Aviva Systems Biology SH3D19 Antibody - C-terminal region (ARP67291_P050) Product Number ARP67291_P050 Product Page http://www.avivasysbio.com/sh3d19-antibody-c-terminal-region-arp67291-p050.html Product Name SH3D19 Antibody - C-terminal region (ARP67291_P050) Size 100 ul Symbol SH3D19 Protein Size (# AA) 420 amino acids Molecular Weight 46kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 152503 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full SH3 domain containing 19 Name Description This is a rabbit polyclonal antibody against SH3D19. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: GRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQV Description of This gene encodes a multiple SH3 domain-containing protein, which interacts with other Target proteins, such as EBP and members of ADAM family, via the SH3 domains. This protein may be involved in suppression of Ras-induced cellular transformation and Ras- mediated activation of ELK1 by EBP, and regulation of ADAM proteins in the signaling of EGFR-ligand shedding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Protein Interactions SH3YL1; SH3KBP1; ELAVL1; Cd2ap; GRB2; CDC42; ADAM15; ADAM17; SH3GL3; ADAM12; ADAM9; ADAM10; SH3GL1; SOS2; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges Blocking Peptide For anti-SH3D19 (ARP67291_P050) antibody is Catalog # AAP67291 Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Complete Anti-SH3D19 (ARP67291_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SH3D19. Swissprot Id Q5HYK7-4 Protein Name SH3 domain-containing protein 19 Sample Type SH3D19 is supported by BioGPS gene expression data to be expressed in Jurkat Confirmation Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SH3D19. Nucleotide Accession # Replacement Item This antibody may replace item sc-100852 from Santa Cruz Biotechnology. Conjugation ARP67291_P050-FITC Conjugated Options ARP67291_P050-HRP Conjugated ARP67291_P050-Biotin Conjugated CB Replacement sc-100852; sc-377282; sc-88945 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat Application WB Predicted Cow: 85%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: Homology Based 92%; Rat: 79% on Immunogen Sequence

Image 1: Jurkat Host: Rabbit Target Name: SH3D19 Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 1.0ug/ml SH3D19 is supported by BioGPS gene expression data to be expressed in Jurkat

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2