEER - Scott Livesey October, 2018 THE PARK MELBOURNE Special Music Guests & DJ 8 Martin St, St Kilda 36 LAKESIDE DRIVE, EVENT TICKETS ALBERT PARK $65 & $185 VIP GALLERY HOURS: Drinks & canapés included 11AM–5PM in ticket price. Deakin University Burwood Gate 6 Gallery Library Gallery Space Gate 6, Cardinia Street, Berwick 3806. Foyer Building V, 221 Burwood Hwy, Burwood 3125. W secan.com.au Free entry. H Sat-Sun 11.00 to E [email protected] 5.00. Oct 7 to 28 (opening Sat Oct 6, 4-5.30pm) W deakin.edu.au/art-collection/ Free admission. Imagine paintings by Katie Rowe and Elaine Kimber. H Daily 8.30 to 8.00. To Oct 19 Portraits From The Collection. A portrait is a work of art that traditionally Gee Lee-Wik Doleen Gallery focuses on the face of a person, allowing the artist to at Hume Global Learning Centre reveal their own insight into the subject depicted. In many ways, a portrait can be like a mirror, in that it Craigieburn reflects as much about the artist as it does about the (map ref Melway 386E-F7) 75-95 Central Park subject. The sitter, the artist and the rapport between Avenue, Craigieburn 3064. T (03) 9356-6117. the two, as well as the setting, the costumes and E [email protected] the choice of materials, all contribute to capturing W www.hume.vic.gov.au/gallery H (refer to website). a precise expression that will remain preserved for To Oct 14 Our World a group exhibition by Sunbury eternity. This exhibition presents traditional and Art Society. Oct 18 to Dec 30 Tree Project by contemporary approaches to portraiture in a diverse Heather Hesterman. range of mediums and formats. All works are from the Deakin University Art Collection, including some rarely Heide Museum of Modern Art seen on public display before. Curated by Claire Muir, 7 Templestowe Road, Bulleen 3105. Art Collection Officer, Deakin University. T (03) 9850-1500. W www.heide.com.au H Tues-Sun 10.00 to 5.00. To Oct 7 Design For Life: Grant and Mary Featherston. To Nov 11 Heide I: House of Ideas. To Feb 24, 2019 Sweeney Reed and Strines Gallery. Also, Meditation on a Bone: Albert Tucker Beyond the Modern. From Oct 13 Danica Chappell: Thickness of Time. Oct 27 to March 24, 2019Mirka Mora: Pas De Deux – Drawing and Dolls. Heritage Hill Museum and Gardens 66 McCrae Street, Dandenong 3175. T (03) 9793-4511. E [email protected] W www.heritagehill.com.au Free entry. H Tues-Fri 10.00 to 4.00. Oct 16 to Nov 15 Present Tense by Silvi Kadillari – a collection of photographs detailing life in Dandenong. Incinerator Gallery Christian Thompson, Othering the Ethnologist, Augustus Pitt Rivers, (map ref Melway 28 D7) 180 Holmes Road, Moonee 2016 Courtesy the artist, Sarah Scout Presents, Melbourne, and Deakin Ponds 3039. T (03) 8325-1750. University Art Gallery E [email protected] W www.incineratorgallery.com.au Free entry. H Tues-Sun 11.00 to 4.00. Oct 13 to Nov 25 Eltham Library (opening with winners announcements Fri Oct 12, Community Gallery 6-8pm) Incinerator Art Award: Art for Social Change (map ref Melway 21 J5) 1 Panther Place, Eltham – the gallery’s annual contemporary art prize featuring 3095. T (03) 9433-3175. 33 works by shortlisted artists from across Australia, E [email protected] inspired by the theme of art for social change. W nillumbik.vic.gov.au/Living-in/Arts-and-Cultural- Artist talk: Sat Oct 20, 2pm. Development H Mon-Thurs 10.00 to 8.30, Fri-Sat 10.00 to 5.00, Sun 1.00 to 5.00, closed public Joel Gallery hols. To Oct 15 Down the Rabbit Hole by Clare 5 Sargood Street, Altona 3018. T (03) 9398-2511. Dunstan (Tog & Pini) and Sarah Hardy (Popcorn E [email protected] W www.ljac.com.au Blue). Oct 18 to Nov 19 Nillumbik Artists Open H Mon-Fri 10.00 to 4.00, Sat-Sun 11.00 to 3.00. Studios – experience the diversity of the Nillumbik Joel Gallery is a contemporary exhibition space Artists Open Studios Program before their open hosting a diverse program of visual arts exhibitions by studio weekends on Nov 17 and 18 and 24 and 25. professional and community artists. artistsopenstudios.com.au

100 Melbourne Melbourne 101 Kosnar’s Picture Framing Maroondah Access Gallery 488 Mount Alexander Road, Ascot Vale 3020. Maroondah Federation Estate, 32 Greenwood Avenue, T (03) 9370-5744. W www.kosnar.com.au Ringwood 3134. T (03) 9298-4545. We offer a large range of frame styles for the artist and E [email protected] collector. Expert advice in framing design for all types W www.artsinmaroondah.com.au H Mon-Fri 9.00 to of artwork. 5.00, closed weekends and public hols. Manningham Art Gallery Monash Gallery of Art (MGA) Manningham City Square (MC ), 687 Doncaster The Australian home Road, Doncaster 3108. T (03) 9840-9367. of photography E [email protected] W www.manningham.vic.gov.au/manningham-art- 860 Ferntree Gully Road, Wheelers Hill 3150. gallery Free entry. H Tues-Sat 11.00 to 5.00. E [email protected] W www.mga.org.au To Oct 6 Slippery When – an exhibition that tries H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 5.00, to get a grip on slipperiness as a concept. Featuring closed public hols. Sept 29 to Nov 18 William & a range of works that depict or employ slippery Winifred Bowness Photography Prize (see ad page 9). materials or surfaces, Slippery When is about Also, Valery Sparks. slipperiness as a material quality, slipperiness as an experience, an interaction between surfaces, and Mornington Peninsula slipperiness as an adjective that can describe people Regional Gallery (MPRG) and personalities as much as physical objects. Oct (map ref Melway 145 G4) Civic Reserve, Dunns 17 to Nov 10 Nature in Art – a survey of natural Road, Mornington 3931. T (03) 5975-4395. history illustrations by members of the Park Orchards E [email protected] Community House and Learning Centre’s Nature W mprg.mornpen.vic.gov.au H Tues-Sun 10.00 to in Art group. This exhibition highlights the inherent 5.00. To Nov 18 Anne Ferran: Intimate Journals. beauty and magic of nature, combining artistic This photographic series, and limited edition book vision with scientific accuracy in stunningly beautiful ‘Artist’s Library’ evolved from time spent by Anne images that also serve to spur greater interest in Ferran exploring the special character of Arthur the maintenance of the natural world. Also, In Your and Yvonne Boyd’s personal library located in the Own Plot asks a group of emerging printmakers to Bundanon Homestead. Ferran is one of Australia’s take a closer look at the flora and fauna within their leading photographic artists. A Bundanon Trust immediate environment namely, the land (or space) travelling exhibition. Also, Catherine Truman: on which their homes sit. Featuring new works that No Surface Holds. Catherine Truman’s practice engage unique elements of the artists’ homes, the incorporates contemporary jewellery, objects, digital exhibition is about appreciating the beauty as much image and film installation with a focus upon the as the ugliness, the consistencies, patterns and parallels between artistic process and scientific changes that exist within the spaces we spend so method. Investigating Truman’s 20 years of much of our lives in. collaborative practice at the nexus of art and science, this exhibition is an important retrospective of the multiple engagements Truman has had working with scientists over this time as well as featuring a new body of work. A JamFactory Icon 2017 touring exhibition (see ad page 10). TarraWarra Museum of Art 313 Healesville-Yarra Glen Road, Healesville 3777. T (03) 5957-3100. E [email protected] W www.twma.com.au Adults $10, seniors $8, concession $5, free entry for children aged 12 and under. H Tues-Sun 11.00 to 5.00, and all public hols. Visit website for public programs and events. To Nov 6 TarraWarra Biennial 2018: From Will to Form.

James Bonnici, Sam 2, 2017, oil on linen, 31 x 36cm Courtesy the artist, Lindberg Galleries, Melbourne, and Manningham Art Gallery

102 Melbourne Walker Street Gallery Yarra Ranges Regional Museum & Arts Centre 35 37 Castella Street, Lilydale 3140. T (03) 9294- (map ref Melway 90 D8, E7) Cnr Walker and 6313. E [email protected] Robinson streets, Dandenong3175. W ach.yarraranges.vic.gov.au Free entry. T (03) 9706 8441. E [email protected] H Daily 10.00 to 4.00, closed public hols. W www.walkerstgallery.com.au H Tues Fri 11.00 to 5.00, Sat 11.00 to 3.00, closed Sun, Mon and public Yering Station Art Gallery hols. Walker Street Gallery & Arts Centre is South 38 Melba Highway, Yarra Glen 3775. Eastern Melbourne’s premier art centre. T (03) 9730 0102. E [email protected] To Oct 13 Gallery 1: Travelling Exhibition: The W www.yering.com Contact: Dr Ewen Jarvis. unsuspected wealth of daily life. Gallery 2: Southern H Mon Fri 10.00 to 5.00, Sat Sun 10.00 to 6.00. RootsExhibition, curated by Katherine Gailer. Oct 18 To Oct 7 Winery Viewing Gallery: The Stillest Hour: to Nov 24 (opening Thurs Oct 18, 6.30pm) Gallery Reimagining Victoria’s Highland Forests by Chris 1: Home Elyas Alvi, Zia Atahi, Lobsan Dhoyou, Taylor. To Nov 18 Main Gallery: Organic Plastic by Mirwais Janbaz, Tadros Hanna and Amir Tehrami Carolyn Cardinet. First Floor Gallery: Winner ofthe Homa. Gallery 2: They Cannot Take the Sky: Stories YouthArt 2018 Yering Station Art Gallery Award From Detention an exhibition made up of dozens of Tessa Hubble. Oct 28 to Dec 9 Yarra Valley Arts short video and audio stories, based on the book of / Yering Station Sculpture Exhibition & Awards the same name. various artists featuring indoor and outdoor sculpture across the grounds of Yering Station.

Zia Atahi, Untitled, 2017, digital image Courtesy the artist and Walker Street Gallery and Arts Centre Whitehorse Artspace Box Hill Town Hall, 1022 Whitehorse Road, Box Hill 3128. T (03) 9262 6250. E [email protected] W www.whitehorseartspace.com.au H Tues Fri 10.00 to 4.00, Sat 12.00 to 4.00. To Nov 3 Boyd & Davey after 20 years of creative collaboration, friends Kevin Boyd and Philip Davey join forces in this inspiring exhibition of ceramics and landscapes. Both artists draw from an impressive body of work. More recently, artworks created together and apart reveal the influences each artist has borne on one another.

Melbourne 103 Victoria

104 Merricks House Art Gallery Mornington 3460 Frankston – Flinders Road, Merricks 3961. T (03) 5989-8088. E [email protected] W www.mgwinestore.com.au H Daily 8.30 to 5.00. Peninsula Merricks House is located adjacent to Merricks General Wine Store and showcases talent from both Frankston Arts Centre the local Mornington Peninsula Region as well as artists from across Australia. Meander through the and Cube 37 Galleries garden from the café, bistro, cellar door or deck to 27-37 Davey Street, Frankston 3199. discover this hidden gem. Oct 6 to 28 The Winsome T (03) 9784-1896. W www.thefac.com.au Collection by Camilla d’Antoine – a curated collection H Tues-Fri 9.00 to 5.00, Sat 9.00 to 2.00. Art After of rare and other-wordly hand coloured lantern Dark every evening from dusk. Through Oct Peninsula slides, restored and transformed into large-scale Film Festival: Selected Shorts. FAC Curved Wall photographic artworks. Gallery: Between Bays – 2017 Open Exhibition winner Craig MacDonald with Brad Henderson & Karina Laird. FAC Atrium Gallery: Sea Boards by Matt D Design. Cube Gallery: Mental Health Week exhibition. FAC Mezzanine: Local Drawing on Nature group show. FAC Art + Gift Boxes: Revamping for Charity Vintage Jewellery. Free entry to all galleries. Gordon Studio Glassblowers A Working Hot Glass Studio & Gallery 290 Red Hill Road (cnr Dunns Creek Road), Red Hill 3937. T (03) 5989-7073. E [email protected] W www.gordonstudio.com.au H Daily 10.00 to 5.00. Manyung Gallery Mount Eliza 60 Mt Eliza Way, Mt Eliza 3930. T (03) 9787-2953. W www.manyunggallery.com.au H Tues-Sat 10.00 to Camilla d’Antoine, Photographers Point, America, c.1890, magic 5.00, and first Sun of the month 10.00 to 3.00. lantern photograph, 320gsm cotton rag, 110 x 110cm Courtesy the artist and Merricks General Wine Store Oct5to20Coastal by Kristine Ballard. Montalto Sculpture park 33 Shoreham Road, Red Hill South 3937. T (03) 5989-8412. W www.montalto.com.au (member of ACGA) Free entry. H Daily. To Oct 28 Montalto Sculpture Prize 2018. Mornington Peninsula Regional Gallery (MPRG) Civic Reserve, Dunns Road, Mornington 3931. W mprg.mornpen.vic.gov.au See Melbourne entry for exhibition details. Oak Hill Gallery (map ref Melway 145 G10) 100 Mornington-Tyabb Aqua Swell Kristine Ballard, , 2018, oil on canvas, 122 x 152cm Road (adjacent to the Rose Gardens), Mornington Courtesy the artist and Manyung Gallery 3931. T (03) 5973-4299. E [email protected] McClelland Sculpture Park W www.oakhillgallery.com.au H Daily 11.00 to 4.00. + Gallery (map ref Melway 103 E3) 390 McClelland Drive, Langwarrin 3910. T (03) 9789-1671. E [email protected] W www.mcclellandgallery.com Director: Lisa Byrne. Entry by donation. H Gallery, shop and café Tues-Sun 10.00 to 5.00. Victoria 105 WHISTLEWOOD Gippsland Art Gallery Contemporary Australian Art 70 Foster Street, Sale 3850. T (03) 5142-3500. 642 Tucks Road, Shoreham 3916. T (03) 5989- E [email protected] 8282. E [email protected] W www.gippslandartgallery.com H Mon-Fri 9.00 to W www.mccullochandmcculloch.com.au H Sat-Sun 5.30, Sat-Sun and public hols 10.00 to 4.00. 11.00 to 4.00. To Oct 28 Spring Salon 2018: To Nov 18 Connections to Country by Dr Aunty Aboriginal art from around Australia – with paintings, Eileen Harrison. Also, Impressions of Gippsland barks, ochres, works on paper and carvings from by Kevin Lincoln. To Nov 25 John Leslie Art Prize 26+ leading Aboriginal art centres of the Kimberley, 2018. To Jan 20, 2019 The Art of Annemieke Mein. Arnhem Land, Central, Western and Eastern Deserts, the APY Lands, the Pilbara, Northern Territory, Queensland and Victoria. Gippsland South East arc Yinnar Gallery 19 Main Street, Yinnar 3869. T (03) 5163-1310. Jason Cordero, It Appeared the Guide was in Error, 2018, oil on linen, 102 x 152cm W www.arcyinnar.org.au H Tues-Fri 12.00 to 4.00, Finalist in the 2018 John Leslie Art Prize Sat 11.00 to 3.00. Oct 20 to Nov 3 (opening Sat Oct Courtesy the artist, Artvisory Gallery, Melbourne, and Gippsland 20, 2pm) SParc Gallery: Mini Retro by Kate McGuire. Art Gallery Oct 20 to Nov 17 (opening Sat Oct 20, 2pm) Gallery arc: an exhibition of work by arc members to be held Latrobe Regional Gallery during the Moartz inc. Open Studios Latrobe Art Fair. 138 Commercial Road, Morwell 3840. Nov 7 to 17 Children’s Art Exhibition, curated by T (03) 5128-5700 F 5128-5706. Yvette Atkins. E [email protected] W latroberegionalgallery.com H Mon-Fri 10.00 to 5.00, Sat-Sun 11.00 to 4.00. ArtSpace Wonthaggi To Oct 7 Mineral | Art of Matter 1400-2000: 1 Bent Street, Wonthaggi 3995. T (03) 5672-5767. Highlights from Latrobe Regional Gallery Object E [email protected] Collection. To Oct 21 Richard Tipping: Art Word, W www.artspacewonthaggi.com.au H Daily 10.00 to Signs, Drawings, Typographs. To Oct 28 Beyond 4.00. 2D and 3D contemporary and traditional art. the Valley – a voyage in time by Martine Corompt. To Oct 15 ArtsPrint an exclusive selection of original To Nov 25 Blurred Boundaries by Helle Cook. To limited edition prints. Oct 16 to Nov 26 (opening Sun Jan 13, 2019 Kylie on Stage – a touring exhibition Oct 21, 2-4pm) ExtraDimensional featuring sculpture proudly presented by Arts Centre Melbourne and the and diverse 3D artworks. Australian Music Vault and supported by Creative Victoria. To Jan 27, 2019 Codebreakers: Women in Gecko Studio Gallery Games. An ACMI touring exhibition. and ArtHouse accommodation 15 Falls Road, Fish Creek 3959. T (03) 5683-2481. E [email protected] W www.geckostudiogallery.com.au Facebook: geckostudiogallery. H Thurs-Mon 9.00 to 4.00. Also including Headquarters Café. To Oct 15 Juxtaposition – Maggie Malone, Harry Pullar, Chris Tuttle and Kerry Spokes. Four artists working with collage, a medium with a sense of revolutionary possibility. Oct 18 to Nov 12 (opening Fri Oct 19, 6-8pm) Rosalind Forster linocuts.

106 Victoria Maffra Exhibition Space 150 Johnson Street, Maffra 3860. T Enquiries to Geelong Gippsland Art Gallery (03) 5142-3500. H Mon, Wed- Fri 10.00 to 6.00, Sat 10.00 to 12.00, closed Tues and Sun. To Oct 22 Actuality by Emma Hearnes. Oct 25 to Dec 10 Homeground: Memory and South West Meaning – Kurec Family. Great Ocean Road Bay of Whales Gallery 47 Liebelts Road, Narrawong 3285. T 0415-464-572. E [email protected] W www.brettjarrettwildlifeart.com H Gallery and Café Sat-Sun 10.00 to 4.00. Presenting artwork by realist artist Brett Jarrett. Jarrett’s works are based on nearly three decades of extensive field work dedicated to wildlife from remote regions of the world, creating a physical and emotional window into his world of art and nature. See ad page 91.

Kiera Brew Kurec, Portrait of the Artist, 2018, digital print on archival rag Courtesy the artist and Gippsland Art Gallery, Victoria Bob Jenyns (1944-2015) The Art of the Traveller Lithographs and sculptures by Bob Jenyns whose artistic practice spanned over four decades.

5 OCTOBER - 14 NOVEMBER 2018 Opening 5 October 6-8pm

Gallery on Sturt 421 Sturt Street, Ballarat 3350 03 5331 7011 [email protected] www.galleryonsturt.com.au Mon-Fri 9.00 to 5.00. Sat 10.00 to 2.00

Image: Bob Jenyns, lithograph, 71 x 45cm

Victoria 107 Blarney Books & Art Qdos Arts + Sculpture Park 37 James Street, Port Fairy 3284. T (03) 5568-2174. 35 Allenvale Road, Lorne 3232. T (03) 5289-1989. E [email protected] W www.qdosarts.com Director: Graeme Wilkie OAM. W www.blarneybooks.com.au H Thurs-Mon 9.00 to 5.00. Oct 9, 10 and 11, Instagram: blarneybooksandart. H Thurs-Sun 11.00 Phil Doggett-Williams – QDOS Drawing Intensive: to 4.00. Unique book-related art space bookshop, in Technique, Process and Invention. Oct 13, David beautiful Port Fairy. Long – Dry Stone walling as sculpture or plinth. Oct 20 and 21, Jock Clutterbuck – Drawing with Boom Gallery the Mind’s Eye. Oct 27 and 28, Dianne Longley – Encaustic Workshop. Oct 30 and 31, and Nov 1, 11 Rutland Street, Newtown 3220. T 0428-305-639. Rimona Kedem – Conservations with Self. Nov 13, 14 E [email protected] and 15, Shona Wilson – Collaborations with Nature. W www.boomgallery.com.au H Mon-Sat 9.00 to For all workshop details please call Qdos Arts, or visit 4.00, Sat 9.00 to 3.00. Boom Gallery presents the website. On-site accommodation at student rates. work of emerging and established artists. Oct 11 to Nov 3 Red, Yellow, Blue paintings by Bridget McNab. SCOPE Galleries 38 Kelp Street, Warrnambool 3280. T (03) 5561-4758, 0410-464-330 F 5561-5692. E [email protected] W www.scopegalleries.com Director: Liza McCosh. H Sat-Sun 1.00 to 4.00, or by appt. Contemporary paintings, prints and sculpture. Warrnambool Art Gallery 26 Liebig Street, Warrnambool 3280. T (03) 5559- 4949. E [email protected] W www.thewag.com.au Director: Vanessa Gerrans. H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols 10.00 to 3.00. To Oct 14 Code Breakers: Women in Games. Also, Humanise by Leah Heiss. Bridgette McNab, June, 2018, oil on polycotton, 70 x 100cm To Dec 2 On Country: Stories of Gunditjmara Elders. Courtesy the artist and Boom Gallery Oct 13 to Feb 24, 2019 Paul Jennings: UNREAL! – an exhibition celebrating Australia’s best-loved Elizabeth Arthur Fine Art storyteller. Gallery & Sculpture Garden 35 Carmichael Street, Hamilton 3300. Wishart Gallery T (03) 5572-2851. E [email protected] 19 Sackville Street, Port Fairy 3284. Director: Dr Elizabeth Arthur. H Thurs-Fri 10.00 to T (03) 5568-2423. E [email protected] 6.00, Sun 12.00 to 4.00, or by appt. W www.wishartgallery.com.au Art, Antiques, Bar. Geelong Gallery 55 Little Malop Street, Geelong 3220. T (03) 5229- 3645. W geelonggallery.org.au Director: Jason Smith. Central Free entry unless otherwise stated. H Daily 10.00 to 5.00. To Nov 18, 2018 Archibald Prize (see ad page 4). To Nov 25 Cuttings by Elizabeth Gower. Victoria Metropolis Gallery Ararat Gallery TAMA 64 Ryrie Street, Geelong 3220. T (03) 5221-6505. Town Hall, Vincent Street, Ararat 3377. W www.metropolisgallery.com.au Director: Robert T (03) 5355-0220 , . E [email protected] Avitabile. H Mon-Fri 9.00 to 5.00, Sat 10.00 W ararat.vic.gov.au H Mon-Sun 10.00 to 4.00. to 4.00, Sun 12.00 to 4.00. Oct 13 to Nov 4 Closed Good Friday, Christmas Day, Boxing Day and Metropolis Gallery Collectors Show. New Year’s Day. To Oct 28 Material Constructs: The Home Stretch by Sarah crowEST.

108 Victoria Art Gallery of Ballarat 40 Lydiard Street North, Ballarat 3350. T (03) 5320-5858. E [email protected] W artgalleryofballarat.com.au Free entry unless specified. H Daily 10.00 to 5.00. To Nov 6 BOAA ART 2018 – a city-wide celebration of contemporary art, as BOAA is the largest ever showcase of Australia’s living artists. Artists featured at the Art Gallery of Ballarat are Kim Anderson, Asher Bilu, Faridah Cameron, Gerwyn Davies, Phillip George, Marlene Gilson, David Jensz, Louiseann King, The Numina Sisters, Pip & Pop and Jason Sims. Full details at boaa.net.au (see ad page 40). To April 9, 2019 solis by Louiseann King – a re-imagining of two rooms of the gallery’s collection combining images of women and landscapes with contemporary works. Part of BOAA ART 2018. ”–• ƒ†‡›ǡ‘•–ˆϐ‹ ‡ Gallery Federation University Australia, cnr Sturt and Lydiard streets, Ballarat 3350; PO Box 663, Ballarat 3353. T (03) 5327-8615. E [email protected] W federation.edu.au/pogallery Curator: Shelley Hinton. H Wed-Sat 12.00 to 5.00, Mon-Tues by appt. To Nov 6 Heidi Wood: Off The Map. Wood’s immersive work explores her curiosity about tourism Bob Jenyns (1944-2015), Fez, lithograph, 71 x 41cm and tourist zones, particularly within the ex-Soviet Courtesy the artist and Gallery on Sturt bloc. Creating her own promotional environment utilising a repertoire of commercial pictograms, Bendigo Art Gallery mementos and symbols, Wood deliberately questions 42 View Street, Bendigo 3550. T (03) 5434-6088. the very position of culture, the messages it can E [email protected] provide and the people it aims to target. Showing as W www.bendigoartgallery.com.au Director: Karen part of BOAA, Biennial of Australian Art. Quinlan. Entry by donation unless specified. H Gallery/shop daily 10.00 to 5.00. To Feb 10, 2019 Ballarat – Gallery on Sturt Jessie Boylan: Rupture. Oct 6 to Feb 10, 2019 421 Sturt Street, Ballarat 3350. T (03) 5331-7011. Gothic Beauty: Victorian notions of love, loss and E [email protected] spirituality. Oct 10 to Jan 21, 2019 Damon Moon: W www.galleryonsturt.com.au Director: Leigh Subject/Object. Tweedie. H Mon-Fri 9.00 to 5.00, Sat 10.00 to 2.00. Oct 5 to Nov 14 (opening Fri Oct 5, 6-8pm) BOAA ART 2018 The Art of the Traveller – a selection of lithographs Biennale of Australian Art and sculptures by Bob Jenyns (1944-2015). Jenyns was a prolific artist whose practice spanned over W www.boaa.net.au/tickets To Nov 6 BOAA ART four decades. He is represented in many of the 2018 – presenting a showcase of 150+ artists from country’s largest collections, including: National across Australia 65 curated solo exhibitions presented Gallery of Australia, Art Gallery of New South Wales, throughout three ‘Art Villages’ within 14 of Ballarat’s Queensland Art Gallery, Museum of Contemporary Art heritage buildings and historic locations. Visit website in Brisbane and Tasmanian Museum and Art Gallery. for program and ticketing. See ad back cover. See ad page 107.

