Product datasheet Anti-PA2G4 Antibody Catalog Number: A02791

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Basic Information Product Name Anti-PA2G4 Antibody Name PA2G4 Source Rabbit IgG Species Reactivity human,mouse,rat Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences. Purification Immunogen affinity purified. Observed MW 43KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user.

Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing

Background Information Proliferation-associated 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional of -regulated and other cell cycle regulatory genes through its interactions with histone deacetylases.

Reference

Anti-PA2G4 Antibody被引用在0文献中。

暂无引用

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-PA2G4 Antibody Catalog Number: A02791

BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China

Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]

Selected Validation Data

Figure 1. Western blot Figure 2. IHC analysis of analysis of EBP1 using EBP1 using anti-EBP1 anti-EBP1 antibody antibody (A02791).EBP1 (A02791). lane 1: rat liver was detected in paraffin- tissue lysates,lane 2: embedded section of rat NIH3T3 whole cell intestine tissues. anti- lysates,lane 3: HEPG2 EBP1 Antibody (A02791) . whole cell lysates. anti- Biotinylated goat anti- EBP1 antigen affinity rabbit IgG was used as purified polyclonal secondary antibody . The antibody (Catalog # tissue section was A02791)probed with a developed using Strepavi goat anti-rabbit IgG-HRP din-Biotin-Complex secondary antibody The (SABC)(Catalog # signal is developed using SA1022) with DAB as the an Enhanced chromogen. Chemiluminescent detection (ECL) kit (Catalog # EK1002) . A specific band was detected for EBP1 at approximately 43KD. The expected band size for EBP1 is at 43KD.

Figure 3. IHC analysis of Figure 4. IHC analysis of EBP1 using anti-EBP1 EBP1 using anti-EBP1 antibody (A02791).EBP1 antibody (A02791).EBP1 was detected in paraffin- was detected in paraffin- embedded section of embedded section of mouse intestine tissues. mouse brain tissues. anti- anti-EBP1 Antibody EBP1 Antibody (A02791) . (A02791) . Biotinylated Biotinylated goat anti- goat anti-rabbit IgG was rabbit IgG was used as used as secondary secondary antibody . The antibody . The tissue tissue section was section was developed developed using Strepavi using Strepavidin-Biotin- din-Biotin-Complex Complex (SABC)(Catalog (SABC)(Catalog # # SA1022) with DAB as SA1022) with DAB as the the chromogen. chromogen.

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2

Powered by TCPDF (www.tcpdf.org)