Victoria 109 Castlemaine Art Museum 14 Lyttleton Street (PO Box 248), Castlemaine 3450. T (03) 5472-2292. E [email protected] W www.castlemainegallery.com H Thurs-Sun 12.00 to 5.00. ‡–”ƒŽ ‘Ž†ϐ‹‡Ž†•”– ƒŽŽ‡”› Old Fire Station, Neil Street, Maryborough 3465. T (03) 5460-4588. E [email protected] W www.visitmaryborough.com.au H Thurs-Sun 10.00 to 4.00. Central Goldfields Art Gallery is a cultural facility of the Central Goldfields Shire Council. To Oct 14 Jeff Makin – Survey. Falkner Gallery 35 Templeton Street, Castlemaine 3450. T (03) 5470-5858. E [email protected] W www.falknergallery.com.au H Wed 1.00 to 5.00, Thurs-Sat 11.00 to 5.00, Sun by appt. Oct 11 to Dec 24 Folds and Feathers – David Golightly, Sally Roadknight and Lee Shelden. Also, 2018 Christmas Jasmine Targett, Immeasurable Heaven/Self, 2016, Perspex, Collection: Affordable small works by 30+ artists. 82 x 86cm Courtesy the artist and Stockroom Gallery La Trobe Art Institute 121 View Street, Bendigo 3550. T (03) 5444-7272. E [email protected] W www.latrobe.edu.au/art-institute H Mon-Fri 10.00 North to 5.00, Sat 12.00 to 5.00. To Oct 27 Artivisms Now featuring Caroline Garcia, Parallel Park, Pierra Van Sparkes and Xanthe Dobbie. Curated by Brigid Hansen. Also, Chart Form featuring Ashley Mariani, North East & Dylan Martorell, Sean Hogan and Yuria Okamura. North West MONDO ART E [email protected] Art at Linden Gate W www.mondoartgallery.com A marketplace and W www.artatlindengategallery.com.au consultancy of innovative, collectable, contemporary For exhibition details see Melbourne section. 2D and 3D art for commercial and private spaces, with a focus on large-scale works. Benalla Art Gallery (map ref Melway 619 D6) Botanical Gardens, Bridge ‘•–ˆϐ‹ ‡ ƒŽŽ‡”› Street West, Benalla 3672. T (03) 5760-2619. A satellite space of Bendigo E [email protected] Art Gallery W www.benallaartgallery.com.au H Daily 10.00 to 51-67 Pall Mall, Bendigo 3550. T (03) 5434-6179. 5.00. Closed Tues, Good Friday, Christmas Day and E [email protected] Boxing Day. To Nov 4 Looking But Not Seeing. W www.bendigoartgallery.com.au Director: Karen Oct 6 to Feb 3, 2019 Collection 50th Anniversary. Quinlan. Entry by donation. H Daily 9.00 to 5.00. Oct 26 to Dec 2 Broken River Potters. To Nov 11 Bankrolling Bendigo: building a city. The Goat Gallery Stockroom Gallery 87A Main Street, Natimuk 3409. T 0417-307-824. 98 Piper Street, Kyneton 3444. T (03) 5422-3215. W facebook.com/TheGoatGallery H Sat-Sun 1.00 E [email protected] W www.stockroom.space to 4.00, or by appt. To Oct 7 VCE Studio Arts – H Mon-Thurs 10.30 to 5.00. Sat 10.00 to 6.00, Sun Horsham College, Horsham and St Brigid’s College, 10.00 to 5.00 (closed Tues-Wed). Oct 13 to Nov 4 Horsham. Supported by Horsham Rural City Council. (opening Sat Oct 13, 4.30-7pm) Super Ecology by Oct 13 to 21 Syria’s historical and cultural legacy Jasmine Targett. in the context of ongoing conflict – photographs taken in Syria before the civil conflict began in 2011. Supported by Horsham Rural City Council. Oct 26 to Nov 18 Mel Obst.

110 Victoria CONGRATULATIONS

• Nicole Allen • Rodney McKenzie • Aldo Bilotta • Shlomit Moira • John Bishop • Donal Molloy-Drum • Betty Collier • Noel Muscat • Mark Cuthberson • Mel Rayski-Mati • David Doyle • Fatih Semiz • Wayne Foenander • Michael Sibel TESSELAAR • Hovik Israelian • Todd Stuart SCULPTURE PRIZE 2018 • Vladimir Ivanoff • Joe Taranto Presented by Tesselaar and • Katy Knighton • Mary van den Broek the Association of Sculptors of Victoria • Rod & Gill Lee • Bruce Webb Curator - Mark Cowie • Lucy McEachern • Nives Zorzut The Tesselaar Tulip Festival and the Association Visit Sept 15th - Oct 14th 2018 of Sculptors of Victoria would like to congratulate the fi nalists selected for the eleventh annual www.tulipfestival.com.au $20,000 Tesselaar Sculpture Prize.

Victoria 111 Horsham Regional Art Gallery Wangaratta Art Gallery 80 Wilson Street, Horsham 3400. 56 Ovens Street, Wangaratta 3677. T (03) 5382-9575. E [email protected] T (03) 5722-0865. E [email protected] W www.horshamtownhall.com.au H Tues-Fri 10.00 W www.wangarattaartgallery.com.au Free entry. to 5.00, Sat 11.00 to 4.30, Sun 1.00 to 4.30. H Tues-Sun 10.00 to 4.00, closed Mon. Office hours Mon-Fri 9.00 to 5.00, closed public hols and for Mildura Arts Centre exhibition installations. Wangaratta Art Gallery is a Cultural Service of the Rural City of Wangaratta. To 199 Cureton Avenue, Mildura 3500. Oct 28 Gallery 2: Formanics recent work by Taro T (03) 5018-8330. E [email protected] iiyama. To Nov 13 WPAC Foyer Gallery: Light Falls W www.milduraartscentre.com.au H Daily 10.00 by Erin Davis-Hartwig. To Nov 18 Gallery 1: Mayoral to 5.00. To Oct 14 Art Directions 2018 – Arts Chain – a Craft Victoria Travelling Exhibition. Educators. To Oct 21 Sense of Place – Barbara Also, Local Links. Bennetts, Bronwen Gibbs, Dawna Richardson-Hyde and Sharron Shalekoff. To Oct 28 A Good Yarn 50 Years Long: 1968-2018 – The Embroiderers Guild, Victoria, Mildura Branch. To Dec 2 Considering Mildura: Mildura Sculpture Triennials, 1982-88 Warragul Mildura Arts Centre Collection. Sculpture among the Tulips Region Tesselaar Tulip Festival Bradley Hall Antiques (map ref Melways Map 123 B5) The Tulip farm, 357 Monbulk Road, Silvan 3795. & Art Gallery W www.tulipfestival.com.au To Oct 14 Tesselaar Australian Studio of Gary Miles Sculpture Prize 2018 – an exhibition of finalists for 12 Old Telegraph Road West, Drouin West 3818. the $20,000 prize. Curated by Mark Cowie. T (03) 5626-8355, 0407-443-606. See ad page 111. E [email protected] W www.garymilesart.com.au H Sat-Sun and public Shepparton Art Museum (SAM) hols 11.00 to 5.00 or by appt. Artist: Gary Miles. (map ref Vic Roads map 273 L8 or 32 H8) 70 Gallery viewing of available paintings of past series. Welsford Street, Shepparton 3630. T (03) 5832-9861. E [email protected] Phil Henshall Studio W sheppartonartmuseum.com.au Director: Dr 1116 Main Neerim Road, Rokeby 3821. Rebecca Coates. Free entry. H Daily 10.00 to 4.00, T 0418-318-187. W philhenshall.com.au public hols 1.00 to 4.00. Closed Christmas Day, New H Studio open the second weekend each month Year’s Day and Good Friday. Join SAM on Facebook, 10.00 to 5.00. Exploring ASPECTIVISM™. Twitter and Instagram! To Oct 24 Drawing Wall Oct 13 and 14 ALTITUDE. Nov 10 and 11, 24 and #32: Sadie Chandler. To Nov 11, 2018 Indigenous 25, 2018 SHOW & TELL. Ceramic Award (ICA). Also, Subject / Object. Red Tree Gallery Jindivick Swan Hill Regional Art Gallery 420 Main Jindivick Road, Jindivick 3818. Horseshoe Bend, Swan Hill 3585. T (03) 5628-5224. E [email protected] T (03) 5036-2430. E [email protected] W www.lauriecollins.com.au Ongoing Laurie Collins. W www.facebook.com/swanhillregionalartgallery H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 4.00. TarraWarra Museum of Art West W www.twma.com.au See Melbourne entry for exhibition details. Gippsland Kerrie Warren, Artist & Pilgrim Creek Studios Crossover (East of Melbourne) T 0411-480-384. W www.kerriewarren.com.au Large Scale Paintings, Ceramics, Sculpture.

112 Victoria

Sydney

114 The Ken Done Gallery CBD 1 Hickson Road, The Rocks 2000. T (02) 8274-4500 F (02) 8274-4545. E [email protected] W www.kendone.com.au H Daily 10.00 to 5.30. Our recent hang in The Ken The Rocks Done Gallery features some colourful, new Sydney Harbour paintings, a mix of new reef canvases and a Art Gallery of New South Wales selection of peaceful works on paper focused on the beach view from Done’s home studio. Complimenting (AGNSW) these are some quintessential Sydney drawings and Art Gallery Road, Sydney 2000. T (02) 9225-1744, small canvases of Chinamans Beach alongside pen 1800-679-278. W www.artgallery.nsw.gov.au and ink sketches to complete the show. Limited Admission charges apply to some exhibitions. edition prints, posters and other art related products H Daily 10.00 to 5.00. Art After Hours: Wed to are available for sale in the gallery shop including the 9pm. To Oct 21 Spacemakers and roomshakers: artist’s latest publication ‘Ken Done: Paintings you installations from the collection. Also, Playback: probably haven’t seen’. Dobell Australian Drawing Biennial 2018. To Nov 11 John Russell: Australia’s French impressionist. To Jan 13, 2019 Fearless: Korean Cultural Centre contemporary South Asian art. To Feb 3, 2019 Australia Gallery William Kentridge: that which we do not remember. Ground Floor, 255 Elizabeth Street, Sydney 2000. T (02) 8267-3400. E [email protected] The Art of Dr. Seuss W www.koreanculture.org.au H Mon-Fri 10.00 to presented by Harvey Galleries, 6.00. Visit website for exhibition information. QVB Museum of Contemporary Art Queen Victoria Building , Level 2, 33-35 / 455 George Street, Sydney 2000. T (02) 9261-0275. Australia (MCA) E [email protected] 140 George Street, The Rocks 2000. W www.harveygalleries.com.au H Mon-Wed 10.00 T (02) 9245-2400. W www.mca.com.au Free entry. to 6.00, Thurs 10.00 to 8.00, Fri-Sat 10.00 to 6.00, H Mon-Tues 10.00 to 5.00, Wed 10.00 to 9.00, Sun 11.00 to 5.00. Authorised editions from the Thurs-Sun 10.00 to 5.00. To Oct 14 Sun Xun. Seuss Estate. Now Showing MCA Collection: Today Tomorrow Yesterday. Oct 19 to March 3, 2019 David Goldblatt: Gaffa Gallery Photographs 1948-2018. 281 Clarence Street, Sydney CBD 2000. T (02) 9283-4273. W www.gaffa.com.au H Mon-Fri 10.00 to 6.00, Sat 11.00 to 5.00. Closed Sun and public hols. Gaffa is an independent creative precinct, artist-run in attitude and execution. Sept 27 to Oct 8 (opening Thurs Sept 27, 6-8pm) #nofearsemmabeers by Emma Beer, and Bittersweet by Melinda Clyne. Also, New World by Katrina Lezaic, and Indirect Landscapes by Gabrielle Freer, Caroline Kronenberg and Tempe Macgowan. Oct 11 to 22 (opening Thurs Oct 11, 6-8pm) Making in Pieces by Donna Sgro and Cecilia Heffer, and Pop Life by Nicole O’Loughlin. Also, Hypersensitive/ Hipsensitif by Soraya Abidin. Also, Man Cave – Peter Connelly, Morgan Dick and Beau Ziggy Abidin, and _spaces_collide – Jenny Du, Charlotte Richardson and Jessica McDermid. Oct 25 to Nov 5 (opening Thurs Oct 25, 6-8pm) Graduate Exhibition by UNSW A&D Masters by Coursework, La Gente by Katrina Garcia, and Kissy Face by Keiren Jolly. David Goldblatt, Shop assistant, Orlando West, 1972, silver gelatin photograph on fibre-based paper © The David Goldblatt Legacy Trust Courtesy Goodman Gallery, Johannesburg and Cape Town, and Museum of Contemporary Art Australia

Sydney 115 Museum of Sydney selected entries from artists representing diversity in contemporary portraiture. The award is recognised as Cnr Phillip and Bridge streets, Sydney 2000. one of the most important celebrations of the talents T (02) 9251-5988 . W sydneylivingmuseums.com.au and creativity of Australian female portrait painters Free with Museum entry, Adults $12, Conc $8, and has played a major role in developing the profile Family $30, Members Fee. H Daily 10.00 to 5.00. of the nation’s women artists. Closed Good Friday and Christmas Day. To Nov 25 Bohemian Harbour: Artists of Lavender Bay – artists include Brett Whiteley, Peter Kingston, Tom Carment, Philip Cox, Joel Elenberg, Robert Jacks, Rollin Schlicht, Garry Shead and Tim Storrier.

Kathrin Longhurst, Maia at 12 and a half, oil on linen, 100 x 100cm 2017 People’s Choice Award Courtesy the artist and S.H. Ervin Gallery State Library of NSW Cnr Shakespeare Place and Macquarie Street, Sydney 2000. T (02) 9273-1414. Brett Whiteley, Seagull over Lavender Bay, 1979 © Wendy Whiteley W www.sl.nsw.gov.au/galleries Free entry. Courtesy Sotheby’s Australia H Mon-Thurs 9.00 to 8.00, Fri 9.00 to 5.00, Sat-Sun 10.00 to 5.00. Open Day: Sat Oct 6, 10am to 4pm. NSW Parliament Visit the Library’s new galleries to explore a display of over 3,000 intriguing objects, and six must see 6 Macquarie Street, Sydney 2000. exhibitions. See ad page 30. E [email protected] W www.pleinair.com.au Free entry. H Mon-Fri 8.00 to 4.30. Oct 3 to 26 The 2018 NSW Parliament plein air Painting Prize Sydney Sculpture Conference: finalist exhibition for the $20,000 acquisitive award. a universal language See ad page 129. Sydney Opera House, Bennelong Point, Sydney 2000. W www.sculpturebythesea.com S.H. Ervin Gallery Mon Nov 5, 9.30am to 5.30pm International and National Trust of Australia (NSW), Watson Road, Australian scholars and artists, with a panel of Observatory Hill, The Rocks 2000. academics and artists from CAFA, China’s leading T (02) 9258-0173. tertiary art school, come together to discuss the E [email protected] importance, impact, challenges and opportunities W www.shervingallery.com.au H Tues-Sun 11.00 to of sculpture. This annual conference coincides with 5.00. To Oct 7 William Robinson: Genesis. Robinson the 22nd Sculpture by the Sea, Bondi exhibition, is recognised as one of Australia’s most important on from Oct 18 to Nov 4. Visit the website for contemporary landscape painters, celebrated in information and ticketing. particular for his original and powerful approaches to depicting the Australian environment through a multi- Vermilion Contemporary dimensional viewpoint. A QUT William Robinson Chinese Art Gallery travelling exhibition. Supported by the Meij 5/16 Hickson Road, Walsh Bay 2000. Family Foundation, Philip Bacon AM and Stuart T (02) 9241-3323. E [email protected] Purves AM of Australian Galleries. Oct 12 to Dec 2 W www.vermilionart.com.au H Tues-Sat 11.00 Portia Geach Memorial Awardd – Australia’s most to 7.00. prestigious art prize for portraiture by women artists since 1965. The annual award exhibition displays

116 Sydney Exhibition on now • Museum of Sydney UTS Gallery Chippendale University of Technology Sydney, Level 4, 702 Harris Street, Ultimo 2007. T (02) 9514-1652. E [email protected] W art.uts.edu.au Senior Curator: Tania Creighton. H Mon-Fri 12.00 to Central 6.00, Sat 12.00 to 4.00. To Nov 16 Void ceramics, video, painting, sculpture and photography by a The Commercial contemporary Aboriginal artists, curated by Emily McDaniel. 148 Abercrombie Street, Redfern 2016. T (02) 8096-3292. E [email protected] W www.thecommercialgallery.com Director: Amanda Rowell. H Wed-Sat 11.00 to 6.00. Please visit our website for current exhibition information. 4A Centre for Contemporary Asian Art 181-187 Hay Street, Haymarket, Sydney 2000. T (02) 9212-0380. W www.4a.com.au Free entry. H Tues-Fri 11.00 to 5.00, Thurs nights to 8.00, Sat-Sun 11.00 to 4.00. Nov 2 to Dec 16 Justine Youssef: All Blessings, All Curses.

Hayley Millar-Baker, Meeyn Meerreeng (Country at Night), 2017 Performance Space Courtesy the artist and UTS Gallery Carriageworks, Level 2, 245 Wilson Street, Eveleigh 2042. T (02) 8571-9111. White Rabbit Gallery E [email protected] W www.performancespace.com.au Presenting a 30 Balfour Street (near Central Station), program for experimental art practice. Visit website for Chippendale 2008. T (02) 8399-2867. more info. Oct 18 to 28 Liveworks 2018: Festival of W www.whiterabbitcollection.org H Wed-Sun 10.00 Experimental Art. to 5.00. To Feb 3, 2019 Supernatural – a journey through the reshaped Chinese landscapes of the 21st century. East Sydney APY Gallery 45 Burton Street, Darlinghurst 2010. E [email protected] W www.apygallery.com H Mon-Fri 9.00 to 5.00, Sat 10.00 to 4.00, Sun by appt. The APY Gallery is a platform for emerging Indigenous artists from the APY Art Centre Collective. www.apyartcentrecollective.com

Daniel Kok and Miho Shimizu, xhe ARO Photograph: Ryuichiro Suzuki 51 William Street, Darlinghurst 2010. T 0414-946- Courtesy the artists and Performance Space 894. E [email protected] W www.arogallery.com Oct 17 to 28 (opening Wed Oct 17, 6-8pm) Terra Sheffer Gallery habitatur new encaustic paintings by Randal Arvilla, curated by Susannah Smith. www.randalarvilla.com 38 Lander Street, Darlington 2008. 0403-363-725. Tues-Sat 10.00 to 6.00, Sun 12.00 T (02) 9310-5683. E [email protected] to 6.00. Enquiries: 0403-363-725. W www.sheffergallery.com H Wed-Sat 11.00 to 6.00. See ad page 119. Oct 3 to 13 Karen Michael. Oct 17 to 27 Tony Mighell.

118 Sydney Maritsa Micos 29 Oct - 4 Nov 2018

Transcribing the Storm, mixed media on canvas, 100 x 100cm

Art Gallery on Darling 307 Darling Street, Balmain NSW • Monday - Sunday 10am - 5pm [email protected] • 0410 578 834

Sydney 119 Arthouse Gallery The Cross Art Projects 66 McLachlan Avenue, Rushcutters Bay 2011. 8 Llankelly Lane (off Orwell Street), Kings Cross T (02) 9332-1019. E [email protected] 2011. T (02) 9357-2058, 0406-537-933. W www.arthousegallery.com.au H Tues-Fri 9.30 to E [email protected] W www.crossart.com.au 6.00, Sat 10.00 to 5.00. Sept 27 to Oct 20 The Director: Jo Holder. H Thurs-Sat 11.00 to 6.00. River Passes by Dean Home. Oct 25 to Nov 10 Past To Oct 20 Abuzz by Jacqueline Rose with text by Voices by Colin Pennock. Johanna Featherstone. Fine Arts, Sydney Suites 204 & 205, 20-22 Bayswater Road, Potts Point 2011. T (02) 9361-6200. E [email protected] W www.finearts.sydney H Wed-Sat, 12.00 to 6.00. Oct 11 to Nov 11 contemporaryary by Matthew Griffin. Firstdraft 13-17 Riley Street, Woolloomooloo 2011. T (02) 8970-2999. E [email protected] W www.firstdraft.org.au H Wed-Sun 12.00 to 6.00. Dean Home, Winding rivers – Remote places, oil on board, 75 x 122cm An artist run organisation for emerging Courtesy the artist and Arthouse Gallery and experimental art practice. Visit website for exhibition program. Artspace 43-51 Cowper Wharf Road, Woolloomooloo 2011. Frances Keevil Gallery T (02) 9356-0555. E [email protected] Bay Village, 28-34 Cross Street, Double Bay 2028. W www.artspace.org.au H Mon-Fri 11.00 to 5.00, T (02) 9327-2475. E [email protected] Sat-Sun 11.00 to 6.00. Visit website for exhibition W www.franceskeevilgallery.com.au H Tues-Sat program. 10.00 to 5.00, Sun 11.00 to 4.00. To Oct 14 Nature’s Calligraphy by Sue Smalkowski. Oct 17 Australian Centre to Nov 4 The Triumph Of Venus – Painters: Esther Erlich, Adrian Lockhart, Bahman Kermany and for Photography Nicole Sacks. Sculptors: Sally Hook, Michael Project Space Gallery Vaynman, Eilat Rabin, Jan Howlin and Gwen Robson. 72 Oxford Street, Darlinghurst 2010. T (02) 9332- 0555. E [email protected] W www.acp.org.au Free entry. H Tues-Fri 10.00 to 5.00, Sat 11.00 to 4.00. Closed public hols. To Oct 20 Oceans From Here – Chris Bennie, Dean Cross, Emma Hamilton, Honey Long + Prue Stent, Kai Wasikowski and John Young Zerunge.

Esther Erlich, Knockout, acrylic on canvas, 82 x 77cm Courtesy the artist and Frances Keevil Gallery Kai Wasikowski, Realtree #4, 2018, colour inks on paper © the artist Courtesy the artist and Australian Centre for Photography

120 Sydney Myrtle Pennington

In association with Spinifex Arts Project, Tjuntjuntjara, WA

4 - 27 October 2018

1/24 Wellington Street, Waterloo NSW 2017 telephone 612 9699 2211 Tues-Sat 11.00-5.00 email info@aboriginalpacificart.com.au web www.aboriginalpacificart.com.au

Image: Myrtle Pennington, Kanpa, 2018, acrylic on linen, 200 x 137cm

Sydney 121 Gallery 9 Liverpool Street Gallery 9 Darley Street, Darlinghurst 2010. 243a Liverpool Street, East Sydney 2010. T (02) 9380-9909. E [email protected] T (02) 8353-7799. E [email protected] W www.gallery9.com.au Director: Allan Cooley. W www.liverpoolstgallery.com.au Director: James Manager: Octavia Knox. H Wed-Sat 11.00 to 6.00, Erskine. H Tues-Sat 10.00 to 6.00. Sun-Tues by appt. Oct 3 to 27 Peter Alwast. Oct 31 to Nov 24 Jake Walker, and Simon Kennedy. NAS Gallery Forbes Street, Darlinghurst 2010. T (02) 9339-8686. E [email protected] W www.nas.edu.au/place/ gallery Free entry. H Mon-Sat 11.00 to 5.00. National Association for the Visual Arts (NAVA) T (02) 9368-1900. E [email protected] W www.nava.net.au NAVA is the peak body representing and advancing the professional interests of the Australian visual arts, craft and design sector. See ad page 111. Robin Gibson Gallery 278 Liverpool Street, Darlinghurst 2010. T (02) 9331-6692. W www.robingibson.net H Tues-Sat 11.00 to 6.00. Sept 29 to Oct 24 Richard Byrnes, and Katherine Edney.

Jake Walker, #0086, 2018, oil on linen, glazed stoneware, STACKS Projects 51x 48 x 10cm 191 Victoria Street, Potts Point 2011. Courtesy the artist and Gallery 9 E [email protected] W www.stacksprojects.com Directors: Chloe Gunn, King Street Gallery on William Zachary Harold, Annelies Jahn, Jane Lush and Joanne 177 William Street, Darlinghurst 2010. Makas. H Thurs-Sat 11.00 to 6.00, Sun 11.00 to T (02) 9360-9727. E [email protected] 4.00. To Oct 7 STACKS Project Space: Joanne Makas W www.kingstreetgallery.com.au H Tues-Sat 10.00 to will stage an investigation into the convergence 6.00. To Oct 6 An arm and a leg by Jumaadi. Also, between mapping body movements and material Domestique by Myfanwy Gullifer. Oct 9 to Nov 3 forms. Oct 11 to 28 (opening Wed Oct 10, 6-8pm) New paintings and works on paper by Ross Laurie. Intertidal by Carol Hudson – an ecological thematic Also, Lest I forget by Jenny Sages. solo exhibition exploring new materialism, and flattened hierarchies between humans and nature.

Ross Laurie, The Visit, 2018, oil on canvas, 140 x 170cm Courtesy the artist and King Street Gallery on William

Carol Hudson, Intertidal Totems, 2018, porcelain, steel, timber, aluminium, motor, motor speed controller, 12V battery, electrical wires, 200 x 152 x 65cm Courtesy the artist and STACKS Projects

122 Sydney Stanley Street Gallery 1/52-54 Stanley Street, Darlinghurst 2010. Redfern T (02) 9368-1142. E [email protected] W www.stanleystreetgallery.com.au Directors: Merilyn Bailey and Liza Feeney. H Wed-Sat 11.00 to 6.00. To Oct 6 Interfacing by Tom Christophersen and Surry Hills Michael Simms – an explosive, collaborative figurative exhibition between two of Australia’s most exciting emerging visual artists. Green Square

„‘”‹‰‹ƒŽƬƒ ‹ϐ‹ ”– 1/24 Wellington Street, Waterloo 2017. T (02) 9699- 2211. E [email protected] W www.aboriginalpacificart.com.au Director: Gabriella Roy (member of ACGA). H Tues-Sat 11.00 to 5.00. Oct 4 to 27 Myrtle Pennington. In association with Spinifex Arts Project, Tjuntjuntjara, WA. See ad page 121. Artbank, Sydney 222 Young Street, Waterloo 2011. T (02) 9697-6000. E [email protected] W www.artbank.gov.au H Mon-Fri 9.00 to 5.00. To Nov 9 In a World of Wounds an outcome of an outcome of Artbank’s emerging curators program. Christel van der Laan, Brooch Sound of Then 1, 2018, plastics, Curated by Talia Smith. laminate, ceramic, antique pins, plywood, silver, 8.5 x 8.5 x 1.5cm Photograph: Robert Frith Courtesy the artist and Stanley Street Gallery UNSW Galleries UNSW Art & Design, Oxford Street (cnr of Greens Road), Paddington 2021. T (02) 8936-0888. E [email protected] W www.artdesign.unsw.edu.au/unsw-galleries H Tues-Sat 10.00 to 5.00. Sept 28 to Nov 3 John Fries Award 2018 (see ad page 31). Sept 29 to Nov 3 The Freedman Foundation Scholarship or Emerging Artists. Exhibition projects: Beth Dillon, David Eastwood, Chelsea Lehmann and Kynan Tan. Watters Gallery 109 Riley Street, East Sydney 2010. T (02) 9331-2556. E [email protected] W www.wattersgallery.com H Tues and Sat 10.00 to 5.00, Wed-Fri 10.00 to 7.00. To Oct 13 Derek O’Connor: Human Smoke. Also, Euan Macleod: PAPER, and Fiona Fell: From Shadow to Shadow, and Euan Macleod & Gregory O’Brien: Collaborations. From Oct 16 Rew Hanks: linocuts from the Master. From Nov 3 James Rogers: Weld – recent sculpture. Gilgi Edwards, Agula in the Antbed, 2006, synthetic polymer paint on canvas, 123 x 93.5cm Artbank collection, purchased 2008 Yuill/Crowley Courtesy the artist and Artbank Yellow House, 57-59 Macleay Street, Potts Point 2011. T 0418-634-712. E [email protected] W www.yuillcrowley.com H Wed-Fri 11.00 to 6.00, Sat 11.00 to 4.30. Oct 11 to Nov 10 New Works by Robert MacPherson.

Sydney 123 Brett Whiteley Studio Soho Waterloo 2 Raper Street, Surry Hills 2010. T (02) 9225-1881. Waterloo Design Centre, 105/197 Young Street, E [email protected] Waterloo 2017. T (02) 9326-9066 F 9358-2939. W www.brettwhiteley.org Free admission made E [email protected] W www.sohogalleries.net possible by J.P. Morgan. H The Studio is open to H Daily trading, closed public holidays. To Oct 13 the public Fri-Sun 10.00 to 4.00. The Brett Whiteley Towards the Clouds by Marshall Williams, and Studio is managed by the Art Gallery of New South group sculpture. Through Oct Soho Showroom: Wales. group exhibition, paintings sculpture and wall relief. At 10 Help Street Chatswood Foyer: Personal ‡ϐ‹ƒ ‡ ƒŽŽ‡”› Graffiti paintings by Phil Stallard. ArtPark Australia exhibitions visit www.artpark.com.au Artpark at 270 Devonshire Street, Surry Hills 2010. d’Arenberg Winery, Mclaren Vale. T (02) 9557-8483. E [email protected] W www.defiancegallery.com Directors: Campbell Robertson-Swann and Lauren Harvey. H Tues-Fri Stella Downer Fine Art 11.00 to 5.00, Sat-Sun 10.00 to 1.00. To Oct 19 Six 1/24 Wellington Street, Waterloo 2017. Artists | Seven Days: The AWC Newhaven Exhibition T 0402-018-283. E [email protected] – Ann Thompson, Joe Furlonger, Paul Hopmeier, W www.stelladownerfineart.com.au H Tues-Fri 10.00 Kevin Lincoln, Dan Kyle and filmmaker Jason to 5.00, Sat 11.00 to 5.00. Oct 9 to Nov 3 (opening Capobianco. See ad page 34. Sat Oct 13, 3-5pm) Sublime by Trevor Weekes. Flinders Street Gallery 61 Flinders Street, Surry Hills 2010. T (02) 9380- 5663. E [email protected] W www.flindersstreetgallery.com H Wed-Sat 11.00 to 6.00, or by appt. Oct 4 to Dec 8 Halinka Orszulok.

Halinka Orszulok, Random Collaboration, 2016, oil on canvas, 120 x 150cm Courtesy the artist and Flinders Street Gallery MAY SPACE 409b George Street, Waterloo 2017. T (02) 9318-1122. E [email protected] Trevor Weekes, Blunt/Sharp, 2018, acrylic on plywood panel, W www.mayspace.com.au H Tues-Sat 10.00 to 30 x 20cm 5.00. To Oct 20 Julie Brooke, Kevin McKay and Courtesy the artist and Stella Downer Fine Art Claire Anna Watson. Oct 24 to Nov 10 Leslie Oliver and Al Munro. Sullivan+Strumpf 799 Elizabeth Street, Zetland 2017. Michael Reid Sydney T (02) 9698-4696. E [email protected] Standard House, 105 Kippax Street (enter from W www.sullivanstrumpf.com Directors: Ursula Waterloo Street), Surry Hills 2010. T (02) 8353-3500. Sullivan and Joanna Strumpf. H Tues-Sat 10.00 W www.michaelreid.com.au Directors: Michael Reid to 5.00, or by appt. Sept 28 to Oct 20 (opening and Toby Meagher. H Wed-Sat 11.00 to 5.00. Fri Sept 28, 6-8pm) Cargo by Alex Seton. Oct 27 Oct 4 to 31 Regina Pilawuk Wilson. to Nov 17 (opening Sat Oct 27, 3-5pm) Sydney Ball. Sullivan+Strumpf Singapore: Oct 6 to Nov 3 (opening Sat Oct 6, 5-7pm) Tony Clark.

124 Sydney Utopia Art Sydney Art Gallery on Darling 72 Henderson Rd, Alexandria 2015. 307 Darling Street, Balmain 2041. T 0488-400-053, T (02) 9699-2900. E [email protected] 0419-989-011. E [email protected] W www.utopiaartsydney.com.au Director: Christopher W artgalleryondarling.com.au H Mon-Sun 10.00 to Hodges. H Tue-Sat 10.00 to 5.00. Oct 4 to 27 5.00. Oct 29 to Nov 4 Maritsa Micos. (opening Sat Oct 6, 3-5pm) Christopher Hodges: Contact: 0410-578-834, [email protected] Being Human presents paintings that continue See ad page 119. Hodges exploration of geometry and precision in paint. It will be his first exhibition in many years that Artereal Gallery focuses solely on painting. 747 Darling Street, Rozelle 2039. T (02) 9818-7473. E [email protected] W www.artereal.com.au Director: Luisa Catanzaro. H Wed-Sat 11.00 to 5.00. Oct 3 to Nov 3 In Memory Inner West of Water by Shoufay Derz. Articulate project space Marrickville 497 Parramatta Road (opposite Cass Bros), Leichhardt 2040. W articulate497.blogspot.com.au articulateupstairs.blogspot.com.au. H Fri-Sun 11.00 Balmain to 5.00. Oct 6 to 21 (opening Fri Oct 5, 6-8pm) Then and Now by Michele Beevors and Nuha Saad. Oct 27 to Nov 11 (opening Fri Oct 26, 6-8pm) on both AIRspace Projects levels of Articulate: Adrian Hall, Sibylle Hofter and 10 Junction Street, Marrickville 2204. William Seeto. ARTICULATEUpstairs: Oct 6 to 21 T 0438-020-661. E [email protected] (opening Fri Oct 5, 6-8pm) Recycling Memory by Rox W www.airspaceprojects.com.au Directors: Sally De Luca, Michelle Elliot and Laurie Paine. Clarke and Brenda Factor. H Thurs-Fri 11.00 to 6.00, Sat 11.00 to 5.00 first three weeks each month. Annandale Galleries 110 Trafalgar Street, Annandale 2038. T (02) 9552- 1699. E [email protected] W www.annandalegalleries.com.au Directors: Bill Gregory and Anne Gregory (members of ACGA). H Tues-Sat 11.00 to 5.00. Oct 2 to Dec (opening Sat Oct 6, 6.30-8.30pm) Right Into Her Arms drawings, sculpture, automated theatre installation with projections by William Kentridge. Preview: Oct 2 to 6.

William Kentridge, Untitled, (Shadow Figure II), 2016, 5/8, bronze, oil paint, 67 x 40 x 42cm Courtesy the artist and Annandale Galleries

Sydney 125 Artsite Galleries Gallery: Featuring Sunshine Coast glass artists, Sean O’Donoghue and Jonathon Westacott. Gauge Gallery: 165 Salisbury Road, Camperdown 2050. to Oct 7 CURIOUS ART BAR. Oct 9 to 21 Once T (02) 8095-9678. E [email protected] by happenstance paintings and ceramics – Geoff W www.artsite.com.au/whats-on-now.php H Wed- Hargraves, Lyndall McCulloch, Susannah Paterson Sun 11.00 to 5.00 during exhibitions. Oct 6 to 28 and Fiona Smith. Oct 23 to 28 Fred Fink paintings. The Way of the Forest by Kerry Johns. See ad page 126. Kate Owen Gallery Boomalli Aboriginal Artists 680 Darling Street, Rozelle 2039. T (02) 9555-5283. E [email protected] Co-operative W www.kateowengallery.com Member of the 55-59 Flood Street, Leichhardt 2040. Aboriginal Art Association of Australia. H Daily T (02) 9560-2541. E [email protected] 10.00 to 6.00. Kate Owen Gallery is a multiple W www.boomalli.com.au award-winning gallery specialising in contemporary www.facebook.com/boomalligallery, Aboriginal art. Artworks range from small affordable www.instagram.com/boomalliartgallery H Wed-Sun works to large investment pieces. Three light-filled 11.00 to 4.00. To Oct 21 Healing Our People, floors showcase major exhibitions of Indigenous Healing Our Land Exhibition. As Aboriginal people masters, established artists and new talent. The we naturally care for our mob and homelands. This ground breaking Collectors’ Gallery is dedicated exhibition is about the healing of our people and to museum-quality works from Australia’s leading healing of our country. Indigenous artists. Oct 13 to Nov 10 Desert Legend by Tommy Watson – a celebration of life and ‡ϐ‹ƒ ‡ ƒŽŽ‡”› tjukurrpa, this curation of masterpieces and museum 47 Enmore Road, Newtown 2042. quality works, including many previously unexhibited T (02) 9557-8483. E [email protected] works, showcases the soaring talent of this recently W www.defiancegallery.com Directors: Campbell deceased desert master. Never before have so many Robertson-Swann and Lauren Harvey. H Wed-Sat of Watson’s major, seminal works been exhibited 11.00 to 5.00. To Oct 11 Group Exhibition – Peter in one space. Artworks include the groundbreaking Godwin, Clara Hali, Roy Jackson, Kevin Norton, Ann 2013 piece featured in The Australian newspaper and Thomson, Peter Powditch and Joe Furlonger. many more. See ad page 127. Factory 49 49 Shepherd Street, Marrickville 2204. T (02) 9572-9863. E [email protected] W factory49.blogspot.com H Thurs-Sat 1.00 to 6.00. To Oct 6 Max Lawrence White. Oct 10 to 20 Nicola McClelland. Oct 24 to Nov 10 Sandra Curry. Glass Artists’ Gallery (upstairs) Gauge Gallery (street level) Tommy Watson, My Country, 183 x 244cm 68 Glebe Point Road, Glebe 2037. T/F (02) 9552- Courtesy the artist and Kate Owen Gallery 1552. E [email protected] W www.glassartistsgallery.com.au www.gaugegallery.com.au. H Tues-Sat 10.00 to 5.30, Sun 1.00 to 5.00. Oct 9 to 21 Glass Artists’

KERRY JOHNS THE WAY OF THE FOREST 6 - 28 October

126 Sydney tommy watson desert legend

‘Ngayuku Ngura (My Country)’ by Tommy Watson (152 x 244 cm) 13 october - 10 november celebrating country and culture featuring previously unseen masterpieces from the desert legend

www.kateowengallery.com free fully insured worldwide delivery (rolled)

kate owen gallery 680 darling street rozelle nsw 2039 (02) 9555 5283 open 7 days 10-6 [email protected] Kerrie Lowe Gallery Grace Cossington Smith Gallery 49-51 King Street, Newtown 2042. T (02) 9550- Gate 7, 1666 Pacific Highway, Wahroonga 2076. 4433 F 9550-1996. E [email protected] T (02) 9473-7878. W www.gcsgallery.com.au W kerrielowe.com H Mon-Sat 10.00 to 5.30, Thurs facebook.com/gcsgallery Free entry. H Mon-Fri 10.00 10.00 to 7.00, Sun 12.00 to 4.00. To Oct 16 Form to 5.00, Sat 9.00 to 4.00. Oct 6 to 27 (opening / Surface / Structure – an exhibition of ceramic Sat Oct 6, 2-4pm) LIFEBLOOD – Square1 @ GCS sculpture. Oct 19 to Nov 16 Table Talk: tableware by Gallery. A group show presenting a snapshot of Australian ceramicists. the creative community of Square One Studios, Alexandria. Finissage: Sat Oct 27, 2-4pm. McGlade Gallery at the Australian Catholic University Mount St. Mary, Gate 3, 25a Barker Road, Strathfield 2135. T (02) 9701-4256. W www.acu.edu.au H Mon-Sat 11.00 to 4.00 during exhibition periods. SCA Galleries Sydney College of the Arts Balmain Road (enter opposite Cecily Street), Rozelle 2040. T (02) 9351-1008. E [email protected] W sydney.edu.au/sca Free admission. H Mon-Fri 11.00 to 5.00, Sat 11.00 to 4.00 (during exhibitions). Oct 4 to Nov 3 (opening and winner announcement Wed Oct 3, Bob Newman, Sq1 studios@GCS Gallery 6-8pm) Fauvette Loureiro Memorial Artists Travel Courtesy Grace Cossington Smith Gallery Scholarship. The 2018 finalists are Ciaran Begley, Penelope Cain, Eugene Choi, Kalanjay Dhir and Kate Harvey Galleries Scardifield. Mosman 842 Military Road, Mosman 2088. T (02) 9968- The Shop Gallery 2153. E [email protected] 112 Glebe Point Road, Glebe 2037. T 0438-550- W www.harveygalleries.com.au H Tues-Sat 11.00 835. E [email protected] to 6.00, Sun 12.00 to 5.00. Select key works from W www.theshopgalleryglebe.com Visit website for important artists. exhibition program. Harvey Galleries Yellow Dot Art Gallery Seaforth Shop 3-4, 654-670 King Street, Newtown 2042. 515 Sydney Road, Seaforth 2092. T 0413-319-293. E [email protected] T (02) 9907-0595, 0408-359-199. F 9907-0657. W yellowdotartgallery.com Director: Yvette Linton- E [email protected] Smith. H Wed-Sun 10.00 to 5.00. W www.harveygalleries.com.au H Wed-Sat 11.00 to 6.00, Sun 12.00 to 5.00. Curated monthly exhibitions, see website. Nth Sydney Headland Artists and Sculpture Park Read Place, Headland Park at Georges Heights Northern entrance off Middle Head Road (opposite Cobittee Street), Mosman 2088. T 0409-653-222. Beaches E [email protected] W www.headlandartists.com In beautiful Headland Park 20+ artists working and selling from their Artarmon Galleries studios, three art schools, art restoration and 479 Pacific Highway, Artarmon 2064. Frenchy’s Cafe. T (02) 9427-0322. W www.artarmongalleries.com.au H Mon-Fri 10.00 to 5.00, Sat 11.00 to 3.00. Oct 8 to 31 (opening Sat Oct 13, 2-4pm with the artist) Clem Millward: 70 years behind the Easel 1948-2018 paintings and drawings. Opening invitation extended to all our clients (and also all past students of Clem) to celebrate Millward’s launch of his exhibition of 50 paintings.

128 Sydney PROJECT GALLERY 90 Artist run concept space

Future exhibitions: Linda Sherman: October 11th - 24th Group show: October 25th - November 7th

90 Oxford St Paddington

For more information please visit: www.projectgallery90.com @project_gallery90

Sydney 129 Manly Art Gallery & Museum West Esplanade Reserve, Manly 2095. T (02) 9976- 1421. E [email protected] W www.magam.com.au Free entry. H Tues-Sun 10.00 to 5.00. To Oct 14 Octennial: Reg Mombassa & Peter O’Doherty – the celebrated art of Reg and Pete returns to Manly Art Gallery & Museum including recent and early works featuring Mombassa’s iconic ‘allegorical landscapes’ and O’Doherty’s studies of deceptively mundane domestic and suburban Australian scenes. Oct 19 to Dec 2 Against The Tide: Robert Dickerson – important works from private collections will bring one of Australia’s greatest figurative artists into the spotlight and provide a special opportunity for Manly Art Gallery & Museum audiences. Large-scale paintings feature, along with Dickerson’s acclaimed and evocative drawings from a career spanning more than 70 years. Also, Impart – recent works by the ceramics teachers at the TAFE NSW, Northern Beaches and Hornsby Robert Dickerson, The Bodysurfers, 1994, acrylic on canvas, campuses in recognition of the vital contribution art 152 x 152cm education makes to our local communities and to the Courtesy the estate of the artist and Manly Art Gallery & Museum broader cultural landscape. It also acknowledges their parallel and connected roles as both practising artists Mosman Art Gallery and teachers. Oct 19 to March 17, 2019 Natural 1 Art Gallery Way, Mosman 2088. Collection – prints from the pages of the collaborative T (02) 9978-4178. E [email protected] artists’ book, Natural Collection, featuring the work W www.mosmanartgallery.org.au Director: John of 29 Warringah Printmakers Studio artists. Each Cheeseman. Free entry. H Daily 10.00 to 5.00, work presents an artist’s view of the endangered closed public hols. To Nov 18 Mosman Art Prize and vulnerable wildlife and habitats of the Northern 2018 – an annual acquisitive prize for painting, and Beaches region of Sydney, NSW. Dr Jennifer Anson the oldest and most prestigious local government art from the Australian Wildlife Conservancy collaborates award in Australia. The 2018 Prize will be judged with the artists on this project. by artist and former Prize winner Cressida Campbell. To Dec 2 Catriona Pollard: Exhalation of the Trees – fibre artist Catriona Pollard explores our connection and disconnection with nature by shape-shifting natural forms, from unnoticed branches, leaves and seedpods into shapes that celebrate the abundance of nature.

Walter Auer, Conversations in blue, clay, terra sigillata, stains, 20 x 30 x 25cm Courtesy the artist and Manly Art Gallery & Museum

Catriona Pollard, Atlantis, 2018, cocos palm sheath, bangalow palm inflorescence and copper, 155 x 22 x 6cm Courtesy the artist and Mosman Art Gallery

130 Sydney Mu Studio Gallery buildings and landscapes of the area where she has resided for her whole life. With the changes to Headland Park Artist Precinct, 8 Read Place (cnr the local urban, rural and social environments that Middle Head Road), Mosman 2088. Hornsby Shire is currently experiencing, the exhibition T (02) 9960-1777. E [email protected] provides an opportunity to pause, remember and W www.studiomu.com.au H Tues-Sat 10.00 to 4.00. appreciate. Artist talk: Sun Nov 4, 2-3pm, in the Oct 13 to 20 The Spring Table by Katherine Mahoney. Veranda Gallery. Both events are free. Visit fota.com. au to register attendance, and for more information. PROJECT [504] Presented as part of the 2018 Festival of the Arts. 65 Berry Street, North Sydney 2060. T 0450-468- 387. E [email protected] W www.project504.com.au H Mon-Fri 12.00 to 4.30. Sydney Road Gallery Shop 2, 561-563 Sydney Road, Seaforth 2092. T 0404-996-739. E [email protected] W www.sydneyroadgallery.com H Thurs-Sun 10.00 to 4.00. Sydney Road Gallery is a commercial art gallery that is co-run by practising artists and changes exhibitions every four weeks. Sept 27 to Oct 21 (opening Sat Sept 29, 1-4pm) Surfacing by Catriona Pollard.

Lyndall Beck, Little boxes Courtesy the artist and Wallarobba Arts and Cultural Centre Paddington Woollahra Catriona Pollard, Lunar Dance, 2018, wonga wonga vine, jacaranda stalks, charcoal, 108 x 175 x 15cm Annette Larkin Fine Art Courtesy the artist and Sydney Road Gallery Suite 4, 8 Soudan Lane, Paddington 2021. T (02) 9332-4614. E [email protected] Wallarobba Arts W www.annettelarkin.com Director: Annette Larkin. and Cultural Centre H Wed-Fri 11.00 to 5.00, Sat 12.00 to 5.00, or by 25 Edgeworth David Avenue, Hornsby 2077. appt. Deals in post-war and contemporary art and T (02) 9847-6893. H Daily 10.00 to 4.00. Oct 17 to provides tailored advice in all aspects of purchasing, 28 Hornsby Art Prize Finalists’ Exhibition – celebrate valuing and collection management. To Oct 13 A the best local and national visual arts at the ninth Private Collection works by Imants Tillers, Robert annual Hornsby Art Prize Finalists’ Exhibition. Artists Macpherson and Robert Hunter. Oct 18 to Nov 17 submitted entries across five categories, including, Poetically Microscopic by Robert Klippel – sculpture Painting, Printmaking, Drawing, 3D works or Digital and works on paper from the 1980s (see ad page 3). Art – Stills. The exhibition is simultaneously hosted at two venues, Wallarobba Arts and Cultural Centre Art Atrium and Hornsby Library, and is presented as part of 181 Old South Head Road, Bondi Junction 2022. the 2018 Festival of the Arts. Visit fota.com.au Oct T 0411-138-308. E [email protected] 30 to Nov 4 (opening Fri Nov 2, 6.30-8.30pm) W www.artatrium.com.au Director: Simon Chan. Of memory and change… an exhibition by the H Wed-Fri 12.00 to 6.00, Sat 12.00 to 4.00, or by 2017 Wallarobba outstanding local artist, Lyndall appt. Oct 10 to 27 (opening Wed Oct 10 with the artist) Beck. Join artist Lyndall Beck on a journey through Paul Connor. Art Atrium in association with Live in Art: time and place, memory and change in Hornsby 515 Crown Street, Surry Hills. Oct 17 to Nov 3 (opening Shire, in northern Sydney. Through the mediums of Sat Oct 20 with the artist) Clinton Nain. Oct 29 to Nov painting, printmaking, sculpture and screen, Beck 11 (opening Tues Oct 30 with the artist) Sophie Dunlop has recollected and documented the people, spaces, at Live in Art: 515 Crown Street, Surry Hills.

Sydney 131 Australian Galleries ‡ϐ‹ƒ ‡ ƒŽŽ‡”›ƒ–ƒ”›Žƒ ‡ 15 Roylston Street, Paddington 2021. 12 Mary Place, Paddington 2021. T (02) 9360-5177 F 9360-2361. T (02) 9557-8483. W www.defiancegallery.com E [email protected] Directors: Campbell Robertson-Swann & Lauren W www.australiangalleries.com.au Director: Stuart Harvey. H Wed-Sun 11.00 to 5.00. To Oct 20 Group Purves AM. H Daily 10.00 to 6.00. Oct 3 to 21 Exhibition – Peter Godwin, Clara Hali, Roy Jackson, Painted from My Life by William Robinson. Kevin Norton, Ann Thomson, Peter Powditch and Joe Furlonger. Oct 26 to Nov 17 Here Now by Dedy BAROMETER Gallery Sufriadi and Indra Dodi. Presented by The Nock Art Foundation. 13 Gurner Street, Paddington 2021. T (02) 9358-4968. E [email protected] W www.barometer.net.au H Wed-Sat 12.00 to 5.00. Fellia Melas Gallery Oct 3 to 20 Shells – Kathleen Berney, Liz Gemmell, 2 Moncur Street, Woollahra 2025. T (02) 9363-5616. Beth Hatton, Irene Manion and Barbara Rogers. E [email protected] W www.fmelasgallery.com.au Blender Gallery H Mon-Sat 10.00 to 5.00, Sun 11.00 to 5.00. From Oct 20 Brett Whiteley – Works on Paper. 16 Elizabeth Street, Paddington 2021. T (02) 9380-7080. E [email protected] W blender.com.au www.facebook.com/BlenderGallery H Wed-Sat 11.00 to 5.00, Tues by appt.

Brett Whiteley, Lipstick, 1981, edition 50 plus APs, colour lithograph, collage and nail polish, 107 x 76cm Courtesy the artist and Fellia Melas Gallery Fox Jensen Gallery Cnr Hampden Street & Cecil Lane, 23a Roylston Street, Paddington 2021. T (02) 8084-4298. E [email protected] W www.jensengallery.com H Wed-Sat 12.00 to 5.00.

132 Sydney 8 SEPTEMBER - 4 NOVEMBER 2018 THE 1818 PROJECT ABDUL-RAHMAN ABDULLAH BRINGS TOGETHER SHAN TURNER-CARROLL EIGHT CONTEMPORARY DALE COLLIER LOCAL AND NATIONAL KARLA DICKENS ARTISTS TO ADDRESS FERNANDO DO CAMPO PERSONAL CULTURAL LINDY LEE HISTORIES AND STORIES OF YHONNIE SCARCE AUSTRALIAN MIGRATION JACQUI STOCKDALE

NEWCASTLE ART GALLERY Newcastle Art Gallery is supported by: 1 Laman Street Newcastle Open Tuesday to Sunday 10am - 5pm & every day during school holidays nag.org.au | | Subscribe to enews: nag.org.au/enews

Image: The 1818 PROJECT featuring Joseph LYCETT Inner View of Newcastle c1818 oil on canvas 61.0 x 91.4cm Purchased 1961 with assistance from the National Art Collections Fund, London, UK Newcastle Art Gallery collection Martin Browne Contemporary Olsen Gallery 15 Hampden Street, Paddington 2021. 63 Jersey Road, Woollahra 2025. T (02) 9327-3922. T (02) 9331-7997. E [email protected] W www.olsengallery.com E [email protected] H Tues-Fri 10.00 to 6.00, Sat 10.00 to 5.00, Sun W www.martinbrownecontemporary.com Director: 11.00 to 5.00. To Oct 7 Stephen Bird, and James Martin Browne (member of ACGA). H Tues-Sun McGrath. Oct 10 to 28 Chris Langlois. Olsen 10.30 to 6.00. To Oct 14 Impromptu by A J Taylor. Annexe: at 74 Queen Street, Woollahra 2025. Also, New Ground by Ildiko Kovacs. Oct 18 to Nov T (02) 9327-3922. H Tues-Sun 11.00 to 5.00. 11 The Ties that bind by Fiona Lowry. Oct 20 to Nov 11 Claudia Damichi. Project Gallery 90 90 Oxford Street, Paddington 2021. T 0402-144-350. E [email protected] W www.projectgallery90.com Artist-run concept space. To Oct 10 Peter Berner. Oct 11 to 24 Linda Sherman. Oct 27 to Nov 7 Group Show. See ad page 129. Roslyn Oxley9 Gallery 8 Soudan Lane (off Hampden Street), Paddington 2021. T (02) 9331-1919. E [email protected] W www.roslynoxley9.com.au Director: Roslyn Oxley (member of ACGA). H Tues-Fri 10.00 to 6.00, Sat 11.00 to 6.00. To Oct 13 Michael Parekowhai. Oct 25 to Nov 17 (opening Thurs Oct 25, 6-8pm) Marley Dawson, and Daniel Boyd. Sabbia Gallery 120 Glenmore Road, Paddington 2021. T (02) 9361-6448. E [email protected] W www.sabbiagallery.com Directors: Anna Grigson and Maria Grimaldi. H Tues-Fri 11.00 to 6.00, Sat 11.00 to 4.00. Oct 10 to Nov 3 Main Gallery: Received Landscapes new works in glass by Brenden Scott French. Gallery Two: Inflorescence new works in ceramic by Cathy Franzi. Ildiko Kovacs, Sunrise, 2018, oil paint and graphite on plywood, 90 x 60cm Courtesy the artist and Martin Browne Contemporary Saint Cloche 37 MacDonald Street, Paddington 2021. Maunsell Wickes Gallery E [email protected] W www.saintcloche.com Director: Kitty Wong. H Wed-Sat 10.00 to 5.00, Sun 19 Glenmore Road, Paddington 2021. T (02) 9331- 11.00 to 4.00, Mon-Tues by appt. Visit website for 4676 F 9380-8485. E [email protected] exhibition program. W www.maunsellwickes.com H Tues-Sat 11.00 to 5.30, Sun 12.00 to 5.00. Oct 2 to 14 Ceramics. Oct 12 to 14 Roger Beale at Wombat Hollow Forum. Oct 16 to 28 Birds.

134 Sydney

Thienny Lee Gallery 176 New South Head Road (opp Edgecliff Train Eastern Station), Edgecliff 2027. T (02) 8057-1769. E [email protected] W www.thiennyleegallery.com H Tues-Fri 10.00 to Suburbs 4.00, Sat 11.00 to 4.00. Sept 27 to Oct 16 Everyday Mix-Ups by Joanna Gambotto. Oct 18 to Nov 1 Sculpture by the Sea: Storyfeast by Josh Butler. Also, Elgas Kids Art Prize entries now open, closing Sun Oct 21. Bondi 2018 Online submission and details at W www.sculpturebythesea.com Oct 18 to Nov 4 thiennyleegallery.com/elgas-kids-art-prize The 22nd annual Sculpture by the Sea exhibition presents over 100 sculptures from across the world, along the 2km Bondi to Tamarama Beach coastal walk. A free public event. See ad page 62. The Woollahra Small Sculpture Prize Woollahra Council Chambers 536 New South Head Road, Double Bay 2028. T (02) 9391-7000. W sculptureprize.woollahra.nsw.gov.au Oct 20 to Nov 11 The Woollahra Small Sculpture Prize 2018 finalist exhibition. Includes artist talks and workshops. Visit website for full program. Mon-Fri 9-5pm, Sat-Sun 10-4pm. See ad page 35. Greater Sydney Blacktown Arts Centre 78 Flushcombe Road, Blacktown 2148. T (02) 9839-6558. E [email protected] W www.blacktownaustralia.com.au/3057/blacktown- arts-centre H Tues-Sat 10.00 to 5.00, closed public hols. Bundeena Maianbar Art Trail

Josh Butler, Flourish (detail), coloured pencil and string on paper, Royal National Park 100 x 60cm W www.arttrail.com.au H 10.00 to 4.00 – 1st Sun Courtesy the artist and Thienny Lee Gallery every month. A collective of over 20 artists who open their studios to the public. Wagner Contemporary 2 Hampden Street, Paddington 2021. T (02) 9360-6069, 0419-251-013. E [email protected] W www.wagnercontemporary.com.au H Tues-Sun 10.30 to 6.00, Mon by appt. Oct 13 to Nov 6 Dagmar Cyrulla: I Am. Dagmar Cyrulla explores what is to be human – the home rituals, the myriad of choices made, and the moments had, incorporating a particular focus on the complex relationship women have with the virtual world.

136 Sydney Campbelltown Arts Centre Hurstville Museum and Gallery 1 Art Gallery Road, Campbelltown 2560. 14 MacMahon Street, Hurstville T (02) 9330-6444. T (02) 4645-4100. E [email protected] E [email protected] W www.georgesriver.nsw.gov.au/HMG W www.c-a-c.com.au Free entry. H Daily 10.00 H Tues-Sat 10.00 to 4.00, Sun 2.00 to 5.00. to 4.00. To Oct 14 We are all connected to Campbelltown (one way or another), and Australian Macquarie University Artist of the 80s. Art Gallery Building E11A, Eastern Road, North Ryde 2109. Casula Powerhouse Arts Centre T (02) 9850-7437. E [email protected] A cultural facility of W www.artgallery.mq.edu.au Senior Curator: Rhonda Liverpool City Council Davis. H Tues-Fri 10.00 to 5.00. 1 Powerhouse Road, Casula 2170 (access via Shepherd Street, Liverpool). T (02) 9824-1121. Margaret Whitlam Galleries, E [email protected] Female Orphan School W www.casulapowerhouse.com Free entry. Ample parking available or alight at Casula Train Station. Western Sydney University H Mon-Fri 9.00 to 5.00, Sat-Sun 9.00 to 4.30, (Parramatta) closed public hols. To Oct 21 Soft Centre exhibition. First Level, West Wing, EZ Building, Parramatta Oct 6 to Nov 11 Landless Bodies. Also, Oceania Campus, cnr of James Ruse Drive and Victoria Road, Rising: Wayfinders. Oct 27 to Nov 18 Bravery Rydalmere 2116. T (02) 9685-9210. Unmasked. W virtualtours.westernsydney.edu.au/home H Thurs-Fri 10.00 to 4.00. Parking $9 per day. Hazelhurst Regional Gallery To Oct 26 Promiscuous Provenance by Anna Glynn – using a range of different media, the artist re- & Arts Centre examines our relationship with our colonial past. 782 Kingsway, Gymea 2227. T (02) 8536-5700 A travelling exhibition from Shoalhaven Regional F 8536-5750. E [email protected] Gallery, presented by Whitlam Institute. W www.hazelhurst.com.au Free admission. H Daily 10.00 to 5.00, closed Christmas Day, Boxing Day, New Year’s Day and Good Friday. To Oct 21 Margot Hardy Gallery Alexander McKenzie: The adventurous gardener. Western Sydney University The first major solo exhibition for artist Alexander (Bankstown) McKenzie, known for his evocative luminous Foyer, Building 23, Bankstown Campus, Bullecourt landscape paintings. Nov 10 to Jan 29, 2019 Avenue, Milperra 2214. T (02) 4620-3450. Weapons for the Soldier – a major exhibition that W virtualtours.westernsydney.edu.au/home brings together both Indigenous and non-Indigenous H Mon-Fri 9.00 to 5.00. Parking $7 per day. Oct 10 artists as they explore their connection to protecting to Nov 9 Circuit Breaker – a collection of artworks land and country. See ad page 20. made by the residents of Odyssey House NSW, an adult residential drug and alcohol rehabilitation program located in south-western Sydney. Parramatta Artists Studios Level 1 & 2, 68 Macquarie Street, Parramatta 2150. T (02) 9687-6090. E [email protected] W www.parramattastudios.com.au H Open during events and by appt.

Alexander McKenzie, More than many sparrows, 2018, oil on linen, 197 x 350cm Fitzgerald collection Photograph: Jenni Carter Courtesy the artist, Martin Browne Contemporary, Sydney, and Hazelhurst Regional Gallery & Arts Centre

Sydney 137 Peacock Gallery Penrith Regional Gallery and Auburn Arts Studio & The Lewers Bequest Auburn Botanic Gardens, cnr Chisholm and Chiswick 86 River Road, Emu Plains 2750. T (02) 4735-1100. streets, Auburn 2144. T (02) 8745-9794. W www.penrithregionalgallery.org Free entry. H Daily E [email protected] 9.00 to 5.00. Visit website for exhibitions. To Nov W cumberland.nsw.gov.au/arts H Tues-Sun 11.00 to 11 Justene Williams: The Curtain Breathed Deeply. 4.00. To Oct 21, 4A Curators’ Intensive X Peacock Also, Leonora Howlett: from the Head and the Heart, Gallery. As part of the 2018 Curators’ Intensive and Samuel Quinteros. presented by 4A Centre for Contemporary Asian Art, two emerging curators have been selected to curate an exhibition at Peacock Gallery. Tongues – Yeliz Yorulmaz, Kai Wasikowski and Eugene Choi respond to the theme of identity through language, reflecting particularly on how their exposure to linguistic diversity has influenced them, and in addition, how their art practice fits into this layered understanding and correspondence. Curated by Isabel Rouch. Also, Chapter One: Thinking through it is a project that exists as a reading room, research space and open studio. Hannah Donnelly, Thea Jones, Shivanjani Lal, Nikki Lam, Anja Loughhead, Stephen Pham and Jason Phu work with different materials and methods to craft works that explore place in relation to the self. Curated by Sabrina Baker. Justene Williams, The Joy of Life After Matisse/Madonna/Marcel (video still), 2014 Courtesy the artist, Sarah Cottier Gallery, Sydney, and Penrith Regional Gallery & The Lewers Bequest Western Sydney University Art Gallery (Penrith, Werrington North) AD Building, Penrith (Werrington North) Campus, Great Western Highway, Werrington 2747. T (02) 4620-3450. W virtualtours.westernsydney. edu.au/home H Mon-Fri 9.00 to 5.00. Parking $7 per day. Oct 15 to Jan 18, 2019 Mind the Gap – Tending the Interface of Art & Therapy featuring works by Andrew Brombley, Catherine Camden-Pratt, Johanna Davies, Kate Deacock, Mandy Evans, Elizabeth Fitzgerald, Joanna Jaaniste, Anita Lever, Joy Paton, Suzanne Perry, Martin Roberts, Sheridan Linnell and Sarah Versitano.

Yeliz Yorulmaz, That’s Not What I Thought, 2017, cardboard, papier-mâché, steel, cement, paint, household items, 190 x 163 x 46cm Courtesy the artist and Peacock Gallery and Auburn Arts Studio

138 Sydney

New South Wales

140 Lake Macquarie City Art Gallery Newcastle First Street, Booragul 2284. T (02) 4921-0382 F (02) 4921 0329. E [email protected] W artgallery.lakemac.com.au Free entry. H Tues-Sun 10.00 to 4.30. Sept 29 to Dec 2 STEEL: art design Central Coast architecture – explores the most innovative ways that steel is being used by artists, designers and architects Cessnock Regional Art Gallery in Australia in the 21st century. A JamFactory touring exhibition. Also, Your Collection: Hunter Steel 16 Vincent Street, Cessnock 2325. photographs by Charles Collin from the gallery’s T (02) 4991-6619. E [email protected] W crag.net.au permanent collection. A gallery project curated by H Tues-Sun 10.00 to 4.00. To Oct 28 Retroactive Rob Cleworth. Oct 6 to Dec 2 Artist Focus: Matthew by James Whitington – works from 1988-2018 Tome. A gallery project curated by Rob Cleworth in including etchings, monotype, sculpture and consultation with the artist. paintings. See ad page 13. Finite Gallery 60 Caves Beach Road, Caves Beach 2281. T 0419-471-660. E [email protected] W finitegallery.com H Fri-Sun and public hols 10.00 to 4.00. Oct 5 to 28 (opening Sat Oct 6, 2-4pm) Found Horizons – Painters Ink. Gallery 139 139A Beaumont Street, Hamilton 2303. T 0434-886-450. W www.gallery139.com.au H Thurs-Sat 11.00 to 4.00, Sun 11.00 to 2.00. Oct 11 to 21 Peter Lankas. Oct 25 to Nov 4 Paul Maher.

Matthew Tome, Smells Like Green, 2017, oil on canvas, 71 x 71cm © the artist Courtesy the artist and Lake Macquarie City Art Gallery The Lock Up 90 Hunter Street, Newcastle 2300. T (02) 4925-2265. W www.thelockup.org.au H Wed-Sat 10.00 to 4.00, Sun 11.00 to 3.00. To Oct 14 Full Circle – Presented by Critical Animals As Part Of Tina. Maitland Regional Art Gallery (MRAG) 230 High Street, Maitland 2320. T (02) 4934-9859 F 4933-1657. E [email protected] W www.mrag.org.au Cultural Director Brigette Uren. H Tues-Sun 10.00 to 5.00. Newcastle Art Gallery (NAG) Peter Lankas, night comfort, oil on board, 50 x 40cm Courtesy the artist and Gallery 139 1 Laman Street, Newcastle 2300. T (02) 4974-5100. E [email protected] W www.nag.org.au Gallery Director: Lauretta Morton. H Tues-Sun 10.00 Gosford Regional Gallery to 5.00, seven days during school hols. To Oct 21 36 Webb Street, East Gosford 2250. Kilgour Prize 2018. To Nov 4 The 1818 Project. T (02) 4304-7550. E [email protected] See ad page 133. W www.gosfordregionalgallery.com Free entry. H Daily 10.00 to 4.00. To Nov 18 Gosford Art Prize.

New South Wales 141 The University Gallery and Senta Taft-Hendry Museum of Oceanic Art University of Newcastle, University Drive, Callaghan 2308. T (02) 4921-5255. E [email protected] W www.newcastle.edu.au/universitygallery H Wed-Fri 10.00 to 5.00, Sat 12.00 to 4.00. To Nov 11 Long Shadows: Australia, The Great War and the Middle East. Watt Space Northumberland House, cnr King and Auckland streets, Newcastle 2300. T Office (02) 4921-5188. Kenji Uranishi, Momentary (installation view), 2015 Gallery 4921-8733. E [email protected] Photograph: Carl Warner W www.newcastle.edu.au/community-and-alumni/ Courtesy the artist and Coffs Harbour Regional Gallery arts-and-culture/watt-space-gallery H Wed-Sun 11.00 to 5.00. Oct 3 to 14 (opening Thurs Oct 4, 6.30-8.30pm) Exhibitions by Students of UoN; The Grafton Regional Gallery Rova Project by Sally Cloke, Body and Light by 158 Fitzroy Street, Grafton 2460. T (02) 6642-3177. Harsimjeet Brar, Colour my world by Vanessa Lewis, E [email protected] and Australiana by Siarn Staley. Oct 17 to Nov 4 W www.graftongallery.nsw.gov.au H Daily 10.00 (opening Thurs Oct 18, 6pm) Town Camps of Alice to 4.00. Prentice House 9.00 to 5.00. Public hols Springs – exhibition by Students of UoN School of may differ. Grafton Regional Gallery is home of the Architecture and Built Environment. Jacaranda Acquisitive Drawing Award (JADA) with a total prize of $40,000. The award is now in it’s 30th year. To Oct 21 Liz Slater: Undergrowth – ‘The inspiration to create has led me in search of a beauty that exists primarily in my every day experience Northern be it the broader location of the Lower Clarence or the immediacy of my surrounds at home’. Also, Rivers TRACEY MOFFATT: MAMA Collection. Moffatt is one of Australia’s most successful international artists, known for her film, photography and video works. Bank Art Museum Moree Drawing on cinema, television and the media, her art 25 Frome Street, Moree 2400. T (02) 6757-3320. is equally inspired by popular culture, recollections W www.bamm.org.au H Mon-Fri 10.00 to 5.00, Sat from her childhood and art history. Also Dave 10.00 to 1.00. Oct 5 to Nov 17 People Like Us. Sparkes: Luminosity. Coffs Harbour Regional Gallery Cnr Coff and Duke streets, Coffs Harbour 2450. T (02) 6648-4863. E [email protected] W www.coffsharbour.nsw.gov.au/gallery Free entry. H Tues-Sat 10.00 to 4.00. To Nov 10 Clay Intersections – this exhibition highlights the work of eight contemporary makers selected for their diverse approaches to their ceramic practice: Kenji Uranishi, Tania Rollond, Bridget Bodenham, Helen Earl, Ulrica Trulsson, Natalie Rosin and Cone 11’s Colin Hopkins & Ilona Topolcsanyi. Clay Intersections is an ADC on Tour national touring exhibition, first presented by Australian Design Centre in 2016. Curated by Gallery Co-ordinator Cath Fogarty. Liz Slater, Mossy Outlook, 2017, pastel on paper, 75 x 90cm Courtesy the artist and Grafton Regional Gallery

142 New South Wales Lismore Regional Art Gallery 11 Rural Street, Lismore 2480. T (02) 6627-4600. South Coast E [email protected] W www.lismoregallery.org Free entry. H Tues, Wed, Fri, Sat and Sun 10.00 to 4.00, Thurs 10.00 to Bega Valley Regional Gallery 6.00. To Oct 14 Far to Go by Victoria Pitel. Zingel Place, Bega 2550. T (02) 6499-2202. To Nov 25 Gallery 2 and 3: Heart & Soul by Jacklyn E [email protected] Wagner and Peter Derrett. Oct 20 to Nov 25 Gallery W gallery.begavalley.nsw.gov.au 5: Meander – Place And Experience by Matt O’Brien. facebook.com/begavalleyregionalgallery. H Mon-Sat 10.00 to 4.00. To Oct 20 South/East Interference Manning Regional Art Gallery Vol. l sculpture and installation by Rosie Deacon. Oct 26 to Dec 8 Shirley Hannan National Portrait Award 12 Macquarie Street, Taree 2430. T (02) 6592-5455. – as one of Australia’s most loved and richest portrait E [email protected] awards, the biennial Shirley Hannan National Portrait W mrag.midcoast.nsw.gov.au H Wed-Sat 10.00 to Award, offering a $50,000 prize, celebrates realistic 4.00, Sun 1.00 to 4.00. Oct 4 to Nov 25 Cohesive portraiture in memory of our eponymous patron. by Yvette & Peter Hugill. Also, Terror Australis by Jane Hosking. Muswellbrook Regional Arts Centre Cnr Bridge and William streets, Muswellbrook 2333. T (02) 6549-3800. E [email protected] W www.muswellbrook.nsw.gov.au/index.php/mrac- home H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 1.00, Mon by appt. To Oct 21 The Locals – 60 Years Collecting Upper Hunter. Also, Miniatures. Oct 28 to Dec 23 Muswellbrook Local Art Awards 2018. Rosie Deacon in one of her installations Retrospect Galleries Courtesy the artist and Bega Valley Regional Gallery 52 Jonson Street, Byron Bay 2481. T (02) 6680-8825. E [email protected] Duck Print Fine Art W www.retrospectgalleries.com H Daily 9.30 to 5.30. 39-41 Wentworth Street, Port Kembla 2505. Cutting-edge collectable art from established and T (02) 4276-1135. W www.duckprintfineart.com.au emerging Australian artists and designers. Prints for sale, workshops available, custom printing + editions. Jervis Bay Maritime Museum Southern & Gallery Woollamia Road, Huskisson 2540. T (02) 4441- Highlands 5675. W www.jervisbaymaritimemuseum.com.au H Daily 10.00 to 4.00. To Nov 25 Report from the Littoral Zone paintings, sculpture, video and Sturt Gallery & Studios installation by Kurt Brereton. www.kurtbrereton.com Cnr Range Road and Waverley Parade, Mittagong 2575. T (02) 4860-2083. E [email protected] W www.sturt.nsw.edu.au H Daily 10.00 to 5.00. Sturt was established in 1941 and is a nationally significant and award winning centre for the teaching, sale, production and exhibition of contemporary Australian craft and design.

New South Wales 143 Wollongong Art Gallery Cnr Kembla and Burelli streets, Wollongong 2520. Blue T (02) 4227-8500 F 4226-5530. E [email protected] W www.wollongongartgallery.com H Tues-Fri 10.00 Mountains to 5.00, Sat-Sun 12.00 to 4.00, closed Mon and public hols. To Oct 28 The Collectors – the Blue Mountains City Art Gallery gallery’s collection owes much to the philanthropy of 30 Parke Street, Katoomba 2780. T (02) 4780-5410. benefactors whose donations and gifts have helped E [email protected] shape and give it form. This exhibition pays tribute W www.bluemountainsculturalcentre.com.au to their generosity and the important contribution Adults $5/Conc. $3. Children under 16 free. they have made to the Gallery and the community. H Mon-Fri 10.00 to 5.00, Sat-Sun 10.00 to To Nov 11 East Meets West – works from the 4.00. Public hols 10.00 to 2.00. To Oct 14 Blue collection by contemporary Asian and Australian Mountains Botanica – James Blackwell, Tania artists who have responded to Asian culture within Bowers, Ona Janzen, Jennifer Leahy & Edith Pass, their practice as well as the Mann-Tatlow collection Angela Lober, Julie Nettleton, Edith Rewa and of Asian Art. To Nov 25 Here + Now – showcases Jacqueline Spedding. Developed in partnership with the work of eight young artists – who live, work or the Royal Botanic Gardens and Domain Trust. Oct who have a close connection to Illawarra, and takes 20 to Nov 25 Contemporary Gallipoli – Co-inciding a ‘snapshot’ of their practice at this particular time in with the 100th anniversary of the end of WWI, Blue their careers – Jessica Cochrane, Tex Crick, Ebony Mountains City Art Gallery will showcase the touring Eden, Misha Harrison, India Mark, Paige Northwood, exhibition Contemporary Gallipoli, an exhibition Nick Santoro and Chris Zanko. To Dec 9 Charmed originally created to mark the ANZAC Centenary – new acquisitions from the Gallery’s contemporary in April 2015. The exhibition includes a diverse collection including works by Malcolm Benham, array of new works created by both emerging and Stephen Benwell, Lee Bethel, Pat Brassington, established artists from Canakkale, near the Gallipoli Debra Dawes, Helen Eager, Jess Johnson and Simon Peninsula, Turkey and Australia, whose work unites Ward, Penny Harris, Gregory Hodge, Madeleine to take the viewer on an experiential journey of Kelly, Jacky Redgate, Clare Thackway, Amy Joy remembrance, and a search for meaning beyond myth Watson and Jenny Watson. and memory. Featuring concepts of friendship and healing, the works comprise music, painting, drawing, printmaking, hand-built ceramic, sculpture, textile, mixed media installation, Artist books, wearables, photo media and digital animation. Artists featured in the exhibition include Ros Auld, Cenk Beyhan, Meredith Brice, Stephen Copland, Mark Davis, Ihsan 'RùUXV|].DWH'RZQKLOO'LDQQH-RQHV%XUW0XOOHU Susan O’Doherty, Toby Roberts and Chris Sainsbury. Curated by Meredith Brice. A Macquarie University Gallery Touring Exhibition.

Amy Joy Watson, Bad Spots, 2017, balsa wood, watercolour and metallic thread, 48 x 50 x 70cm Purchased 2018 Telopea speciosissima, botanical illustration from Curtis’s Botanical Courtesy the artist and Wollongong Art Gallery Magazine, 1808 Courtesy Royal Botanic Gardens and Domain Trust, and Blue Mountains City Art Gallery

144 New South Wales Central Tablelands Western Districts

Meredith Brice, War and flowers, 2014, textile installation, cotton, polyester, silk, and plastic, 200 x 45 cm Greater NSW Photograph: Effy Alexakis, Photowrite Courtesy the artist and Blue Mountains City Art Gallery Bathurst Regional Art Gallery Lost Bear Gallery 70-78 Keppel Street, Bathurst 2795. T (02) 6333- 98 Lurline Street, Katoomba 2780. 6555. W www.bathurstart.com.au Free entry. T (02) 4782-1220. E [email protected] H Tues-Sat 10.00 to 5.00, Sun and public hols W www.lostbeargallery.com.au Director: Geoff White. 11.00 to 2.00. Oct 12 to Dec 9 Looking Forward H Daily 10.00 to 5.00. – Looking Back Contemporary works from the East Kimberley. A Bathurst Regional Art Gallery exhibition with curatorial assistance by Robert Nolan on Lovel Gallery Hirschmann. Also, Jonathan Jones and the Bathurst 56a Lovel Street, Katoomba 2780. Wiradyuri and Aboriginal Community Elders: Group T (02) 4782-6231. E [email protected] guwiinyguliya yirgabiyi ngay yuwin.gu gulbalangidyal W nolanonlovelgallery.com.au H Thurs-Sun 10.00 ngunhi (they made a solitude and called it peace). to 5.00. Oct 20 to Nov 4 (opening Sat Oct 20, 2pm) A Bathurst Regional Art Gallery permanent collection NOL 10th Birthday Group Exhibition. exhibition. Also, Michelle Collocott: Three Ponds Series C. A Bathurst Regional Art Gallery exhibition. Norman Lindsay Gallery & Museum Broken Hill Regional Art Gallery 14 Norman Lindsay Crescent, Faulconbridge 2776. 404-408 Argent Street, Broken Hill 2880. T (02) 4751-1067. E [email protected] T (08) 8080-3444. E [email protected] W www.normanlindsay.com.au H Daily 10.00 to W www.bhartgallery.com.au H Daily 10.00 to 4.00. 4.00. The Norman Lindsay Gallery is the home of the Sept 28 to Nov 11 Unwinding Road by Clark Barrett, Magic Pudding and displays the work of artist and and Objet d’art by Robert Clinch & Jeff Brown. writer Norman Lindsay (1879-1969). Also, Moving Histories // Future Projections, and From Railway Town To The Western Front 1917 by Rex-Livingston Art + Objects Peter Osborn. 182-184 Katoomba Street, Katoomba 2780. E [email protected] W www.rex-livingston.com Ceramic Break Sculpture Park Director: David Rex-Livingston. H Mon-Tues, Thurs- ‘Bondi’, Warialda 2402. T (02) 6729-4147. Sun 10.00 to 5.00, closed Wed. To Oct 8 Hey ya – E [email protected] Wolgan Valley by Raphe Coombes. W www.cbreaksculpturepark.com.au Oct 12 to 29 Peripheral View by Joshua Charadia. H Thurs-Sun 10.00 to 5.00, or by appt. Through Oct 3 Perspectives oil and acrylic paintings, mixed media and water colours by Sydney artists Robyne Berling, Suzanne Lane and Sylvia Davies.

New South Wales 145 Cowra Regional Art Gallery Suki & Hugh Gallery 77 Darling Street, Cowra 2794. T (02) 6340-2190. 38A Gibraltar Street, Bungendore 2621. E [email protected] T (02) 6238-1398. E [email protected] W www.cowraartgallery.com.au Admission free. W www.sukihugh.com.au H Thurs-Sun 10.00 to H Tues-Sat 10.00 to 4.00, Sun 2.00 to 4.00. To Oct 4.00. Oct 6 to Nov 18 Above and Beyond by Stefan 7 ARTEXPRESS 2018 – an exhibition of outstanding Gevers. Inspired by the drama of light and the student artworks selected by the Gallery from the HSC inherent patterns in nature, Gevers’ work reflects the examination in Visual Arts 2017. Oct 14 to Nov 18 ever-evolving mood in a landscape. Nov 24 to Dec 16 Jamfactory Icon Gerry Wedd: Kitschen Man – a solo Time & Tide by Sue Hewat & Sara Freeman. Lines, exhibition of new and staple works by Gerry Wedd, webs and surface textures are the common threads showcasing the breadth of this iconic artist’s career. of Canberra artists, Sue Hewat’s ceramics and Sara Freeman’s paintings. Both source their inspiration Goulburn Regional Art Gallery from coastal light, and the textures and rhythms of nature, creatively pushing the boundaries of their Goulburn Mulwaree Council, Civic Centre, Cnr Bourke chosen mediums. and Church streets, Goulburn 2580. T (02) 4823- 4494. E [email protected] W www.grag.com.au Free entry. H Mon-Fri 10.00 to 5.00, Sat 1.00 to 4.00. To Oct 13 Inhabiting the Woodlands by Carolyn Young. Also, ACO Virtual. Oct 19 to Dec 1 Coarse Stories. Also, Permanent Collection – fit to size. ”‹ˆϐ‹–Š‡‰‹‘ƒŽ”– ƒŽŽ‡”› 167 Banna Avenue, Griffith 2680. T (02) 6962-8444. E [email protected] W www.griffithregionalartgallery.com.au H Wed-Fri 10.00 to 5.00, Sat-Sun 11.00 to 2.00. Sept 29 to Nov 4 Elsewhere: Travels to Syria, Iran, Egypt, Morocco and Central Asia by Wendy Sharp and Bernard Ollis. Murray Art Museum Albury (MAMA) 546 Dean Street, Albury 2640. T (02) 6043-5800. E [email protected] W mamaalbury.com.au H Mon-Fri 10.00 to 5.00, Thurs 10.00 to 7.00, Sat-Sun and public hols 10.00 to 4.00. To Oct 7 Leon deMontignie: The Life and Death of an Unknown Artist. To Nov 4 Immortality. To Dec 9 Mechelle Bounpraseuth: Westside Story. To Dec 31 Land & Title. New England Regional Art Museum 106-114 Kentucky Street, Armidale 2350. T (02) 6772-5255. E [email protected] W www.neram.com.au H Tues-Sun 10.00 to 4.00. Orange Regional Gallery 149 Byng Street, Orange 2800. T (02) 6393-8136. Stefan Gevers, Midnight Sun Purple, 2018, watercolour, 70 x 40cm E [email protected] W www.org.nsw.gov.au Courtesy the artist and Suki & Hugh Gallery H Daily 10.00 to 4.00. Closed Christmas Day, Boxing Day and Good Friday. To Oct 14 Mary Turner Western Plains Cultural Centre Collection and Bequest. Also, Connections: from the Gutenberg Press to Richard Swinbourne’s ‘The Dubbo Regional Gallery The Armati Bequest, Dubbo Etching Press Company’. Sept 29 to Nov 25 Kevin Regional Museum and Community Arts Centre, 76 Connor: People in the forever one day. Oct 20 to Dec Wingewarra Street, Dubbo 2830. T (02) 6801-4444. 2 Kedumba Drawing Award. W www.westernplainsculturalcentre.org H Daily 10.00 to 4.00, Fri 10.00 to 6.00. To Oct 28 Michael Cook: Undiscovered. To Dec 19 Primavera At 25: MCA Collection.

146 New South Wales Australian Capital Territory

147 Canberra Museum and Gallery Civic Cnr London Circuit and Civic Square, Canberra City 2600. T (02) 6207-3968. W www.cmag.com.au H Mon-Fri 10.00 to 5.00, Sat-Sun 12.00 to 4.00. To Nov 4 Crafting the house on the hill: Art, Design Inner North and the Building of Australian Parliament House – reveals the stories behind the building’s major art and ANCA Gallery design commissions. 1 Rosevear Place, Dickson 2602. T (02) 6247-8736. E [email protected] W www.anca.net.au Contour 556 H Wed-Sun 12.00 to 5.00. Oct 9 to 21 (opening Wed Canberra’s Public Art Biennial Oct 10, 6pm) Interspatial by Nyx Mathews – through W www.contour556.com.au Oct 5 to 28 A free public a broad range of media and a focus on experimental art event presenting artworks and performances by 60 material processes, Mathews makes work that artists in the world famous public realm and national questions the artificial landscapes and interior spaces cultural icons around Lake Burley Griffin, Canberra. we are encouraged to accept as standard, in small All artworks and performances are site-specific – sculptural works. Oct 24 to Nov 11 (opening Wed Oct drawing inspiration from, or reflecting on the cultural 24, 6pm) Mood Shifts by Debra Jurss – an exhibition or physical character of Canberra. Visit website to of glass that explores the flow and movement of view full program. See ad page 149. our emotions, and the strong positive impact that the landscape has on them, whether that impact is restorative, inspiring, overwhelming, calming, soothing or healing.

Jason Wing, Ask us what we want, 2018, core flute, acrylic paint and spray paint, 90 x 50cm Courtesy the artist and Contour 556 Craft ACT Craft and Design Centre Nyx Mathews, Studies of elevation and containment (No.02), 2017, Level 1, North Building, 180 London Circuit, paraffin wax, nickel silver, silver solder, 29.5 x 5.5 x 17cm Canberra 2601. T (02) 6262-9333. Photograph: Simon Cottrell E [email protected] W www.craftact.org.au Courtesy the artist and ANCA Gallery H Tues-Fri 10.00 to 5.00, Sat 12.00 to 4.00. Canberra Contemporary Art Nancy Sever Gallery Space, Gorman Arts Centre Gorman Arts Centre, B Hall, cnr Batman and Currong 55 Ainslie Avenue, Braddon 2612. streets, Braddon 2604. T (02) 6182-0055. T (02) 6247-0188. E [email protected] E [email protected] W www.ccas.com.au H Tues-Sat 11.00 to 5.00. W www.nancysevergallery.com.au To Nov 17 Black Elephant by Jess Higgins. H Wed-Sun 11.00 to 5.00. Also, Drones Over Aleppo by Kate Stevens, and FENCEsBORDERsWALLs by Janenne Eaton.

148 Australian Capital Territory

Canberra Glassworks Acton 11 Wentworth Avenue, Kingston 2604. T (02) 6260- 7005. E [email protected] W www.canberraglassworks.com Free entry. H Wed-Sun 10.00 to 4.00. To Oct 21 A Profusion NewActon of plumes by B. Jane Cowie. Cowie is an Australian artist based in Singapore. She has created public ANU Drill Hall Gallery art commissions in many parts of the world and most recently at Bondi Sculpture by the Sea 2018. Kingsley Street (off Barry Drive), Acton 2601. These new works created at Canberra Glassworks T (02) 6125-5832. E [email protected] will coincide with Canberra’s iconic Floriade W dhg.anu.edu.au Director: Terence Maloon. Free Festival. See her work colonising the exterior of the admission. H Wed-Sun 10.00 to 5.00. To Oct 7 Canberra Glassworks. Nov 1 to Dec 30 Illuminated Painting amongst other things. Oct 18 to Dec 16 Spaces – Lisa Cahill, Scott Chaseling, Judi Elliott, Western Desert Sublime – The Craig Edwards Gift. Jeremy Lepisto, Ruth Oliphant, Lucy Palmer, Clare Peters, Kirstie Rea and Richard Whiteley. A survey ANU School of Art Gallery show featuring artists whose work is informed by 105 Childers Street, Acton 2602. T (02) 6125-5841. architectural glass art, including stained glass. E [email protected] W soad.cass.anu.edu.au H During Main Gallery exhibitions Tues-Fri 10.30 M16 Artspace to 5.00, Sat 12.00 to 5.00, closed Sun-Mon and 21 Blaxland Crescent, Griffith 2603. T (02) 6295- public hols. 9438. E [email protected] W www. m16artspace.com.au H Wed-Sun 12.00 to 5.00. Sept 27 to Oct 14 Gallery 1: Silk on the Road by Jeffree Skewes. Gallery 2: Testamur – Canberra Art Foreshore Workshop. Gallery 3: Edible Plants in Art – The Watercolour Group, curated by Lesley Wallington. Oct 18 to Nov 4 Gallery 1: New Work by Brenton McGeachie and Martin Paull. Gallery 2: Bloom by Southside Jodie Cunningham. Gallery 3: Feet on the Ground by Lucile Carson and Ruth Hingston. Beaver Galleries 81 Denison Street, Deakin, Canberra 2600. T (02) 6282-5294. E [email protected] W www.beavergalleries.com.au Directors: Martin & Susie Beaver (member of ACGA). H Tues-Fri 10.00 to 5.00, Sat-Sun 9.00 to 5.00. Canberra’s largest private gallery featuring regular exhibitions of contemporary paintings, prints, sculpture, glass and ceramics by established and emerging Australian artists. Oct 18 to Nov 4 Thornton Walker paintings and works on paper. Also, Catherine Woo paintings. Canberra Contemporary Art Space, Manuka 19 Furneaux Street, Manuka 2603. T (02) 6247- 0188. E [email protected] W www.ccas.com.au H Fri-Sun 11.00 to 5.00. Oct 4 to 14 Outside Over There by Mark Van Veen. Oct 18 to 28 Seen and Foreseen by Alex Lundy.

Arjen Romeyn, Edible Plants, goauche on black gesso, 70 x 50cm Courtesy the artist and M16 Artspace

150 Australian Capital Territory Megalo Print Studio + Gallery National Portrait Gallery 21 Wentworth Avenue, Kingston 2604. T (02) 6232- King Edward Terrace, Parkes 2600. T (02) 6102- 6041. E [email protected] W www.megalo.org H Tues 7000. E [email protected] W www.portrait.gov.au to Sat 9.30 to 5.00. Sept 29 to Oct 20 We Are Lost H Daily 10.00 to 5.00. To April 22, 2019 Electric! by Caren Florance. Portraits that pop! – a mix of bright and colourful portraits from the collection to celebrate the National Gallery of Australia Gallery’s 20th birthday. Oct 20 to Feb 10, 2019, 20/20: Celebrating twenty years with twenty new (NGA) portrait commissions. This is exhibition of 20 new Parkes Place, Parkes, Canberra 2600. T (02) 6240- portraits commissioned to celebrate the Gallery’s 6411. E [email protected] W www.nga.gov.au 20th birthday. To Oct 28 Icons: Volume Two – bold Admission to the permanent collection is free. contemporary portraits drawn from the collection. H Daily 10.00 to 5.00. To Nov 11 American Masters 1940-1980. To Nov 18 Watercolours by HRH The Prince of Wales. To Dec Art Deco. To Jan 20, 2019 Performing Drawing. To Jan 28, 2019 Power & Imagination: Conceptual Art. From Oct 6 California Greater Cool: art and Los Angeles 1960s-70s. Canberra Belconnen Arts Centre 118 Emu Bank, Belconnen 2617. T (02) 6173-3300. E [email protected] W www.belconnenartscentre.com.au H Tues-Sun 10.00 to 4.00. Visit the gallery website for exhibition program. Strathnairn Arts 90 Stockdill Drive, Holt 2615. T (02) 6254-2134. E [email protected] W www.strathnairn.com.au Free entry, all welcome. H Thurs-Sun 10.00 to 4.00. To Oct 14 Strathnairn Arts Homestead Gallery 1: Bird Watching by Carol Cooke. Cooke observes, draws and hand embroiders local birds, found feathers and forest debris. Woolshed Gallery: Strathnairn Members Exhibition 2018. Oct 18 to Nov 11 (opening Sat Oct Josef Albers, Homage to the square: On an early sky, 1964, oil on 20, 4pm) Strathnairn Arts Association Homestead composition board Gallery 2: Spring by Jude Cirillo. This exhibition will National Gallery of Australia, Canberra, purchased 1981 be a celebration of Spring and all things new. Spring © The Josef and Anni Albers Foundation Bild-Kunst/Copyright Agency, 2018 is a time for breathing new life into the environment, Courtesy National Gallery of Australia a brightening of the world around us, a time for awakening.’ Oct 20 to Nov 11 Strathnairn Woolshed Gallery: Squares Strathnairn’s annual peoples choice National Library of Australia exhibition and award. Award presentation: Sun Nov Parkes Place, Canberra 2600. T (02) 6262-1111. 11, 2pm. W www.nla.gov.au Free entry. H Visit website for opening times and exhibitions. Tributary Projects Unit 9 Molonglo Mall, 105 Newcastle Street, Fyshwick 2609. E [email protected] W www.tributaryprojects.xyz H Thurs-Sun 11.00 to 5.00, or by appt. Oct 18 to 28 (opening Sat Oct 20, 4pm) Apparition by Dean Cross.

Australian Capital Territory 151 Tasmania

152 Colville Gallery Hobart 91a Salamanca Place, Hobart 7004. T (03) 6224- 4088, 0419-292-626. E [email protected] W www.colvillegallery.com.au H Daily 10.00 to 5.00. Sullivans Cove Oct 2 to 31 Ether and Earth by Stephen Lees. Battery Point Art Mob 29 Hunter Street, Hobart 7000. T (03) 6236-9200, 0419-393-122. E [email protected] W www.artmob.com.au Director: Euan Hills. H Daily 10.00 to 6.00. Aboriginal fine art, including Tasmanian Aboriginal artists. Bett Gallery Hobart Level 1, 65 Murray Street, Hobart 7000. T (03) 6231-6511. E [email protected] W www.bettgallery.com.au Directors: Carol Bett, Stephen Lees, Empire Day, 2018, oil on linen, 84 x 101cm Emma Bett and Jack Bett . H Mon-Fri 10.00 to 5.30, Courtesy the artist and Colville Gallery Sat 10.00 to 4.00. To Oct 13 Double Yolker! by Mish Meijers, and Digital Satiety by Nathan Taylor. Oct 18 to Nov 10 Middle Ground by Amber Koroluk- Stephenson, and Further by Anna Eden.

Tasmania 153 Despard Gallery Level 1, 15 Castray Esplanade, Hobart 7000. T (03) 6223-8266. E [email protected] W www.despard-gallery.com.au H Mon-Fri 10.00 to 5.00, Sat 10.00 to 4.00, Sun 11.00 to 4.00. To Oct 14 Raw Backyard by Lisa Garland, and Instinct by Lucia Usmiani. Oct 17 to Nov 11 A World of My Own by Micheila Petersfield. Handmark Gallery Unique Tasmanian Art & Design, 77 Salamanca Place, Hobart 7000. Also, 2 Russell Street, Evandale, 7212. T Hobart: (03) 6223-7895, Evandale: (03) 6391-8193. E Hobart: [email protected], Ian Burns, Circle, 2016, fans, latex gloves, table, air, timing system, Evandale: [email protected] 165 x 160 x 160cm W www.handmark.com.au Hobart: Oct 5 to 29 Courtesy the artist, Anna Schwartz Gallery, Melbourne, and Plimsoll Michael McWilliams new paintings. Evandale: to Oct Gallery 10 Jeff Gatt new paintings. Oct 14 to Nov 7 Olivia Moroney new prints. Salamanca Arts Centre 65-77 Salamanca Place, Hobart 7000. The Henry Jones Art Hotel T (03) 6234-8414. E [email protected] 25 Hunter Street, Hobart 7000. T (03) 6210-7700. W www.salarts.org.au H Daily 10.00 to 5.00. E [email protected] W www.thehenryjones.com Oct 1 to 31 Top Gallery: Approaching From A Showcasing leading and emerging Tasmanian artists Distance by Ai Shanshan. Lightbox: Sketch by Emily with a changing display of original contemporary Snadden. Oct 3 to 31 Studio Gallery: Looking At artworks. Place by Hilary Clared. Oct 5 to 13 Sidespace Gallery & Kelly’s Garden: They Tell You Which Rock They Mona Were And How They Travelled So Far. Presented by Constance ARI and Salamanca Arts Centre. Oct 6 to Museum of Old and New Art 21 Long Gallery: Tasmanian Portrait Prize 2018 – a 655 Main Road, Berriedale, Hobart 7011. prestigious award for Tasmanian artists aged 30 and T (03) 6277-9900. E [email protected] under. Presented by RACT Insurance. W www.mona.net.au Visit website for details. To Feb 4, 2019 The Unmanned: Fabien Giraud and Tasmanian Museum Raphaël Siboni, Part Two. To April 22, 2019 ZERO. and Art Gallery Plimsoll Gallery Dunn Place (enter via the Watergate), Hobart 7000. T (03) 6165-7000. E [email protected] School of Creative Arts, W www.tmag.tas.gov.au H Tues-Sun 10.00 to 4.00 University of Tasmania closed Mon, Good Friday, Anzac Day and Christmas Hunter Street, Hobart 7000. T (03) 6226-4300. Day. E [email protected] W www.utas.edu.au/ creative-arts/events/plimsoll-gallery H Daily 12.00 to Wagner Framemakers 5.00 during exhibitions, closed on Tues and public 72 Brisbane Street, Hobart 7000. T (03) 6234-8599. hols. To Oct 14 Systematic – Ian Burns, Laura E [email protected] Woodward, Patrick Pound, Tricky Walsh, Jacob W www.wagnerframemakers.com.au Leary, Tega Brain, Nadège Philippe-Janon and Bill Wagner Framemakers offers a fresh and contemporary Hart. Systematic is an exhibition showcasing eight approach to fine art picture framing. Australian artists whose works engage with the creative potential of systems to critique, re-imagine or re-invent their workings. The exhibition is a playful blend of vibrant and kinetic works that invite viewers to reflect on the relationships between various human and non-human systems, and concepts of organisation, inter-relatedness and connectivity. Curated by Eliza Burke.

154 Tasmania North Hobart Contemporary Art Tasmania 27 Tasma Street, North Hobart 7000. T (03) 6231-0445. E [email protected] W www.contemporaryarttasmania.org H Wed-Sun 12.00 to 5.00. To Nov 4 Beyond the Field (Still) – Samara Adamson-Pincweski, Eun Ju Cho, Michael Graeve, Neil Haddon, Sarah Hughes, Benjamin Kluss, Jacob Leary, Suzanne Moss, Frank Murri, Joshua Reilly, Ron Robertson-Swann, Paul Snell, Wilma Tabacco, Tricky Walsh, Stephen Wickham, Dancing Together Carolyn Wigston and Paul Zika. Curated by Anne Robyn McKinnon, , 2016, acrylic on canvas Collection the artist Mestitz. Presented across two locations, in partnership Courtesy the artist and Queen Victoria Museum & Art Gallery with Moonah Arts Centre, 23-27 Albert Road, Moonah TAS 7000. Sawtooth ARI Level 1, 160 Cimitiere Street, Launceston 7250. T (03) 6331-2777. E [email protected] W www.sawtooth.org.au Director: Paul Eggins. Free Launceston entry. H Wed-Fri 12.00 to 5.00, Sat 10.00 to 2.00. Academy Gallery School of Creative Arts, Academy of the Arts, University of Tasmania, Invermay Road, Inveresk, North West Launceston 7250. T (03) 6324-4410. E [email protected] Coast W www.utas.edu.au/creative-arts Director: Dr Malcom Bywaters. Free admission. H Mon-Fri 9.00 to 5.00, closed weekends and public hols. Sept 28 to Oct 12 Burnie Regional Art Gallery Not drawing, writing – the exhibition, curated by Dr Burnie Arts & Function Centre, Wilmot Street, Burnie Kim Lehman. To Oct 15 Object Design – University 7320. T (03) 6430-5875. E [email protected] of Tasmania, curated by Sara Lindsay. W www.burniearts.net H Mon-Fri 10.00 to 4.30, Sat-Sun and public hols 1.30 to 4.00. Queen Victoria Museum & Art Gallery Devonport Regional Gallery Art Gallery at 2 Wellington Street, and Museum at Paranaple Arts Centre, 137-145 Rooke Street, 2 Invermay Road, Launceston 7250. Devonport 7310. T (03) 6424-8296. T (03) 6323-3777. W www.qvmag.tas.gov.au E [email protected] H Daily 10.00 to 5.00. To Oct 28 Spiders. Touring W www.devonportgallery.com Free entry. from the Australian Museum and Questacon – The The gallery is closed through Oct while re-locating to National Science & Technology Centre. Paranaple Arts Centre, re-opening Nov 2. To Nov 11 Disappearing into Being by Robyn McKinnon. To Feb 3, 2019 Artist and the Collection: Material Memories – Susan Buchanan, Janine Combes, Penelope Davis, Eli Giannini, Robyn Pelan and Sarah Stubbs. Oct 6 to Nov 5 Minds Do Matter – various artists. An exhibition exploring the powerful relationship between art and well-being. Supported by Wellways. Nov 10 to Feb 24, 2019 The Midlands: Whimsy and Pathos by Mandy Hunniford. Nov 24 to Feb 17, 2019 The National Picture: The Art of Tasmania’s Black War – shining a light on two enthralling yet under-examined figures in Australian history: colonial artist Benjamin Duterrau and the ‘Conciliator’, George Augustus Robinson. Dec 15 to April 23, 2019 ArtRage 2018 Collection – Tasmanian pre-tertiary students.

Tasmania 155 South Australia

156 Adelaide ACE Open Lion Arts Centre, North Terrace (West End), Kaurna Yarta 5000. T (08) 8211-7505. E [email protected] W www.aceopen.art Free admission. H Tues-Sat 11.00 to 4.00. South Australia’s leading organisation for contemporary visual art and artists. Oct 5 to Nov 17 (opening Thurs Oct 4, 5pm) my parents met at the fish market by Jason Phu (NSW). Plunge into the psyche of rising Australian artist Jason Phu in the gallery-wide installation my parents met at the fish market. This new iteration of the work, originally commissioned by West Space, showcases the breadth and depth of the artist’s ability to navigate his Chinese/Vietnamese cultural upbringing, family and nostalgia, across five distinct spaces.

Andrew Clarke, detail from postcard artwork, 2017 Courtesy the artist and Adelaide Central Gallery Anne & Gordon Samstag Museum of Art University of South Australia 55 North Terrace, Adelaide 5000. T (08) 8302-0870. Jason Phu, my parents met at the fish market, 2017, installation view at West Space, Melbourne E [email protected] Courtesy the artist, Christo Crocker and ACE Open W www.unisa.edu.au/samstagmuseum Free admission, all welcome. H Tues-Fri 10.00 to 5.00, Sat 12.00 to 5.00. Closed public hols and Adelaide Central Gallery during exhibition changeovers. To Nov 30 Starstruck: 7 Mulberry Road, Glenside 5065. Australian Movie Portraits. Also, The Waiting Room T (08) 8299-7300. E [email protected] by Molly Reynolds and Rolf de Heer. W www.acsa.sa.edu.au H Mon, Tues Thurs-Fri 9.00 to 5.00, Wed 9.00 to 6.45. After hours by appt. To Oct 19 The Drawing Exchange 2018 – Louise Haselton & Damian Dillon, Bernadette Klavins & Toni Warburton, Michael Kutschbach & Marian Tubbs, Mary-Jean Richardson & Chelsea Lehman, Hossein Valamanesh & Gary Deirmendijan and Laura Wills & Kirtika Kain. The Drawing Exchange is an ongoing collaboration between the nation’s top art schools. This year 12 artists will work in pairs to produce new works for Adelaide Central Gallery and Rayner Hoff Project Space at the National Art SPECIALISING IN SENNELIER OIL PAINTS, WATERCOLOURS, School in Sydney. The exhibition encompasses a PASTELS, DRAWING INKS & BELGIAN LINEN. range of interdisciplinary approaches to drawing and ALSO STOCKING ART SPECTRUM, DANIEL SMITH, explores the generative potential of collaboration. ARCHES, LANGRIDGE, CONTE, LUKAS PLUS MANY MORE. Oct 27 to Nov 16 Wish you were here! – Adelaide Central School of Art’s annual fundraising exhibition 83 Commercial Road, Port Adelaide SA 5015 Ph: (08) 8241 0059 • Fax: (08) 8241 0058 of postcard sized works donated by established and Open: Monday-Friday 8.30-5.00, Saturday 9.00-2.00 emerging artists. [email protected] • www.portartsupplies.com.au

South Australia 157 Art Gallery of South Australia Heartland Studio North Terrace, Adelaide 5000. T (08) 8207-7000. 558 Marion Road, Plympton Park 5038. W www.artgallery.sa.gov.au Free entry. H Daily 10.00 T 0458-742-715. W www.facebook.com/Jungle- to 5.00. Guided tours daily at 11.00 and 2.00. Oct Phillips-84033841545/ H Wed-Sun 10.00 to 3.00. 26 to 28 TARNANTHI Art Fair presents the work of Jungle Phillips and Frantastic Fran. over 40 Aboriginal art centres from across Australia. Art lovers and collectors can meet and buy works of Hugo Michell Gallery art direct from artists. This year’s Art Fair welcomes 260 Portrush Road, Beulah Park 5067. ten new art centres, including Bábbarra Designs T (08) 8331-8000 F 8331-7000. and Maningrida Arts and Culture, both representing E [email protected] the community of Tarnanthi feature artist John W www.hugomichellgallery.com H Tues-Fri 10.00 to Mawurndjul. Works of art are available for sale at 5.00, Sat 11.00 to 4.00, or by appt. To Oct 13 Word various price points. Oct 26 to Jan 28, 2019 John a group show. Oct 18 to Nov 10 The Lucky Country? Mawurndjul: I am the old and the new presents the by William Mackinnon. Also, Born to give not to get masterful fusion of traditional and contemporary art by Min Wong. from one of Australia’s greatest living artists. John Mawurndjul has been celebrated internationally for his innovative bark paintings and the radiance of their meticulous rarrk (cross-hatching). This first major Australian survey of his work assembles more than 160 paintings and sculptures from collections worldwide. It illuminates connections between land and ancestral power in Mawurndjul’s Kuninjku homeland and vividly reveals his linking of past and present.

William Mackinnon, Fitzroy Crossing, 2018, acrylic, ochre, oil and automotive paint on canvas, 130 x 160cm Courtesy the artist and Hugo Michell Gallery JamFactory Contemporary Craft & Design 19 Morphett Street, Adelaide 5000. John Mawurndjul, 2016 Photograph: Tristan Derátz T (08) 8410-0727. W www.jamfactory.com.au Courtesy Art Gallery of South Australia H Daily 10.00 to 5.00. Oct 5 to Dec 2 Adelaide Modern. FELTspace 12 Compton Street, Adelaide 5000. T 0418-267-005. Kerry Packer Civic Gallery E [email protected] W www.feltspace.org at the Bob Hawke H Wed-Thurs 1.00 to 4.00, Fri 1.00 to 7.00, Prime Ministerial Centre Sat 10.00 to 4.00, or by appt. FELTdark hours Wed- UniSA Hawke Building, Level 3, 55 North Terrace, Sat Dusk to 12.00am. Oct 4 to 20 (opening Wed Oct Adelaide 5000. T (08) 8302-0371. 3, 5.30pm) Front Gallery: inside mumbling rain by W www.hawkecentre.unisa.edu.au H Mon-Fri 9.00 Max Callaghan (SA). Back Gallery: Expansionism III to 5.00, Thurs 9.00 to 7.00. Oct 8 to 26 Visualising by SLIPPAGE (VIC). FELTdark: Visitors of the Night Mental Health by Match Studio – presents clinical by Monika Morgenstern (SA). tools and product prototypes designed and developed by UniSA’s Communication Design students in GAGPROJECTS | consultation with practicing psychologists to ‘visualise’ Greenaway Art Gallery complex mental health concepts. Also, Concepts 39 Rundle Street, Kent Town 5067. for a Modbury Age Friendly Precinct – Retrofitting T (08) 8362-6354. E [email protected] Australia’s suburbs for the future – explores the W gagprojects.com Director: Paul Greenaway. application of age friendly community principles in a H Tues-Fri 11.00 to 6.00, Sat-Sun 12.00 to 4.00. real-world setting. To Oct 14 Space Junky by Christian Lock. Oct 17 to Nov 18 Daryl Austin and Mark Kimber.

158 South Australia SASA Gallery JamFactory University of South Australia, Level 2 Kaurna ƒ–‡’’‡Ž–•ϐ‹‡Ž† Building, cnr Hindley Street and Fenn Place, Adelaide 730 Seppeltsfield Road, Seppeltsfield 5355. 5000. T (08) 8302-9274. T (08) 8562-8149. W www.jamfactory.com.au E [email protected] H Daily 11.00 to 5.00. To Nov 25 Jamfactory Icon W www.unisa.edu.au/sasa-gallery H Mon-Fri 11.00 2018 Clare Belfrage: A Measure Of Time. to 5.00. Closed public hols and during exhibition changeovers. Kapunda Community Gallery 67-69 Main Street, Kapunda 5373. Sister Gallery E [email protected] E [email protected] W www.kapundagallery.com Free entry, wheelchair W www.sistergallery.com.au access. H Mon-Sat 10.00 to 4.00, Sun 10.00 to www.facebook.com/sistergallerysister Artist-run gallery 3.30. To Oct 21 NorthernVisions – Artsnorth Group. and project space Sister Gallery is a Fontanelle Gallery and Studios supported project. Sister is currently operating as a satellite space facilitating contemporary art exhibitions and events across multiple sites. SA Regional State Library of South Australia North Terrace and Kintore Avenue, Adelaide 5000. Ascot Theatre Gallery T (08) 8207-7250. W www.slsa.sa.gov.au 48 Graves Street, Kadina 5554. T (08) 8821-2404. Visit website for exhibition program and W www.coppercoast.sa.gov.au H Mon-Fri 10.00 opening hours. to 4.30, Sat 9.30 to 11.30, closed Sun and public hols. To Oct 18 Art For All. Oct 22 to Nov 8 Kadina Tandanya Memorial School Art Showcase. National Aboriginal Cultural Institute Belalie Art Gallery 253 Grenfell Street, Adelaide 5000. 6 Irvine Street, Jamestown 5491. T (08) 8224-3200. W www.tandanya.com.au T (08) 8664-0455, 8664-1567. Established in 1989. Australia’s oldest Aboriginal- W www.visitjamestown.com.au/belalie-art-gallery owned and managed multi-arts centre. The modern gallery hosts a vast range of curated exhibitions all year round. At other times the gallery’s own collection is on display. Millicent Gallery Barossa Valley Civic Centre, Ridge Terrace, Millicent 5280. T (08) 8733-0903. E [email protected] W www.wattlerange.sa.gov.au Adelaide Hills www.facebook.com/MillicentLibraryGallery. H Tues and Fri 9.00 to 5.30 and 6.30 to 8.30, Wed-Thurs Greater 9.00 to 5.30, Sun 2.00 to 4.00. Port Pirie Regional Art Gallery Adelaide 3 Mary Elie Street, Port Pirie 5540. T (08) 8633-0681. W pprag.org.au H Mon-Fri 9.00 to 5.00, Sat-Sun and public hols Barossa Regional Gallery 11.00 to 3.00. Closed Good Friday and Christmas 3 Basedow Road, Tanunda 5352. T (08) 8563-0849. Day. To Oct 28 Photographic Society Competition – E [email protected] W www.barossagallery.com amateur and professional travel photographers from H Daily 11.00 to 4.00. To Oct 22 Re:Location by around the world. Lyne Marshall. Burra Regional Art Gallery 5-6 Market Street, Burra 5417. T (08) 8892-2411. W www.burragallery.com H Tues-Sun 1.00 to 4.00. Oct 11 to Nov 18 Art of the Flower & Garden Competition.

South Australia 159 Western Australia

160 Fremantle Artitja Fine Art South Fremantle, 6162. T (08) 9336-7787, 0418-900-954. E [email protected] W www.artitja.com.au Directors: Anna Kanaris and Arthur Clarke. H By appt. Call or email to view art in a relaxed environment. Artitja Fine Art holds up to four external exhibitions a year, details of which can be found on their website. Recipients: Outstanding Cultural Enterprise award 2017 Fremantle Business Awards. Oct 26 to Nov 18 The Essence Of Place at Earlywork: 330 South Terrace, South Fremantle WA. Fremantle Arts Centre 1 Finnerty Street, Fremantle 6160. T (08) 9432-9555. E [email protected] W www.fac.org.au Free entry. H Daily 10.00 to 5.00. To Nov 4, 2018 Fremantle Arts Centre Print Award Supported by Little Creatures Brewing. This year the 43rd annual Fremantle Arts Centre Print Award presents the best of Australian printmaking. Australia’s premier showcase of prints and artists’ books returns with a selection of 50 works from established, emerging and cross-disciplinary artists from across the nation. Kathleen O’Connor, 1966 In 2018, the award continues to present works Photograph: Richard Woldendorp that celebrate the traditions of printmaking while Courtesy Fremantle Arts Centre simultaneously looking towards the future of the medium. Also, Being There – Kathleen O’Connor Heathcote Museum and Gallery in Paris – is presented to commemorate the 50th Swan House, Heathcote Cultural Centre, 58 Duncraig Anniversary of the death of Kathleen O’Connor Road, Applecross 6153. T (08) 9364-5666. (1876–1968), who was born in New Zealand and E [email protected] established a professional career in Paris where she W www.heathcotewa.com/heathcotegallery H Tues-Fri settled in 1906 and embraced the bohemian lifestyle 10.00 to 3.00, Sat-Sun 12.00 to 4.00. To Oct 14 in the Artists’ Quarter. Being There brings together Mindmatter by Bjoern Rainer-Adamson. Oct 20 for the first time recent acquisitions and the entire to Nov 25 Heathcote Select – Elham Eshraghian, O’Connor holding of drawings and paintings gifted Sharon Callow, Sophie La Maitre, Sam Bloor, Olivia to the City of Fremantle in 1978 by Sir Ernest Lee Ryan, Rob Kettels and Stephanie De Biasi. Steere on behalf of his mother, the artist’s sister. The exhibition includes loans of artworks and ephemera from public and private collections and is presented to Japingka Gallery coincide with the release of a new book by Amanda 47 High Street, Fremantle 6160. T (08) 9335-8265. Curtin, ‘Kathleen O’Connor of Paris’, published by E [email protected] W JapingkaAboriginalArt.com Fremantle Arts Centre. H Open daily. Through Oct Gallery 1: Painting on Country – Utopia Artists. Gallery 2: Ikuntji Artists from Haasts Bluff.

Western Australia 161 Moores Building sophisticated jewels in its historical, contemporary and Indigenous collections. Moving from bold and Contemporary Art Gallery captivating wearable art to quiet and subtle, almost 46 Henry Street, Fremantle 6160. private, personal interventions, the show will change T (08) 9432-9898. E [email protected] how you think about what jewellery is and can be. W www.fac.org.au/about/moores-building H Daily 10.00 to 4.00. Oct 20 to Nov 4 (opening Fri City of Joondalup Oct 19, 6pm) Brilliant; Undercurrent – an exhibition that aims to celebrate Fremantle’s particular narrative Lakeside Joondalup with new works from multi-disciplined contemporary Shopping City, Myer Court artists. Since the 1970s the city has been dedicated 420 Joondalup Drive, Joondalup 6027. to the arts with many practitioners calling Fremantle T (08) 9400-4924. E [email protected] home. Brilliant: Undercurrent features works by Jana W www.joondalup.wa.gov.au H Open during Braddock, Sheryl Chant, Ben Crappsley, Marion shopping hours. Oct 14 to 28 CIAA: Community Duke, Sharyn Egan, James Egan, Ellie Eshraghian, Invitation Art Award 2018 exhibition. Ricky Gibson, Shavaurn Hanson, Junko Kitamira, See ad page 8. Robyn Laycock, Hana Akalani, Laura Mitchell, Ben Reynolds, Alessandra Rossi, David Spencer, Mark Welsh, Simon Wilson, Rosina Wonglorz, Marcia Cool Change Contemporary Hadlow, Fiona Gavino, Alan Muller, Ric Spencer, Bec 1F, 74-84 Barrack Street, Perth 6000. Dagnall and Simon Gilby. E [email protected] W www.coolchange.net.au H Wed-Sun 11.00 to 6.00. A new artist-run-initiative for exhibitions, performances, screenings, workshops and events across multiple galleries. Perth City Perth Institute of Contemporary Arts (PICA) Art Gallery Of Western Australia Perth Cultural Centre, 51 James Street, Perth 6000. Perth Cultural Centre, James Street Mall, Perth 6000. T (08) 9228-6300. E [email protected] T (08) 9492-6600 F 9492-6655. W www.pica.org.au Free entry. H Tues-Sun 10.00 to W www.artgallery.wa.gov.au Free entry unless stated 5.00. To Oct 7 please open hurry by Amalia Pica. otherwise. H Wed-Mon 10.00 to 5.00 (closed Tues). Also, A Self Portrait by Khaled Sabsabi. Oct 20 to To Nov 12 Sidney Nolan’s Ned Kelly series – the Dec 23 HyperPrometheus – commemorates the Sidney Nolan rebel masterpiece series comes to Perth. 200th anniversary of Mary Shelley’s Frankenstein and AGWA explores the iconic Australian rebel, Ned Kelly, re-contextualises it for the new millennium. Artists as immortalised in Sidney Nolan’s celebrated series include ORLAN, AES+F, Heather Dewey Hagborg of 26 works from the 1940s. On short-term loan from and Chelsea E. Manning. Curated by Oron Catts, the National Gallery of Australia, it’s a rare opportunity Laetitia Wilson and Eugenio Viola and presented in to view this renowned series depicting the story of partnership with SymbioticA, UWA. Also. Unspoken bush outlaw Ned Kelly through Nolan’s bold and sees WA-based artist Olga Cironis work in a hybrid expressive sense of landscape and vivid storytelling. of both studio and exhibition space, where visitors To Dec 3 WA Now – Biomess – The Tissue Culture & are invited to become part of the artwork. Curated by Art Project (Oron Catts/Ionat Zurr). Is it art? Science? Eugenio Viola. Or both. Including a range of strange, bewildering, rarely seen and, just maybe, brand new organisms, this exhibition defies categorisation. In the anniversary year of Mary Shelley’s Frankenstein, the provocative project asks some moral as well as creative questions about how science operates today and might in the future. The exhibition will be presented in the form of a high-end retail installation. As the display set up implies, it will also offer a critique of the ways that humans commodify nature for our own ends. To Jan 7, 2019 spaced 3: north by southeast. Organised by the WA-based International Art Space, this exhibition brings together 11 artists, from Australia and the Nordic region. Each artist presents works made after immersive residencies in their opposing hemispheres Heather Dewey-Hagborg and Chelsea E. Manning, Probably Chelsea, 2017 and track, amongst other things, the ways that identity Courtesy the artists and Perth Institute of Contemporary Arts is composed in dynamic exchange with the forces of nature and economics. From Oct 13 Culture Juice – Beyond Bling! A wild and intriguing celebration of the art, design and craft of jewellery, AGWA is unlocking the vaults to showcase the best, the bizarre and the

162 Western Australia Wanneroo Gallery Wanneroo Library and Cultural Centre, 3 Rocca Way, Wanneroo 6065. W wanneroo.wa.gov.au/ wanneroogallery Free entry. H Mon-Sat 10.00 to 4.00, closed Sun and public hols. Subiaco Buratti Fine Art Suite 6, 217 Hay Street, Subiaco 6008. T 1300-028-728. E [email protected] W www.buratti.com.au H Tues-Fri 10.00 to 5.00, Sat-Sun by appt. Gallery 360 309 Hay Street, Subiaco 6008. T (08) 9381-6577. E [email protected] W www.gallery360.com.au H Mon-Fri 8.30 to 5.30, Thurs 8.30 to 6.30, Sat 9.00 to 4.00. Lawrence Wilson Art Gallery UWA, 35 Stirling Highway (cnr Fairway), Crawley Anne Jeppe, Venus Con-Cave, c.1987, assemblage from found 6009. T (08) 6488-3707. E [email protected] materials with painted plaster cast W lwag.uwa.edu.au H Tues-Sat 11.00 to 5.00. © the artist To Dec 8 No Second Thoughts: Reflections on the Courtesy the artist and Lawrence Wilson Art Gallery ARTEMIS Women’s Art Forum – including newly commissioned works and archival material, this Linton & Kay Galleries exhibition examines the legacy of The ARTEMIS Women’s Art Forum, a group who aimed to raise West Perth the status of women in the arts and to foster interest 11 Old Aberdean Place, West Perth 6005. in women’s art practice and ideas. Presented T (08) 6465 4314. E [email protected] by the Cruthers Collection of Women’s Art. Also, W www.lintonandkay.com.au H Mon-Sat 10.00 to 4.00. HERE&NOW18: Besides, it is always others who die new works from Western Australian artists. Perdita Linton & Kay Galleries Phillips, Alex Spremberg, Carly Lynch, Peter & Molly, Subiaco Julie Dowling and Bjoern Rainer-Adamson respond to the challenge of contemporary art set by Marcel 299 Railway Road (cnr Nicholson Rd), Subiaco Duchamp 100 years ago. Also, Stockyards and 6008. T (08) 9388-3300. Saddles: A story of Gibb River Station. Presented E [email protected] by the Berndt Museum, this exhibition explores the W www.lintonandkay.com.au H Mon-Sat 10.00 to lives of those living and working on the remote cattle 4.00, Sun 11.00 to 4.00. To Oct 21 Investment Art station of Gibb River in the East Kimberley region from and Secondary Sales. the early 1900s until the 1990s.

Western Australia 163 Geraldton Regional Art Gallery Greater Perth 24 Chapman Road, Geraldton 6530. T (08) 9956-6750. E [email protected] W artgallery.cgg.wa.gov.au H Mon-Sat 10.00 to John Curtin Gallery 4.00, public hols 1.00 to 4.00. Oct 12 to Nov 24 Building 200, Curtin University, Kent Street, Bentley Assembling Parts For A Bigger Picture – Nicole 6102. T (08) 9266-4155. E [email protected] Slatter, Susanna Castleden, Bevan Honey and W jcg.curtin.edu.au Free entry. H Mon-Fri 11.00 to Bruce Slatter. 5.00, Sun 12.00 to 4.00. Linton & Kay Galleries Mandoon Estate Gallery 10 Harris Road, Cavisham 6055. T (08) 6465-4314. E [email protected] W www.lintonandkay.com.au H Fri-Sun and public hols 11.00 to 5.00. To Oct 21 Women Of The West – Samantha Dennison, Jenni Doherty, Barbara George, Sandie Schroder, Jean Sher and Fi Wilkie. Bruce Slatter and Nicole Slatter, Suburban Picturesque, 2018, oil on board, 60 x 120cm Mundaring Arts Centre Courtesy the artists and Geraldton Regional Art Gallery 7190 Great Eastern Hwy, Mundaring 6073. T (08) 9295-3991. Jahroc Galleries E [email protected] 83 Bussell Highway, Margaret River 6285. W www.mundaringartscentre.com.au Free entry. T (08) 9758-7200. E [email protected] H Tues-Fri 10.00 to 5.00, Sat-Sun 11.00 to 3.00, W www.jahroc.com.au H Daily 10.00 to 5.00. closed Mon and public hols. To Nov 4 Instrumental: The distinct pleasures of tools. Oct 7 to Nov 16 Re-Imagined Railyard. Also, Remembering Tomorrow Margaret River Gallery – Rory Paton, Adam Ismail and William Leggett. Shop 4, 1 Charles West Avenue, Margaret River 6285. T (08) 9757-2729. E [email protected] Nyisztor Studio W www.margaretrivergallery.com.au H Mon-Sat 391 Canning Highway, Melville 6156. 10.00 to 5.00, Sun 10.00 to 3.00. T 0414-459-503. E [email protected] W www.nyisztorstudio.com.au Multiple exhibition venues. Artist studios. Oct 27 to Nov 11 Jo Darvall Port Hedland presents key works from several major solo exhibitions Courthouse Gallery held in Singapore and Australia. See ad page 41. 16 Edgar Street, Port Hedland T (08) 9173-1064. E [email protected] W www.form.net. au/project/port-hedland-courthouse-gallery Regional H Mon-Fri 9.00 to 4.30, Sat 9.00 to 3.00. Bunbury Regional Art Gallery 64 Wittenoom Street, Bunbury 6230. T (08) 9792-7323. E [email protected] W www.brag.org.au H Daily 10.00 to 4.00. To Oct 28 Gera Woltjer: C R O S S I N G 3. To Nov 18 Iluka Visions 2018.

Gera Woltjer, Untitled; Swim 31 #1, 2018, digital image Courtesy the artist and Bunbury Regional Art Gallery

164 Western Australia Northern Territory

165 Godinymayin Yijard Rivers Arts and Cultural Centre Stuart Highway, Katherine East 0850. T (08) 8972-3751. E [email protected] W www.gyracc.org.au H Tues-Fri 10.00 to 5.00, Sat 10.00 to 3.00. Darwin Charles Darwin University Art Gallery Ground Floor, Building Orange 12, Casuarina Campus, Darwin 0909. T (08) 8946-6621. E [email protected] W cdu.edu.au/artgallery H Wed-Fri 10.00 to 4.00, Sat 10.00 to 2.00. Visit our website for programs and events. Oct 31 to Feb 16, 2019 Still in my mind: Gurindji location, experience and visuality. Matthew Dhamuliya Gurruwiwi, Banumbirr (Morning Star Poles), natural pigments, feathers, bush string, bush wax and milkwood, 35th Telstra NATSIAA Museum and Art Gallery of the Courtesy the artist and Museum & Art Gallery of the Northern Northern Territory (MAGNT) Territory 19 Conacher Street, The Gardens, Darwin 0820. T (08) 8999-8264. E [email protected] Northern Centre for W www.magnt.net.au Free entry. H Daily 10.00 Contemporary Art (NCCA) to 5.00. To Nov 11, 35th Telstra NATSIAA. The Vimy Lane, Parap 0820. T (08) 8981-5368. National Aboriginal & Torres Strait Islander Art Awards W nccart.com.au H Mon-Fri 10.00 to 4.00, Sat (NATSIAA) is Australia’s longest running and most 10.00 to 2.00, or by appt. Closed public hols. The prestigious Indigenous art award (see ad page 113). Northern Centre for Contemporary Art delivers leading To Feb 17, 2019 Out of the Dark: From the MAGNT local, national and international contemporary art Collection – natural science specimens, history and to Darwin. To Oct 13 Office Works – the central culture objects and artworks from MAGNT’s nationally theme of the exhibition involves working with office- and internationally significant collections. To March 3, place stationary including paper, tape and other 2019 Midawarr | Harvest: Mulkun Wirrpanda and materials usually employed for business purposes. John Wolseley – a unique printmaking collaboration The exhibition comprises of seven artists – Christian between two of Australia’s most distinguished senior Bök, Bill Davies, Stuart Gluth, Christian Clare artists. A touring exhibition developed by the National Robertson, Koulla Roussos, Don Whyte and Kaye Museum of Australia in partnership with Mulkun Strange. These artists will showcase their collective Wirrpanda and John Wolseley (see ad inside front responses to working with office materials. Oct 19 cover). Through Oct Feeling For Pattern: 50 Years to 27 fledgling 2018 – focuses on work developed of Tiwi Pottery – highlights the evolution, style and through experimentation; pushing the boundaries of direction of Tiwi pottery over 50 years. Also, Unruly printmaking materials and techniques. As the Days: Territory Life 1911-1921 – drawing on name implies, it is also the (gentle) pushing of MAGNT’s own Territory History Collection and key CDU printmaking students – emerging artists loans from local collectors and interstate institutions, – towards experimentation, professionalisation this exhibition richly illustrates the challenges of life in of creative practice and exhibiting work in a the Territory in the early 1900s. contemporary art space.

166 Northern Territory Alice Springs Araluen Arts Centre Larapinta Drive, Alice Springs 0870. T (08) 8951-1122. E [email protected] W araluenartscentre.nt.gov.au H Daily 10.00 to 4.00. To Oct 21 Desert Mob 2018 – one of the most anticipated annual events on the Aboriginal and Torres Strait Islander Art calendar. Held annually since 1991, Desert Mob is a powerful articulation of culture, country and contemporary desert life by artists from Desart-member art centres across the Northern Territory, South Australia and Western Australia. www.desertmob.nt.gov.au Artback NT Arts Development and Touring 67 Bath Street, Alice Springs 0871. T (08) 8953-5941. W www.artbacknt.com.au Artback NT is the Northern Territory’s arts development and touring agency. The visual arts program works with individuals, groups and arts- based organisations to present and tour dynamic and exciting visual arts exhibitions nationally Kaye Strange, Rubber-Band DVD, 2011, rubber bands and CD cases, multiple panels, 13.5 x 19cm per panel and within the Northern Territory with a focus on Courtesy the artist and Northern Centre for Contemporary Art the development and promotion of Northern Territory artists. Outstation Gallery 8 Parap Place, Parap, Darwin 0820. Watch This Space ARI T (08) 8981-4822. W www.outstation.com.au 8 Gap Road, Alice Springs 0870. T (08) 8952-1949. Outstation Gallery works directly with art centres in E [email protected] W www.wts.org.au the presentation and promotion of Indigenous art from H Wed-Fri 12.00 to 5.00, *Sat 10.00 to 2.00 the Tiwi Islands, Arnhem Land, the Western Desert, *during exhibitions. Showcasing local, interstate the Kimberley and Central and South Australia. and international emerging and established artists. To Oct 6 Tjala Arts 2018. Oct 19 to Nov 9 Across the Presentation: Thurs Oct 4, 6pm Museum of Intimate River by David Wickens. Memories by Kelly Lee Hickey. Free event. Oct 10 to 27 (opening Fri Oct 12, 6pm) Dal Mar Mediterrane Tactile Arts al Centro Rosso: Arte di strada dalla Vucciria a Mparntwe / From the Mediterranean Sea to the Red Contemporary Craft Studios Centre: Street art from the Vucciria to Mparntwe by and Gallery Chips Mackinolty. Artist talk: Sat Oct 13, 11.30am. 19 Conacher Street (located in the grounds of the Art dinner: Sat Oct 20, 6pm The Silver Spoon – Aoife Museum and Art Gallery of NT), Fannie Bay 0810. Milson, Frankie Snowdon, Jonny Rowden and Zoya T (08) 8981-6616. E [email protected] Godoroja-Prieckaerts. Visit wts.org.au to book tickets. W www.tactilearts.org.au H Tues-Sat 10.00 to Presentation: Wed Oct 24, 6pm ARTalks, curated by 4.00. Tactile Arts is a not-for-profit, member based, Kieran Finnance and Jenny Taylor. Located at Red Hot community arts organisation supporting artists and Arts. Free event. artisans throughout the Top End of Australia. Oct 19 to Nov 4 Lunaria, Blossoms, Birdies & Besties: Luna Bird.

Northern Territory 167 Queensland

168 Jan Manton Art Brisbane Contemporary Australian + International Art Andrew Baker Art Dealer 1/93 Fortescue Street, Spring Hill 4000. T (07) 3831-3060, 0419-657-768. 26 Brookes Street, Bowen Hills 4006. E [email protected] W www.janmantonart.com T (07) 3252-2292, 0412-990-356. Director: Jan Manton. H Wed-Fri by appt, Sat E [email protected] W www.andrew-baker.com 10.00 to 4.00 no appt required. Jan Manton Art H Wed-Sat 10.00 to 5.00, or by appt. has a changing program of leading and emerging Paintings, photographs, prints and sculptures by contemporary artists. Oct 3 to 27 Surge by Michelle leading contemporary Australian, Melanesian and Gilbert. Also, New Work by Kate McKay. Polynesian artists, including: Lincoln Austin, Leonard Brown, Michael Cook, Karla Dickens, Ruki Famé (PNG), Fiona Foley, Simon Gende (PNG), Taloi Havini (Bougainville), Dennis Nona (Torres Strait), Ömie Artists (PNG), Michel Tuffery (New Zealand/ Polynesia), Katarina Vesterberg and William Yang. To Oct 20 Apophoria (The way of negation) by Leonard Brown. Contemporary Art Awards Exhibitions T 0407-739-871. E [email protected] W www.contemporaryartawards.com H Mon-Sat 10.00 to 5.00. Oct 1 to 29 Unreal Michelle Gilbert, Through the overgrowth, 2018, oil on linen, Reality by Lauri Smith. 61.5 x 84cm Courtesy the artist and Jan Manton Art FireWorks Gallery 9/31 Thompson Street, Bowen Hills 4006. Jan Murphy Gallery T (07) 3216-1250. E [email protected] 486 Brunswick Street, Fortitude Valley 4006. W www.fireworksgallery.com.au H Tues-Fri 10.00 to T (07) 3254-1855. 6.00, Sat 10.00 to 5.00. To Nov 3 Punch the Clock E [email protected] a group exhibition. W www.janmurphygallery.com.au Director: Jan Murphy. H Tues-Sat 10.00 to 5.00 or by appt. To Oct Graydon Gallery 6 John Nicholson. Oct 9 to 27 James Guppy. Oct 30 to Nov 17 Adam Pyett. 29 Merthyr Road, New Farm 4005. T 0418-740-467. E [email protected] W www.graydongallery. com.au A contemporary gallery available for short term Mitchell Fine Art hire to individual artists/craftsmen or groups to showcase 86 Arthur Street, Fortitude Valley 4006. T (07) 3254- a wide variety of works – painting, sculpture, ceramics, 2297. E [email protected] jewellery, woodcraft, bespoke furniture and fashion. W www.mitchellfineartgallery.com H Mon-Fri 10.00 Taking 2019 bookings enq. email or phone. Oct 2 to 14 to 5.30, Sat 10.00 to 5.00. To Oct 13 George Gary Myers. Oct 18 to 28 (opening Fri Oct 19, 6-9pm) Gittoes. Oct 17 to Nov 10 Min-Woo Bang. Around the Place contemporary narrative landscapes by Brisbane-based visual artist Pamela Gough. Daily 10am Museum of Brisbane to 6pm. www.pamelagough.com Ph: 0439-677-755. Level 3, Brisbane City Hall, Adelaide and Ann streets, King George Square, Brisbane 4000. T (07) 3339-0800. E [email protected] W www.museumofbrisbane.com.au Free entry. H Daily 10.00 to 5.00, Fri 10.00 to 7.00. To Oct 28 Life in Irons: Brisbane’s Convict Stories – provides a vivid insight into daily life in the settlement using original documents, personal accounts and contemporary art, alongside immersive new technologies. Also, 100% Brisbane brings together 100 residents who currently call Brisbane home. Fascinating and deeply moving, their personal Pamela Gough, Home & the Thought of Kells, mixed media on stories will be revealed alongside beliefs and attitudes canvas, 100 x 100cm that shape who we are, creating a real-time snapshot Courtesy the artist and Graydon Gallery of our city.

Queensland 169 Philip Bacon Galleries Redland Art Gallery 2 Arthur Street, Fortitude Valley 4006. Cleveland T (07) 3358-3555. Cnr Middle and Bloomfield streets, Cleveland 4163. E [email protected] T (07) 3829-8899. E [email protected] W www.philipbacongalleries.com.au H Tues-Sat W artgallery.redland.qld.gov.au Free admission. 10.00 to 5.00. Philip Bacon Galleries is the largest H Mon-Fri 9.00 to 4.00, Sun 9.00 to 2.00. and most established dealing gallery in Brisbane. To Oct 14 Redland Art Awards 2018. Oct 21 to Dec We have a large selection of important 19th century, 2 Australian Exotica: A MGA Travelling Exhibition, 20th century and contemporary paintings and and House of Hope: Susan Fell McLean. sculptures in stock. To Oct 20 Vera Moller. Oct 23 to Nov 17 Peter Anderson. Suzanne O’Connell Gallery 93 James Street, New Farm 4005. Queensland Art Gallery | Gallery T (07) 3358-5811, 0400-920-022 F 3358-5813. of Modern Art (QAGOMA) E [email protected] Stanley Place, Cultural Precinct, South Bank Brisbane W www.suzanneoconnellgallery.com Member of ACGA. 4101. T (07) 3840-7303 F 3844-8865. H Wed-Sat 11.00 to 4.00, or by appt. Specialising in W www.qagoma.qld.gov.au Free entry, unless contemporary Australian Indigenous art. Representing otherwise stated. H Daily 10.00 to 5.00. QAG: to Oct leading Aboriginal artists; works include paintings, 7 Tony Albert: Visible. Ongoing Australian Collection fibre and wood carvings. Reimagined. GOMA: Nov 24 to April 28, 2019 The 9th Asia Pacific Triennial of Contemporary Art University of Queensland (APT9). Ongoing James Turrell: Nightlife 2018. Art Museum James and Mary Emelia Mayne Centre (Building 11), QUT Art Museum University Drive, The University of Queensland, St 2 George Street, QUT Gardens Point Campus (next to Lucia 4067. T (07) 3365-3046. the City Botanic Gardens), Brisbane 4000. E [email protected] T (07) 3138-5370. E [email protected] W www.artmuseum.uq.edu.au H Mon-Sat 10.00 W www.artmuseum.qut.edu.au Free entry. to 4.00, Wed 10.00 to 8.00, closed Sun and H Tues-Fri 10.00 to 5.00, Sat-Sun 12.00 to 4.00, public hols. To Nov 10 Defying Empire – bringing closed Mon and public hols. Visit website for programs together works by 30 contemporary Aboriginal and and events. To Nov 4 ‘the churchie’ National Emerging Torres Strait Islander artists from across the country, Art Prize is an exhibition of 35 finalists. This annual commemorating the 50th anniversary of the 1967 exhibition profiles new and emerging artists, and Referendum. To Nov 24 Shirley Macnamara: Layered explores a broad range of contemporary art making, from threads – includes the major installation ‘Mugama new media and installation to traditional mediums. for Country’ (2018) – standing for generations of traditional knowledge, the resilience of Macnamara’s people, and the need to care for Country.

Min Wong, Too fit to quit, 2017, neon, 60 x 200cm Courtesy the artist and QUT Art Museum Redland Art Gallery Capalaba Shirley Macnamara, Mugama for Country (detail), 2018, spinifex, Capalaba Place, Noeleen Street, Capalaba 4157. feathers, bone, ochre and spinifex resin T (07) 3829-8899. E [email protected] Photograph: Carl Warner W artgallery.redland.qld.gov.au Free admission. Courtesy the artist, Alcaston Gallery, Melbourne, and University of H Mon-Wed, Fri 8.30 to 5.00, Thurs 8.30 to 7.30, Queensland Art Museum Sat 9.00 to 4.00. To Oct 9 My Father’s an Artist. Oct 13 to Nov 27 A Consumer’s Guide to Unobtainable Happiness: Susan Gourley.

170 Queensland Gold Coast Sunshine Anthea Polson Art Coast Shop 120 Marina Mirage, 74 Seaworld Drive, Main Beach 4217. T (07) 5561-1166. Montville Art Gallery E [email protected] 138 Main Street, Montville 4560. T (07) 5442-9211. W www.antheapolsonart.com.au E [email protected] Director: Anthea Polson. H Daily 10.00 to 6.00. W www.montvilleartgallery.com.au H Daily 10.00 Oct 27 to Nov 10 Robert Ryan new works, and to 5.00. Marise Maas new works. Gallery at HOTA Noosa Regional Gallery Ground floor, 9 Pelican Street (PO Box 141), HOTA, Home of the Arts Riverside, Tewantin 4565. T (07) 5329-6145. Home of the Arts, 135 Bundall Road, Surfers Paradise E [email protected] 4217. T (07) 5588-4067. E [email protected] W www.noosaregionalgallery.com H Tue-Fri 10.00 W www.hota.com.au Free entry. H Mon-Sun 10.00 to to 4.00, Sat-Sun 10.00 to 3.00. Closed Mon, public 5.00. To Oct 14 ENERGIES 2018 – profiles artwork hols and during exhibition changeovers. To Oct 14 from senior secondary schools across the Gold As far as the eye can see – an exhibition of works by Coast. Oct 20 to Nov 25 Josephine Ulrick And Win prominent Australian printmakers investigating their Schubert Photography Award 2018. Also, Breathing local landscapes. In Trees: Nicola Moss. Yandina Historic House Lorraine Pilgrim Gallery 3 Pioneer Road, Yandina 4561. T (07) 5472-7181. Studio 87, 87 Ridgeway Avenue, Southport 4215. E [email protected] T (07) 5532-7170, 0418-767-495. W www.yandinahistorichouse.com.au Art Gallery Co- E [email protected] ordinator: Fiona Groom [email protected]. W www.lorrainepilgrim.com H Mon-Fri 10.00 to H Daily 9.30 to 2.30. Gallery, craft shop, local 5.00, weekends by appt. Oct 6 to Nov 23 (opening history, local art and artists. Sat Oct 6, 4-6pm) Art and Architecture by Kathy Mackey. Official opening by Brett Adlington, Director, Lismore Art Gallery. South East Region Davson Gallery Lockyer Valley Cultural Centre, 34 Lake Apex Drive, Gatton 4343. T 0416-026-426. E [email protected] W www.davsonarts.com H Mon-Fri 9.00 to 5.00, Sat 9.00 to 12.00, or by appt. See ad page 139. Gympie Regional Gallery 39 Nash Street, Gympie 4570. T (07) 5481-0733. E [email protected] W www.gympie.qld.gov.au/gallery H Tues-Sat 10.00 to 4.00. The gallery promotes the development of the arts as an integral part of the lives and industry of the local community. Oct 11 to 26 Rush Art Competition. Oct 31 to Dec 1 I am that...that I am by Bianca Beetson. Also, Unassuming A Gender by Tyza Stewart.

Kathy Mackey, Judd and Jug, digital photograph Courtesy the artist and Lorraine Pilgrim Gallery

Queensland 171 Toowoomba Regional Cairns Art Gallery Art Gallery Cnr Abbott and Shields streets, Cairns 4870. 531 Ruthven Street, Toowoomba 4350. T (07) 4046-4800. T (07) 4688-6652 F 4688-6895. E [email protected] E [email protected] W www.tr.qld.gov.au/trag Free admission. H Tues-Sat W www.cairnsartgallery.com.au H Mon-Fri 9.00 to 10.00 to 4.00, Sun 1.00 to 4.00, closed Mon and 5.00, Sat 10.00 to 5.00, Sun 10.00 to 2.00. public hols. To Oct 28 Toowoomba Biennial Emerging To Oct 7 Olaf & Kerstens: Erwin Olaf and Hendrick Artist Award & Exhibition. To Nov 4 kanalaritja: An Kerstens. To Nov 11 The Tim Fairfax Gift: A World Unbroken String. View To Nov 18 The Nature of Blue by Mollie Bosworth. Sept 28 to Nov 25 Between Nature and Sin by David Griggs. Gab Titui Cultural Centre Cnr Blackall Street and Victoria Parade, Thursday Island 4875. T (07) 4069-0888. E [email protected] W www.gabtitui.com.au H Mon-Fri 9.00 to 4.30, Sat 10.00 to 3.00. KickArts Contemporary Arts 96 Abbott Street, Cairns 4870. T (07) 4050-9496. E [email protected] W www.kickarts.org.au H Mon-Sat 10.00 to 5.00. KickArts is regional Queensland’s leading contemporary visual arts Ashlee Murray, 2016, king marina shells organisation and presents a program of local, national Purchased TMAG Foundation 2016 and international artists. Courtesy Tasmanian Museum and Art Gallery, Tasmania, and Toowoomba Regional Art Gallery Western Far North District Artspace Mackay Dogwood Crossing, Miles Civic Precinct, cnr Gordon and Macalister Streets, Mackay 4740. T (07) 4961-9722. 81 Murilla Street, Miles 4415. T (07) 4628-5330. E [email protected] E [email protected] W www.artspacemackay.com.au Free admission. W www.dogwoodcrossing.com Free entry. H Mon-Fri H Tues-Fri 10.00 to 5.00, Sat-Sun 10.00 to 3.00. 9.00 to 5.00, Sat 10.00 to 2.00, closed Sun. To Oct 28 Familiar distance: Clara Adolphs. To Nov 6 John Mullins Memorial Art Gallery: Voyages To Nov 25 On yer bike. Sept 29 to Nov 18 Ray White Botanical – an exhibition of solar plate engravings by Mackay City: Postcard Exhibition & Competition. Christine Johnson. Curved Wall: Thirteen Years in Review – an exhibition of paintings and drawings by Bundaberg Regional Galleries Kerryn Rabone. 1 Barolin Street, Bundaberg 4670. T (07) 4130-4750. E [email protected] W www.bundabergregionalgalleries.com.au H Mon-Fri 10.00 to 5.00, Sat-Sun and public hols 9.00 to 1.00. To Oct 7 Happy Birthday Play School: Celebrating 50 Years – National Museum of Australia. Also, Dreamscape by Maki Horanai.

172 Queensland Artist Index

173 Abidin, Beau Ziggy Gaffa Gallery SYD Brar, Harsimjeet Watt Space NSW Curry, Sandra Factory 49 SYD Abidin, Soraya Gaffa Gallery SYD Brassington, Pat Wollongong Art Gallery NSW Cuthbertson, Mark Montalto Sculpture Prize VIC Adamson-Pincweski, Samara Contemporary Art TAS TAS Breathe Earth Collective RMIT Gallery MEL Cuthbertson, Mark Tesselaar Tulip Festival VIC Adolphs, Clara Artspace Mackay QLD Breen, William Flinders Lane Gallery MEL Cyrulla, Dagmar Wagner Contemporary SYD AES+F PICA WA Brennan, Angela Niagara Galleries MEL d’Antoine, Camilla Merricks House VIC Ahead, Curves Red Gallery MEL Brereton, Kurt Jervis Bay Maritime NSW Dagnall, Bec Moores Building WA Ahmett, Irwan George Paton Gallery MEL Brice, Meredith Blue Mountains City NSW Damichi, Claudia Olsen Gallery SYD Akalani, Hana Moores Building WA Bridgewater, Robert Niagara Galleries MEL Darvall, Jo Nyisztor Studio WA Albert, Tony QAG/GOMA QLD Brombley, Andrew Western Sydney SYD Davenport, Jo Flinders Lane Gallery MEL Allen, Nicole Tesselaar Tulip Festival VIC Brooke, Julie MAY SPACE SYD Daverington, Peter Arc One MEL Allen, Tim Gallerysmith MEL Brophy, Charlie BlackCat Gallery MEL Davey, Philip Whitehorse Art Space MEL Alvi, Elyas Walker Street Gallery MEL Brown, Jeff Broken Hill Regional NSW Davidson Lauraine Diggins MEL Alwast, Peter Gallery 9 SYD Brown, Leonard Andrew Baker Art Dealer QLD Davies, Bill NCCA NT Amor, Rick Niagara Galleries MEL Buchanan, Susan Queen Victoria Museum TAS Davies, Gerwyn Art Gallery of Ballarat VIC Ampleyeva, Anna Walker Street Gallery MEL Buic, Kagetsu Studio B Gallery MEL Davies, Johanna Western Sydney SYD Anderson, Helen Tacit Galleries MEL Burns, Ian Plimsoll Gallery TAS Davies, Sylvia Ceramic Break NSW Anderson, Kim Art Gallery of Ballarat VIC Burruwal, Bob Alcaston Gallery MEL Davis, Mark Blue Mountains City NSW Anderson, Peter Philip Bacon Galleries QLD Burry, Jane RMIT Gallery MEL Davis, Penelope Queen Victoria Museum TAS Andrew, Brook Ten Cubed MEL Butler, Josh Thienny Lee Gallery SYD Davis-Hartwig, Erin Wangaratta Gallery VIC Arcier, Virginie Faivre d Walker Street Gallery MEL Byrnes, Richard Robin Gibson Gallery SYD Davson, Sharon Davson Gallery QLD Argyros, Troy Melbourne Studio of Art MEL Cahill, Lisa Canberra Glassworks ACT Dawes, Debra Wollongong Art Gallery NSW Armstrong, Bruce Aust. Print Workshop MEL Cai, Ri Ying Red Gallery MEL Dawson, Marley Roslyn Oxley9 Gallery SYD Arvilla, Randal ARO SYD Cain, Penelope SCA Galleries SYD De Biasi, Stephanie Heathcote Museum WA Atahi, Zia Walker Street Gallery MEL Callaghan, Max FELTspace SA De Luca, Rox Articulate Project Space SYD Auer, Thomas RMIT Gallery MEL Callow, Sharon Heathcote Museum WA Deacock, Kate Western Sydney SYD Auld, Ros Blue Mountains City NSW Camden-Pratt, Catherine Western Sydney SYD Deacon, Rosie Bega Valley Regional NSW Austin, Daryl Greenaway Gallery SA Cameron, Faridah Art Gallery of Ballarat VIC Deirmendijan, Gary Adelaide Central Gallery SA Austin, Lincoln Andrew Baker Art Dealer QLD Capobianco, Jason Defiance Gallery SYD deMontignie, Leon MAMA NSW Avano, Marisa MAS Gallery MEL Cardinet, Carolyn Yering Station MEL Dennison, Samantha Linton & Kay Fine Art WA Avila, Marynes Montalto Sculpture Prize VIC Carment, Tom Museum of Sydney SYD Derrett, Peter Lismore Regional NSW Ayres, Phil RMIT Gallery MEL Carosi, Gregory Alternating Current MEL Derz, Shoufay Artereal Gallery SYD Babic, Robert Art at St Francis MEL Carroll, Ben Montalto Sculpture Prize VIC deVille, Julia Linden New Art MEL Baker, Su Nicholas Thompson MEL Carson, Lucile M16 Artspace ACT Dhir, Kalanjay SCA Galleries SYD Bakker, Jeremy RMIT Project Space MEL Castleden, Susanna Geraldton Regional WA Dhoyou, Lobsan Walker Street Gallery MEL Baldessin, George Australian Galleries MEL Cattell, James Carlisle Street Arts Space MEL Diacolabrianos, Zoe Counihan Gallery MEL Baldessin, George Lauraine Diggins MEL Catts, Oron Art Gallery of WA WA Dick, Morgan Gaffa Gallery SYD Baldessin, George NGV Ian Potter Centre MEL Cavaniglia, Consuelo Margaret Lawrence MEL Dickens, Karla Andrew Baker Art Dealer QLD Ball, Sydney Sullivan+Strumpf SYD Cervinkova, Stepanka George Paton Gallery MEL Dickerson, Robert Manly Art Gallery SYD Ballard, Kristine Manyung Gallery Mt Eliza VIC Chandler, Sadie Shepparton Art Museum VIC Dilkes, Helen RMIT Gallery MEL Banfield, Elizabeth Stephen McLaughlan MEL Chant, Sheryl Moores Building WA Dillon, Beth UNSW Galleries SYD Bang, Min-Woo Mitchell Fine Art QLD Chappell, Danica Heide Museum MEL Dillon, Damian Adelaide Central Gallery SA Bannon, Cheryle CAS Inc. MEL Charadia, Joshua Rex-Livingston Art NSW Dixon, Maz Fox Galleries MEL Barkley, Glenn Niagara Galleries MEL Chaseling, Scott Canberra Glassworks ACT Dobbie, Xanthe La Trobe Art Institute VIC Barrett, Clark Broken Hill Regional NSW Cho, Eun Ju Contemporary Art TAS TAS Dobell Lauraine Diggins MEL Basseghi, Sofi Bundoora Homestead MEL Choi, Eugene Peacock Gallery SYD Dodi, Indra Defiance Gallery SYD Batt, Terry Niagara Galleries MEL Choi, Eugene SCA Galleries SYD 'RùUXV|],KVDQ %OXH0RXQWDLQV&LW\ 16: Batuner, Yula Walker Street Gallery MEL Christmann, Gunter Niagara Galleries MEL Doherty, Jenni Linton & Kay Fine Art WA Beale, Roger Maunsell Wickes SYD Christophersen, Tom Stanley Street Gallery SYD Done, Ken Ken Done SYD Beck, Lyndall Wallarobba Arts SYD Chyon, Gyungju RMIT Gallery MEL Donnelly, Hannah Peacock Gallery SYD Beer, Emma Gaffa Gallery SYD Ciccarone, Julie Niagara Galleries MEL Douglas, Kate Ipswich Art Gallery QLD Beetson, Bianca Gympie Regional Gallery QLD Cirillo, Jude Strathnairn Arts ACT Dowling, Julie Lawrence Wilson WA Beevors, Michele Articulate Project Space SYD Cironis, Olga PICA WA Dowling, Julie Niagara Galleries MEL Begley, Ciaran SCA Galleries SYD CITA RMIT Gallery MEL Downhill, Kate Blue Mountains City NSW Beilharz, Hannah Alternating Current MEL Civil, Tom Tinning Street MEL Doyle, David Tesselaar Tulip Festival VIC Belfrage, Clare JamFactory Seppeltsfield SA Clared, Hilary Salamanca Arts Centre TAS Drendel, Graeme Tweed River Regional NSW Benham, Malcolm Wollongong Art Gallery NSW Clark, Tony Sullivan+Strumpf SYD Driessen, Ralf Montalto Sculpture Prize VIC Bennetts, Barbara Mildura Arts Centre VIC Clinch, Robert Broken Hill Regional NSW Drummond, Rozalind Bundoora Homestead MEL Bennie, Chris ACP Project Space SYD Cloke, Sally Watt Space NSW Drysdale Lauraine Diggins MEL Benwell, Stephen Niagara Galleries MEL Clyne, Melinda Gaffa Gallery SYD Du, Jenny Gaffa Gallery SYD Benwell, Stephen Wollongong Art Gallery NSW Cochrane, Jennifer Lakeside Joondalup WA Duke, Marion Moores Building WA Berean, Jen MADA MEL Cochrane, Jessica Wollongong Art Gallery NSW Dunlop, Sophie Art Atrium SYD Berling, Robyne Ceramic Break NSW Colbourne, Brodie BlackCat Gallery MEL Dunstan, Clare Eltham Library MEL Berner, Peter Project Gallery 90 SYD Collier, Betty Tesselaar Tulip Festival VIC Dupois, Nanou Red Gallery MEL Berney, Kathleen BAROMETER Gallery SYD Collin, Charles Lake Macquarie City NSW Duterrau, Benjamin Queen Victoria Museum TAS Bethel, Lee Wollongong Art Gallery NSW Collins, Laurie Red Tree Gallery VIC Eager, Helen Wollongong Art Gallery NSW Bevan, Tony Niagara Galleries MEL Collocott, Michelle Bathurst Regional NSW Earl, Helen Coffs Harbour Regional NSW Beyhan, Cenk Blue Mountains City NSW Combes, Janine Queen Victoria Museum TAS Eastman, Leslie RMIT Gallery MEL Bilotta, Aldo Tesselaar Tulip Festival VIC Cone 11 Coffs Harbour Regional NSW Eastwood, David UNSW Galleries SYD Bilu, Asher Art Gallery of Ballarat VIC Connelly, Peter Gaffa Gallery SYD Eaton, Janenne CCAS - Gorman Arts ACT Bird, Luna Tactile Arts NT Connor, Kevin Orange Regional NSW Eden, Anna Bett Gallery Hobart TAS Bird, Stephen Olsen Gallery SYD Connor, Paul Art Atrium SYD Eden, Ebony Wollongong Art Gallery NSW Bishop, John Tesselaar Tulip Festival VIC Cook, Helle Latrobe Regional VIC Edney, Katherine Robin Gibson Gallery SYD Blackman Lauraine Diggins MEL Cook, Michael Andrew Baker Art Dealer QLD Egan, James Moores Building WA Blackwell, James Blue Mountains City NSW Cook, Michael Western Plains Centre NSW Egan, Sharyn Moores Building WA Bloor, Sam Heathcote Museum WA Cooke, Carol Strathnairn Arts ACT Elenberg, Joel Museum of Sydney SYD Boddy, Adrian Justin Art House MEL Cooke, Mela Montalto Sculpture Prize VIC Elliot, Michelle Articulate Project Space SYD Bodenham, Bridget Coffs Harbour Regional NSW Coombes, Raphe Rex-Livingston Art NSW Elliott, Judi Canberra Glassworks ACT Bök, Christian NCCA NT Coombs, Courtney George Paton Gallery MEL Elson, Sarah Lakeside Joondalup WA Boneu, Marie-Do Hyman Walker Street Gallery MEL Copland, Stephen Blue Mountains City NSW Enzenhofer, Lisa Maria RMIT Gallery MEL Borland, Polly NGV Ian Potter Centre MEL Corompt, Martine Latrobe Regional VIC Erlich, Esther Frances Keevil Gallery SYD Boros, Julia Gallerysmith MEL Cottrell, Chris RMIT Gallery MEL Eshraghian, Elham Heathcote Museum WA Borries, Friedrich von RMIT Gallery MEL Coutts, Maryanne Australian Galleries MEL Eshraghian, Ellie Moores Building WA Boston, Paul Niagara Galleries MEL Cowie, Jane Canberra Glassworks ACT Evans, Catherine RMIT Project Space MEL Bosworth, Mollie Cairns Art Gallery QLD Cox, Philip Museum of Sydney SYD Evans, Mandy Western Sydney SYD Both, Julia Walker Street Gallery MEL Crappsley, Ben Moores Building WA Face, Kissy Gaffa Gallery SYD Bounpraseuth, Mechelle MAMA NSW Crick, Tex Wollongong Art Gallery NSW Fairbairn, Ember Manyung Gallery Malvern MEL Bowen, Dean Montalto Sculpture Prize VIC Croft, Brenda L. Niagara Galleries MEL Fairhall, Caspar Lakeside Joondalup WA Bowers, Tania Blue Mountains City NSW Crooke Lauraine Diggins MEL Famé, Ruki Andrew Baker Art Dealer QLD Boyd Lauraine Diggins MEL Cross, Dean ACP Project Space SYD Featherston, Grant Heide Museum MEL Boyd, Daniel Roslyn Oxley9 Gallery SYD Cross, Dean Tributary Projects ACT Featherston, Mary Heide Museum MEL Boyd, Kevin Whitehorse Art Space MEL crowEST, Sarah Ararat Gallery TAMA VIC Fell, Fiona Watters Gallery SYD Boylan, Jessie Bendigo AG VIC Cullen, Adam Cullen MEL Ferran, Anne Mornington Peninsula MEL Braddock, Jana Moores Building WA Cunningham, Jodie M16 Artspace ACT Ferri, Chantelle BlackCat Gallery MEL Brain, Tega Plimsoll Gallery TAS Cunningham, Merce Aust. Print Workshop MEL Fink, Fred Glass Artists’ Gallery SYD

Artist Index Fitzgerald, Elizabeth Western Sydney SYD Headlam, Kristin Charles Nodrum Gallery MEL Kain, Kirtika Adelaide Central Gallery SA Fitzmaurice, John Montalto Sculpture Prize VIC Hearnes, Emma Maffra Exhibition Space VIC Kasarin & Krongkwan BlackCat Gallery MEL Fletcher, Thancoupie Gloria UTS Gallery SYD Heed, Maria Walker Street Gallery MEL Keefe, Jacinta George Paton Gallery MEL Florance, Caren Megalo Print Gallery ACT Heer, Rolf de Anne & Gordon Samstag SA Keeling, David Niagara Galleries MEL Foenander, Wayne Tesselaar Tulip Festival VIC Heffer, Cecilia Gaffa Gallery SYD Kelly, Madeleine Wollongong Art Gallery NSW Foley, Fiona Andrew Baker Art Dealer QLD Heiss, Leah Warrnambool Art Gallery VIC Kendall, Yvonne Niagara Galleries MEL Foley, Fiona Niagara Galleries MEL Henderson, Brad Frankston Arts Centre VIC Kennedy, Simon Gallery 9 SYD Folland, Nicholas Tolarno Galleries MEL Heng, Euan Niagara Galleries MEL Kentridge, William Annandale Galleries SYD Foote, Graeme Hawthorn Studio MEL Henshall, Phil Phil Henshall Studio VIC Kentridge, William Art Gallery of NSW SYD Forster, Rosalind Gecko Studio Gallery VIC Hesterman, Heather Gee Lee-Wik Doleen MEL Kermany, Bahman Frances Keevil Gallery SYD Fosdike, Tahney George Paton Gallery MEL Hewat, Sue Suki & Hugh Gallery NSW Kerr, Mel Tacit Galleries MEL Foster, Pat MADA MEL Hickey, Dale Niagara Galleries MEL Kerstens, Hendrick Cairns Art Gallery QLD Frankovich, Alicia MUMA MEL Hickey, Kelly Lee Watch This Space NT Kettels, Rob Heathcote Museum WA Frantastic Fran Jungle’s Art Studio SA Hicks, Petrina THIS IS NO FANTASY MEL Khounpasert, Sone Walker Street Gallery MEL Franzi, Cathy Sabbia Gallery SYD Higgins, Jess CCAS - Gorman Arts ACT Kim, Myunghee Tacit Galleries MEL Freeman, Sara Suki & Hugh Gallery NSW Hikmet, Zainab BLINDSIDE MEL Kimber, Elaine Gate 6 Gallery MEL Freer, Gabrielle Gaffa Gallery SYD Hill, Justin Australian Tapestry MEL Kimber, Mark Greenaway Gallery SA French, Brenden Scott Sabbia Gallery SYD Hingston, Ruth M16 Artspace ACT King, Louiseann Art Gallery of Ballarat VIC French, Suzy Hawthorn Studio MEL Hinterding, Joyce RMIT Project Space MEL King, Martin Gallerysmith MEL Friend Lauraine Diggins MEL Hiraki, Yumemi George Paton Gallery MEL Kingston, Peter Museum of Sydney SYD Furlonger, Joe Defiance Gallery SYD Hodge, Gregory Wollongong Art Gallery NSW Kinnane, Aaron Scott Livesey Galleries MEL Gailer, Katherine Walker Street Gallery MEL Hodges, Christopher Utopia Art Sydney SYD Kirkegaard, Jacob RMIT Project Space MEL Galligan, Briony George Paton Gallery MEL Hofter, Sibylle Articulate Project Space SYD Kitamira, Junko Moores Building WA Gambotto, Joanna Thienny Lee Gallery SYD Hogan, Sean La Trobe Art Institute VIC Klavins, Bernadette Adelaide Central Gallery SA Garcia, Caroline La Trobe Art Institute VIC Hohaus, Herman Australian Galleries MEL Klippel, Robert Annette Larkin Fine Art SYD Garcia, Katrina Gaffa Gallery SYD Holding, Judy Montalto Sculpture Prize VIC Kluge-Pott, Hertha Australian Galleries MEL Garland, Lisa Despard Gallery TAS Hollyoak, Polly Red Gallery MEL Kluss, Benjamin Contemporary Art TAS TAS Gatt, Jeff Handmark Gallery TAS Holmes, Lily Tinning Street MEL Knighton, Katy Tesselaar Tulip Festival VIC Gavino, Fiona Moores Building WA Holt, William William Holt Gallery MEL Kollath, Edith RMIT Gallery MEL Gemmell, Liz BAROMETER Gallery SYD Homa, Amir Tehrami Walker Street Gallery MEL König, Bernhard RMIT Gallery MEL Gende, Simon Andrew Baker Art Dealer QLD Home, Dean Art House Gallery SYD Koroluk-Stephenson, Amber Bett Gallery Hobart TAS Gente, La Gaffa Gallery SYD Honey, Bevan Geraldton Regional WA Kosloff, Laresa MADA MEL George, Barbara Linton & Kay Fine Art WA Hook, Sally Frances Keevil Gallery SYD Kotai, Eveline Lakeside Joondalup WA George, Martin Montalto Sculpture Prize VIC Hopkins, Colin Coffs Harbour Regional NSW Kovacs, Ildiko Martin Browne SYD George, Phillip Art Gallery of Ballarat VIC Hopmeier, Paul Defiance Gallery SYD Kronenberg, Caroline Gaffa Gallery SYD Gevers, Stefan Suki & Hugh Gallery NSW Horanai, Maki Bundaberg Regional QLD Kutschbach, Michael Adelaide Central Gallery SA Giannini, Eli Queen Victoria Museum TAS Hornum, Emily Lakeside Joondalup WA Kyle, Dan Defiance Gallery SYD Giardino, Pasquale Brightspace MEL Horton, Ede Langford 120 MEL La Maitre, Sophie Heathcote Museum WA Gibbs, Bronwen Mildura Arts Centre VIC Hosking, Jane Manning Regional NSW Laird, Karina Frankston Arts Centre VIC Gibson, Ricky Moores Building WA Hout, Ronnie van Buxton Contemporary MEL Lal, Shivanjani Peacock Gallery SYD Gilbert, Darren Bolin Bolin Gallery MEL Howlett, Leonora Penrith Regional SYD Lam, Nikki Peacock Gallery SYD Gilbert, Michelle Jan Manton Art QLD Howlin, Jan Frances Keevil Gallery SYD Lane, Nancy D Guild Assembly Point MEL Gilby, Simon Moores Building WA Hromek, Danièle UTS Gallery SYD Lane, Suzanne Ceramic Break NSW Gilson, Marlene Art Gallery of Ballarat VIC Hsu, Chen Alternating Current MEL Langlois, Chris Olsen Gallery SYD Giraud, Fabien Mona TAS Hubble, Tessa Yering Station MEL Lankas, Peter Gallery 139 NSW Gittoes, George Mitchell Fine Art QLD Hudson, Carol STACKS Projects SYD Larter, Richard Niagara Galleries MEL Gleeson Lauraine Diggins MEL Hudson, Kate Aust. Print Workshop MEL Larwill, David Larwill Studio MEL Gluth, Stuart NCCA NT Hughes, Sarah Contemporary Art TAS TAS Lasmanis, Ilona Firestation Print Studio MEL Glynn, Anna Margaret Whitlam SYD Hugill, Peter Manning Regional NSW Latifi, Mehrnoush RMIT Gallery MEL Godoroja-Prieckaerts, Zoya Watch This Space NT Hugill, Yvette Manning Regional NSW Laurent, Titane Laurent Gallery MEL Godwin, Peter Defiance Gallery SYD Humphries, Chris Tinning Street MEL Laurie, Ross King Street Gallery SYD Goldblatt, David MCA SYD Hunniford, Mandy Queen Victoria Museum TAS Laycock, Robyn Moores Building WA Golightly, David Falkner Gallery VIC Hunter, Robert Annette Larkin Fine Art SYD Leahy, Jennifer Blue Mountains City NSW Gonzalez, Kathleen Walker Street Gallery MEL iiyama, Taro Wangaratta Gallery VIC Leary, Jacob Contemporary Art TAS TAS Gossage, Star Niagara Galleries MEL Inkamala, Beth Alcaston Gallery MEL Leary, Jacob Plimsoll Gallery TAS Gough, Jennifer Cambridge Studio MEL Inkamala, Kathy Vivien Anderson Gallery MEL LeCerf, Carly Southern Buoy Studios VIC Gough, Pamela Graydon Gallery QLD Isabel, Gabriela Walker Street Gallery MEL Lee, Gill Tesselaar Tulip Festival VIC Gourley, Susan Redland Art Gallery QLD Ismail, Adam Mundaring Arts Centre WA Lee, Rod Tesselaar Tulip Festival VIC Gower, Elizabeth Geelong Gallery VIC Israelian, Hovik Tesselaar Tulip Festival VIC Lees, Stephen Colville Gallery TAS Grabner, Michelle Niagara Galleries MEL Ivanoff, Vladimir Tesselaar Tulip Festival VIC Leggett, William Mundaring Arts Centre WA Graeve, Michael Contemporary Art TAS TAS Jaaniste, Joanna Western Sydney SYD Lehman, Chelsea Adelaide Central Gallery SA Griffin, Matthew Fine Arts, Sydney SYD Jaanz, Lynn Lynn Jaanz Art Gallery MEL Lehmann, Chelsea UNSW Galleries SYD Griggs, David Cairns Art Gallery QLD Jacks, Robert Museum of Sydney SYD Lepisto, Jeremy Canberra Glassworks ACT Guerrilla Girls NGV International MEL Jackson, Roy Defiance Gallery SYD Lever, Anita Western Sydney SYD Guichard, Frederique Walker Street Gallery MEL James, Stu Australian Galleries MEL Lew, Zelman Crowther Contemporary MEL Gullifer, Myfanwy King Street Gallery SYD Janbaz, Mirwais Walker Street Gallery MEL Lewis, Vanessa Watt Space NSW Gumana, Malaluba Niagara Galleries MEL Janzen, Ona Blue Mountains City NSW Lezaic, Katrina Gaffa Gallery SYD Guppy, James Jan Murphy Gallery QLD Jarrett, Brett Bay of Whales Gallery VIC Lim, Jihyun Walker Street Gallery MEL Haddon, Neil Contemporary Art TAS TAS Jass, Rudi Montalto Sculpture Prize VIC Lincoln, Kevin Defiance Gallery SYD Hadlow, Marcia Moores Building WA Javan, Katayoun Bundoora Homestead MEL Lincoln, Kevin Gippsland Art Gallery VIC Hagborg, Heather Dewey PICA WA Jensz, David Art Gallery of Ballarat VIC Lincoln, Kevin Niagara Galleries MEL Haider, Rubaba Niagara Galleries MEL Jenyns, Bob Gallery on Sturt VIC Lindsay, Norman Norman Lindsay Gallery NSW Haines, David RMIT Project Space MEL Jeschaunig, Markus RMIT Gallery MEL Ling, Song Niagara Galleries MEL Hali, Clara Defiance Gallery SYD Jing, Leah George Paton Gallery MEL Linnell, Sheridan Western Sydney SYD Hall, Adrian Articulate Project Space SYD Johns, Kerry Artsite Galleries SYD Little Wonder RMIT Gallery MEL Hall, Jenny BlackCat Gallery MEL Johns-Messenger, Natasha RMIT Gallery MEL Lober, Angela Blue Mountains City NSW Hamilton, Emma ACP Project Space SYD Johnson, Christine Dogwood Crossing QLD Lock, Christian Greenaway Gallery SA Hamilton, Jim Montalto Sculpture Prize VIC Johnson, Jess Wollongong Art Gallery NSW Lockhart, Adrian Frances Keevil Gallery SYD Hanks, Rew Watters Gallery SYD Johnson, Pia Bundoora Homestead MEL Lolicato, Salvatori Carlisle Street Arts Space MEL Hanna, Tadros Walker Street Gallery MEL Jolly, Keiren Gaffa Gallery SYD Long, Honey ACP Project Space SYD Hanson, Shavaurn Moores Building WA Jones, Dianne Blue Mountains City NSW Loughhead, Anja Peacock Gallery SYD Harding, Matthew Montalto Sculpture Prize VIC Jones, Dianne Niagara Galleries MEL Low, Janelle Bundoora Homestead MEL Hardy, Sarah Eltham Library MEL Jones, Jonathan UTS Gallery SYD Lowry, Fiona Martin Browne SYD Hargraves, Geoff Glass Artists’ Gallery SYD Jones, Jonathon Bathurst Regional NSW Luccio, Marco fortyfivedownstairs MEL Harris, Brent Neon Parc MEL Jones, Thea Peacock Gallery SYD Lundy, Alex CCAS - Manuka ACT Harris, Penny Wollongong Art Gallery NSW Jones, Tim Aust. Print Workshop MEL Lynch, Carly Lawrence Wilson WA Harrison, Dr Aunty Eileen Gippsland Art Gallery VIC Joseph, Dinusha Tacit Galleries MEL Lyon, Meaghan Box Hill Community Arts MEL Harrison, Misha Wollongong Art Gallery NSW Joseph, Jennifer Niagara Galleries MEL Ma, Yesol George Paton Gallery MEL Hart, Bill Plimsoll Gallery TAS Joshi, Sweety Walker Street Gallery MEL Maas, Marise Anthea Polson Art QLD Haselton, Louise Adelaide Central Gallery SA Juli, Mabel UTS Gallery SYD MacDonald, Craig Frankston Arts Centre VIC Hastings, Rebecca Flinders Lane Gallery MEL Jumaadi King Street Gallery SYD MacDonald, Travis Niagara Galleries MEL Hatton, Beth BAROMETER Gallery SYD Jurss, Debra ANCA ACT Macgowan, Tempe Gaffa Gallery SYD Havini, Taloi Andrew Baker Art Dealer QLD KAAM Tacit Galleries MEL Mackey, Kathy Lorraine Pilgrim QLD Headache _ Stencil BlackCat Gallery MEL Kadillari, Silvi Heritage Hill MEL Mackinnon, William Hugo Michell Gallery SA

Artist Index 175 Mackinolty, Chips Watch This Space NT Murri, Frank Contemporary Art TAS TAS Qinwu, HU Niagara Galleries MEL Macleod, Euan Niagara Galleries MEL Muscat, Noel Tesselaar Tulip Festival VIC Quilty, Andy Lakeside Joondalup WA Macleod, Euan Watters Gallery SYD Musgrove, Betty Bundoora Homestead MEL Quinteros, Samuel Penrith Regional SYD Macnamara, Shirley Uni QLD Art Museum QLD Myers, Gary Graydon Gallery QLD Rabin, Eilat Frances Keevil Gallery SYD Macpherson, Robert Annette Larkin Fine Art SYD Myrteza, Graeme Quadrant Gallery MEL Rabling, John Tacit Galleries MEL MacPherson, Robert Yuil/Crowley SYD Nagy, Eugene Von Tacit Galleries MEL Rabone, Kerryn Dogwood Crossing QLD Magee, Morganna Bundoora Homestead MEL Nain, Clinton Art Atrium SYD Rainer-Adamson, Bjoern Heathcote Museum WA Magree, Shane Montalto Sculpture Prize VIC Namunjdja, Samuel Niagara Galleries MEL Rainer-Adamson, Bjoern Lawrence Wilson WA Maher, Paul Gallery 139 NSW Nelson, Ilona Town Hall Gallery MEL Rayski-Mati, Mel Tesselaar Tulip Festival VIC Mahoney, Katherine Mu Studio Gallery SYD Nettleton, Julie Blue Mountains City NSW Rea, Kirstie Canberra Glassworks ACT Makas, Joanne STACKS Projects SYD Ngarrwoneng, Kunkamak Alcaston Gallery MEL Redgate, Jacky Wollongong Art Gallery NSW Makin, Jeff Central Goldfields VIC Nguyen, Hoa Walker Street Gallery MEL Reilly, Joshua Contemporary Art TAS TAS Makonnen, Gennet Cambridge Studio MEL Nguyen, Van Walker Street Gallery MEL Rendall, Steven Niagara Galleries MEL Malin, Ellie Modern Times MEL Nicholls, Mike Montalto Sculpture Prize VIC Rewa, Edith Blue Mountains City NSW Malone, Maggie Gecko Studio Gallery VIC Nicholson, John Jan Murphy Gallery QLD Reynolds, Ben Moores Building WA Manion, Irene BAROMETER Gallery SYD Nieves, Grace De Las Walker Street Gallery MEL Reynolds, Genevieve Felix Nicholas Thompson MEL Manning, Chelsea E. PICA WA Nolan, Sidney Art Gallery of WA WA Reynolds, Molly Anne & Gordon Samstag SA Manning, Ross Tableland Regional QLD Nona, Dennis Andrew Baker Art Dealer QLD Richards, Trevor Lakeside Joondalup WA Mansbridge, Leonie Ngahuia Lakeside Joondalup WA Norrish, Ellen Lakeside Joondalup WA Richardson, Charlotte Gaffa Gallery SYD Marawili, Nonggirrnga Alcaston Gallery MEL Northwood, Paige Wollongong Art Gallery NSW Richardson, Mary-Jean Adelaide Central Gallery SA Mariani, Ashley La Trobe Art Institute VIC Norton, Kevin Defiance Gallery SYD Richardson-Hyde, Dawna Mildura Arts Centre VIC Mariani, Leah Tacit Galleries MEL Nyadbi, Lena Niagara Galleries MEL Riddle, Jennifer Scott Livesey Galleries MEL Marika, Dhuwarrwarr Vivien Anderson Gallery MEL O’Brien, Matt Lismore Regional NSW Ringholt, Stuart MADA MEL Mark, India Wollongong Art Gallery NSW O’Brien, Catherine Walker Street Gallery MEL Rix, Jimmy Montalto Sculpture Prize VIC Marsh, Amanda Lakeside Joondalup WA O’Connor, Derek Watters Gallery SYD Roadknight, Sally Falkner Gallery VIC Marshall, Lyne Barossa Regional Gallery SA O’Connor, Kathleen Fremantle Arts Centre WA Robbins, Cameron RMIT Gallery MEL Martorell, Dylan La Trobe Art Institute VIC O’Doherty, Peter Manly Art Gallery SYD Roberts, Carolyn Cambridge Studio MEL Mathews, Nyx ANCA ACT O’Doherty, Susan Blue Mountains City NSW Roberts, Martin Western Sydney SYD Matt D Design Frankston Arts Centre VIC O’Donoghue, Sean Glass Artists’ Gallery SYD Roberts, Toby Blue Mountains City NSW Maudsley, Helen Niagara Galleries MEL O’Donovan, Dan Collingwood Gallery MEL Robertson, Christian Clare NCCA NT Mawurndjul, John Art Gallery of SA SA O’Keefe, Lisa Tacit Galleries MEL Robertson-Swann, Ron Contemporary Art TAS TAS Mawurndjul, John UTS Gallery SYD O’Loughlin, Nicole Gaffa Gallery SYD Robins, Amanda Fox Galleries MEL McAdam, Robyn Firestation Print Studio MEL Obst, Mel Goat Gallery VIC Robinson, George Augustus Queen Victoria Museum TAS Mccabe, Dan George Paton Gallery MEL Okamura, Yuria La Trobe Art Institute VIC Robinson, William Australian Galleries SYD McClelland, Nicola Factory 49 SYD Olaf, Erwin Cairns Art Gallery QLD Robinson, William S.H. Ervin Gallery SYD McConchie, Kerri Wilson Town Hall Gallery MEL Oliphant, Ruth Canberra Glassworks ACT Robson, Gwen Frances Keevil Gallery SYD McCullagh, Helen Southern Buoy Studios VIC Oliver, Leslie MAY SPACE SYD Rogers, Barbara BAROMETER Gallery SYD McCulloch, Lyndall Glass Artists’ Gallery SYD Oliver-Skuse, Helen Tacit Galleries MEL Rogers, James Watters Gallery SYD McDermid, Jessica Gaffa Gallery SYD Ollis, Bernard Griffith Regional Gallery NSW Rollond, Tania Coffs Harbour Regional NSW McDonald, Rafaella Chapter House Lane MEL Olsen, John Olsen MEL Rose, Jacqueline Cross Art SYD McDonald, Wendy Southern Buoy Studios VIC Ömie Artists Andrew Baker Art Dealer QLD Rosetzky, David MADA MEL McEachern, Lucy Tesselaar Tulip Festival VIC ORLAN PICA WA Rosin, Natalie Coffs Harbour Regional NSW McGeachie, Brenton M16 Artspace ACT Orszulok, Halinka Flinders Street Gallery SYD Rossi, Alessandra Moores Building WA McGrath, James Olsen Gallery SYD Osborn, Peter Broken Hill Regional NSW Rothschild, Eva ACCA MEL McGregor, Alan Red Gallery MEL Osborne, Rose Alternating Current MEL Rothwell, Caroline Aust. Print Workshop MEL McGuire, Kate Arc Yinnar Gallery VIC Paine, Laurie Articulate Project Space SYD Roussos, Koulla NCCA NT McHaffie, Rob Gallery @ Bayside Arts MEL Palmer, Lucy Canberra Glassworks ACT Roux, Susan Lakeside Joondalup WA McInnis, Helen Tacit Galleries MEL Parekowhai, Michael Roslyn Oxley9 Gallery SYD Rowden, Jonny Watch This Space NT McIntosh, Ruth Tacit Galleries MEL Pareroultja, Hubert Vivien Anderson Gallery MEL Rowe, Katie Gate 6 Gallery MEL McKay, Kate Jan Manton Art QLD Parfitt, Mark Lakeside Joondalup WA Rubin, Victor Fox Galleries MEL McKay, Kevin MAY SPACE SYD Park, Parallel La Trobe Art Institute VIC Ruiz-Geli, Enric RMIT Gallery MEL McKenna, Noel Niagara Galleries MEL Parker, Astra Montalto Sculpture Prize VIC Russell, Alison Cambridge Studio MEL McKenzie, Alexander Hazelhurst Regional SYD Parr, Martin Niagara Galleries MEL Russell, John Art Gallery of NSW SYD McKenzie, Rodney Tesselaar Tulip Festival VIC Parr, Mike Anna Schwartz MEL Ruthi, Andreas Niagara Galleries MEL McKinnon, Robyn Queen Victoria Museum TAS Parrett, James Montalto Sculpture Prize VIC Ryan, Natalie Linden New Art MEL McLean, Susan Fell Redland Art Gallery QLD Parry, Ian Eastgate Gallery MEL Ryan, Olivia Heathcote Museum WA McNab, Bridget Boom Gallery VIC Pass, Edith Blue Mountains City NSW Ryan, Robert Anthea Polson Art QLD McWilliams, Michael Handmark Gallery TAS Paterson, Susannah Glass Artists’ Gallery SYD Saad, Nuha Articulate Project Space SYD Meade, John Neon Parc MEL Paton, Joy Western Sydney SYD Sabsabi, Khaled PICA WA Meijers, Mish Bett Gallery Hobart TAS Paton, Rory Mundaring Arts Centre WA Sacks, Nicole Frances Keevil Gallery SYD Meilak, Sean Niagara Galleries MEL Paull, Martin M16 Artspace ACT Sadar, John RMIT Gallery MEL Mein, Annemieke Gippsland Art Gallery VIC Pelan, Robyn Queen Victoria Museum TAS Sadauskas, Faustus Montalto Sculpture Prize VIC Miano, Nunzio Studio B Gallery MEL Pelikan, Milos Tacit Galleries MEL Sages, Jenny King Street Gallery SYD Michael, Karen Sheffer Gallery SYD Pena, Maria Walker Street Gallery MEL Sainsbury, Chris Blue Mountains City NSW Micos, Maritsa Art Gallery on Darling SYD Pennington, Myrtle Aboriginal & Pacific Art SYD Saker, Annette Hawthorn Studio MEL Mighell, Tony Sheffer Gallery SYD Pennock, Colin Art House Gallery SYD Salina, Tita George Paton Gallery MEL Mikael, Mikael RMIT Gallery MEL Perez, Sophie Southern Buoy Studios VIC Sampi, Winnie Southern Buoy Studios VIC Miles, Gary Bradley Hall VIC Perez, Yunuen Walker Street Gallery MEL Santoro, Nick Wollongong Art Gallery NSW Millar-Baker, Hayley UTS Gallery SYD Perry, Suzanne Western Sydney SYD Sawant, Sanjay Walker Street Gallery MEL Millward, Clem Artarmon Galleries SYD Peter & Molly Lawrence Wilson WA Saxton, Louise Town Hall Gallery MEL Milson, Aoife Watch This Space NT Peters, Clare Canberra Glassworks ACT Sayers, Phil Red Gallery MEL Mitchell, Laura Moores Building WA Petersen, Phred RMIT Gallery MEL Scardifield, Kate SCA Galleries SYD Moffatt, Tracey Grafton Regional NSW Petersfield, Micheila Despard Gallery TAS Schlicht, Rollin Museum of Sydney SYD Moira, Shlomit Tesselaar Tulip Festival VIC Pham, Stephen Peacock Gallery SYD Schroder, Sandie Linton & Kay Fine Art WA Moller, Vera Philip Bacon Galleries QLD Philippe Rahm Architects RMIT Gallery MEL Scoglio, Zoe RMIT Project Space MEL Molloy-Drum, Donal Tesselaar Tulip Festival VIC Philippe-Janon, Nadège Plimsoll Gallery TAS Scott, Jessica Counihan Gallery MEL Mombassa, Reg Manly Art Gallery SYD Phillips, Jungle Jungle’s Art Studio SA Scovill, Ole Walker Street Gallery MEL Montigne, Gwenaelle Walker Street Gallery MEL Phillips, Perdita Lawrence Wilson WA Seeto, William Articulate Project Space SYD Moon, Damon Bendigo AG VIC Phu, Jason ACE Open SA Semiz, Fatih Tesselaar Tulip Festival VIC Mora, Mirka Heide Museum MEL Phu, Jason Peacock Gallery SYD Senbergs, Jan Niagara Galleries MEL Morgan, Glenn Australian Galleries MEL Pica, Amalia PICA WA Seton, Alex Sullivan+Strumpf SYD Morgenstern, Monika FELTspace SA Pickering, Linda Tacit Galleries MEL Seymour, Nobby Langford 120 MEL Moroney, Olivia Handmark Gallery TAS Pistekova, Danica RMIT Gallery MEL Sgro, Donna Gaffa Gallery SYD Morton, Sussanne Manyung Gallery Malvern MEL Pitel, Victoria Lismore Regional NSW Shalekoff, Sharron Mildura Arts Centre VIC Moss, Nicola Gold Coast City Art QLD Pollard, Catriona Mosman Art Gallery SYD Shanshan, Ai Salamanca Arts Centre TAS Moss, Suzanne Contemporary Art TAS TAS Pollard, Catriona Sydney Road Gallery SYD Sharp, Wendy Griffith Regional Gallery NSW Mptyane, Harry Dixon Niagara Galleries MEL Pound, Patrick Plimsoll Gallery TAS Shead, Garry Museum of Sydney SYD Muir, Josh Koorie Heritage Trust MEL Pound, Patrick STATION MEL Shelden, Lee Falkner Gallery VIC Mullens, Andy Bundoora Homestead MEL Powditch, Peter Defiance Gallery SYD Shelton, Meagan Tacit Galleries MEL Muller, Alan Moores Building WA Prisco, Luciano Langford 120 MEL Sher, Jean Linton & Kay Fine Art WA Muller, Burt Blue Mountains City NSW Prohasky, Daniel RMIT Gallery MEL Sherman, Linda Project Gallery 90 SYD Munro, Al MAY SPACE SYD Pullar, Harry Gecko Studio Gallery VIC Sibel, Michael Tesselaar Tulip Festival VIC Murray, Jan BLINDSIDE MEL Pwerle, Angelina Niagara Galleries MEL Sibley, Jordan Belgrave Creative Space MEL Murray, Janice Aust. Print Workshop MEL Pyett, Adam Jan Murphy Gallery QLD Siboni, Raphaël Mona TAS

176 Artist Index Simms, Michael Stanley Street Gallery SYD Tiatia, Angela Bundoora Homestead MEL Wedd, Gerry Cowra Regional NSW Sims, Jason Art Gallery of Ballarat VIC Tillers, Imants Annette Larkin Fine Art SYD Weekes, Trevor Stella Downer Fine Art SYD Skewes, Jeffree M16 Artspace ACT Tillers, Imants Arc One MEL Weil, Linda Tacit Galleries MEL Skinner, Susannah Lakeside Joondalup WA Tipping, Richard Latrobe Regional VIC Welham, Vanessa Collingwood Gallery MEL Slater, Liz Grafton Regional NSW Tiravanija, Rirkrit NGV International MEL Wellm, Irene Tacit Galleries MEL Slatter, Bruce Geraldton Regional WA Tome, Matthew Lake Macquarie City NSW Welsh, Mark Moores Building WA Slatter, Nicole Geraldton Regional WA Tomlin, Steve Firestation Print Studio MEL Westacott, Jonathon Glass Artists’ Gallery SYD SLIPPAGE FELTspace SA Topolcsanyi, Ilona Coffs Harbour Regional NSW Westerman, Catherine Town Hall Gallery MEL Smalkowski, Sue Frances Keevil Gallery SYD Transsolar RMIT Gallery MEL Westfold, Katherine Tacit Galleries MEL Smith, Fiona Glass Artists’ Gallery SYD Trulsson, Ulrica Coffs Harbour Regional NSW Westmoreland, Bradd Niagara Galleries MEL Smith, Lauri Cont. Art Awards QLD Truman, Catherine Mornington Peninsula MEL Whisson, Ken Niagara Galleries MEL Smith, Talia BLINDSIDE MEL Tubbs, Marian Adelaide Central Gallery SA White, Max Lawrence Factory 49 SYD Smith, Talia Bundoora Homestead MEL Tucker, Albert Heide Museum MEL Whiteley, Brett Brett Whiteley Studio SYD Smolska, Marianne Walker Street Gallery MEL Tucker, Jessie Willow Bundoora Homestead MEL Whiteley, Brett Fellia Melas Gallery SYD Snadden, Emily Salamanca Arts Centre TAS Tuffery, Michel Andrew Baker Art Dealer QLD Whiteley, Brett Lauraine Diggins MEL Snelgar, Andy UTS Gallery SYD Turner, David Red Gallery MEL Whiteley, Brett Museum of Sydney SYD Snell, Paul Contemporary Art TAS TAS Turrell, James QAG/GOMA QLD Whiteley, Brett NGV Ian Potter Centre MEL Snowdon, Frankie Watch This Space NT Tuttle, Chris Gecko Studio Gallery VIC Whiteley, Richard Canberra Glassworks ACT Sparkes, Pierra Van La Trobe Art Institute VIC Tyler, Katrina Alternating Current MEL Whitington, James Cessnock Regional NSW Sparks, Valery Monash Gallery of Art MEL Tylor, James George Paton Gallery MEL Whyte, Don NCCA NT Spedding, Jacqueline Blue Mountains City NSW Tylor, James UTS Gallery SYD Wickens, David Outstation Gallery NT Spencer, David Moores Building WA Uhlmann, Nicholas Montalto Sculpture Prize VIC Wickham, Stephen Contemporary Art TAS TAS Spencer, Ric Moores Building WA Unsworth, Ken NGV Ian Potter Centre MEL Wigley, Christabel Montalto Sculpture Prize VIC Spiller, Winsome Red Gallery MEL Uranishi, Kenji Coffs Harbour Regional NSW Wigston, Carolyn Contemporary Art TAS TAS Spokes, Kerry Gecko Studio Gallery VIC Usmiani, Lucia Despard Gallery TAS Wilkie, Fi Linton & Kay Fine Art WA Valamanesh, Hossein Adelaide Central Gallery SA Spremberg, Alex Lawrence Wilson WA Williams Lauraine Diggins MEL Spurrier, Stephen Langford 120 MEL van der Broek, Mary Tesselaar Tulip Festival VIC Williams, Justene Penrith Regional SYD Staley, Siarn Watt Space NSW Van Veen, Mark CCAS - Manuka ACT Williams, Marshall Soho Waterloo SYD Stallard, Phil Soho Waterloo SYD Vassilieff Lauraine Diggins MEL Wills, Laura Adelaide Central Gallery SA Stent, Prue ACP Project Space SYD Vaynman, Michael Frances Keevil Gallery SYD Wilson, Regina Pilawuk Michael Reid SYD Stevens, Kate CCAS - Gorman Arts ACT Versitano, Sarah Western Sydney SYD Wilson, Simon Moores Building WA Stevenson, Susan Tacit Galleries MEL Vestartas, Petras RMIT Gallery MEL Wirrpanda, Mulkun Museum & Art Gallery NT NT Stewart, Tyza Gympie Regional Gallery QLD Vesterberg, Katarina Andrew Baker Art Dealer QLD Wolf-Tasker, Allan fortyfivedownstairs MEL Steyerl, Hito NGV International MEL Vongpoothorn, Savanhdary Niagara Galleries MEL Wolseley, John Museum & Art Gallery NT NT Storrier, Tim Museum of Sydney SYD Wagenfeld, Malte RMIT Gallery MEL Woltjer, Gera Bunbury Regional WA Strange, Kaye NCCA NT Wagner, Jacklyn Lismore Regional NSW Street, Mervyn Aust. Print Workshop MEL Waldron, Ian Montalto Sculpture Prize VIC Woltjer, Gera Lakeside Joondalup WA Stringer, Richard Carlisle Street Arts Space MEL Waler, Jake Gallery 9 SYD Wong, Min Hugo Michell Gallery SA Stuart, Todd Tesselaar Tulip Festival VIC Walker, Deborah Carlisle Street Arts Space MEL Wonglorz, Rosina Moores Building WA Stubbs, Sarah Queen Victoria Museum TAS Walker, Thornton Beaver Galleries ACT Woo, Catherine Beaver Galleries ACT Sufriadi, Dedy Defiance Gallery SYD Walsh, Brenda Tacit Galleries MEL Wood, David Montalto Sculpture Prize VIC Summers, Peter Tacit Galleries MEL Walsh, Tricky Contemporary Art TAS TAS Wood, Heidi Arts Academy VIC Swalwell, Derek Modern Times MEL Walsh, Tricky Plimsoll Gallery TAS Woodward, Laura Plimsoll Gallery TAS T’Jolle, Sven STATION MEL Wanambi, Wolpa Niagara Galleries MEL Wright, Gillian Collingwood Gallery MEL Tabacco, Wilma Contemporary Art TAS TAS Wanambi, Wukun Niagara Galleries MEL Wright, Helen Niagara Galleries MEL Tan, Kynan UNSW Galleries SYD Warburton, Toni Adelaide Central Gallery SA Xun, Sun MCA SYD Taranto, Joe Tesselaar Tulip Festival VIC Warburton, Toni Fox Galleries MEL Yang, William Andrew Baker Art Dealer QLD Targett, Jasmine Stockroom Gallery VIC Ward, Peter Tacit Galleries MEL Yarinkura, Lena Alcaston Gallery MEL Taylor, A J Martin Browne SYD Ward, Simon Wollongong Art Gallery NSW Yoon, Kelly George Paton Gallery MEL Taylor, Chris Yering Station MEL Warren, Kerrie Pilgrim Creek Studios VIC Yorulmaz, Yeliz Peacock Gallery SYD Taylor, Nathan Bett Gallery Hobart TAS Wasikowski, Kai ACP Project Space SYD Young, Carolyn Goulburn Regional NSW Taylor, Neil Niagara Galleries MEL Wasikowski, Kai Peacock Gallery SYD Youssef, Justine 4A Centre SYD Tempestt, Sioux Lakeside Joondalup WA Waters, David Montalto Sculpture Prize VIC Zanko, Chris Wollongong Art Gallery NSW Teudt, Maria RMIT Gallery MEL Watkins, Simon RMIT Gallery MEL Zerunge, John Young ACP Project Space SYD Thackway, Clare Wollongong Art Gallery NSW Watson, Amy Joy Wollongong Art Gallery NSW Zheng, Lei March Space MEL The Numina Sisters Art Gallery of Ballarat VIC Watson, Charlotte Bundoora Homestead MEL Zhuoquan, Liu Niagara Galleries MEL Thebus, Athena George Paton Gallery MEL Watson, Claire Anna MAY SPACE SYD Zika, Paul Contemporary Art TAS TAS Thomas, Melissa Bolin Bolin Gallery MEL Watson, Jenny Wollongong Art Gallery NSW Zika, Paul Stephen McLaughlan MEL Thompson, Ann Defiance Gallery SYD Watson, Tommy Kate Owen Gallery SYD Zoellner, Julia Guild Assembly Point MEL Thompson, Carlene Alcaston Gallery MEL Weaver, Louise Aust. Print Workshop MEL Zorzut, Nives Tesselaar Tulip Festival VIC Thomson, Ann Defiance Gallery SYD Webb, Bruce Tesselaar Tulip Festival VIC Zurr, Ionat Art Gallery of WA WA

/HYHO%XLOGLQJ$3DFLíF+LJKZD\6W/HRQDUGV16: Locked Bag 5555, St Leonards NSW 1590. T 02 9901 6100. Executive Chairman David Gardiner. Managing Director+DPLVK%D\OLVVCirculation Director Caroline Jones. Art Almanac is published by nextmedia Pty Ltd, ACN: 128 805 970 /HYHO  %XLOGLQJ $  3DFLíF +LJKZD\ 6W /HRQDUGV 16:  ƒ  All rights reserved. No part of this magazine may be reproduced, in whole or in part, without the prior permission of the publisher. Printed by SOS Print + Media, distributed in Australia by Gordon & Gotch. ISSN 0313-220x. The publisher will not accept responsibility or any liability for the correctness of information or opinions expressed in the publication. All material submitted is at the owner’s risk and, while every care will be taken nextmedia does not accept liability for loss or damage. Privacy Policy We value the integrity of your personal information. If you provide personal information through your partici- pation in any competitions, surveys or offers featured in this issue of Art Almanac, this will be used to provide the products or services that you have requested and to improve the content of our magazines. Your details may be provided to third parties who assist us in this purpose. In the event of organisations providing prizes or offers to our readers, we may pass your details on to them. From time to time, we may use the information you provide us to inform you of other products, services and events our company has to offer. We may also give your information to other organisations which may use it to inform you about their products, services and events, unless you tell us not to do so. You are welcome to access WKHLQIRUPDWLRQWKDWZHKROGDERXW\RXE\JHWWLQJLQWRXFKZLWKRXUSULYDF\RIíFHUZKRFDQEHFRQWDFWHGDW nextmedia, Locked Bag 5555, St Leonards, NSW 1590.

Artist Index 177

SCU URE AT SCENI ORLD 19

Jacek Wankowski Observatorium One, 2017 | Image: Keith Maxwell