DOCSLIB.ORG

Lity Fish Food

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Lity Fish Food the cichlidmonthly Premium Quality Fish Food OSI Cichlid Pellets OSI Premier Cichlid Pellets OSI Cichlid Flakes Discover the Difference with Ocean Star International Victorian Cichlid Society Incorporated OSIPet Pty Ltd Volume 35, #5, June 2006 Great Fish 75 Araluen Street Rudducks Pty Ltd $1.10 Graham Rowe Kedron QLD 4031 Ph: 9798 2022 0413 203 604 Phone: 07 3350 6400 Fax: 9798 2211 Certificate of Incorporation # A0012794D REGISTERED BY AUSTRALIA POST - PP342780/0024 20 COMMCOMMIITTTTEE:EE: 1 YouYou mightmight alsoalso likelike toto meetmeet ...... cichlidcichlid PRESIDENT: John McCormick ......................5944-3502 [email protected] scenesceneAUSTRALIAN & AQUARIUM VICE-PRESIDENT: NEW GUINEA Andrew Kiefer ..........................9782-6010SOCIETY OF THE NEXT MEETING of theFISHES Society ASSOC will be VICTORIA held on the first Wednesday of the month SECRETARY: Meets bi-monthly at the Graham RoweMeets..........................9560-7472 on the last Thursday at 8 pm sharp (the Trading Table opens Field Naturalist Club, [email protected] the month at earlier) in the1 GardeniaMitcham Scout Street, Hall, Blackburn. 29 Grant Street, Clifton Hill. Brunswick Road,Contact Mitcham. John Visitors Cousins: are TREASURER: Call Val Bradley: 9478 6028 encouraged9844 to come 1245 along. (AH) for information. Tony Ferguson ....................0408for information. 533 552 MINI TALK: EDITOR: MAIN TALK:. Adrian Quental ....................0414 304 977 EASTERN [email protected] NATIONAL DOOR PRIZES: . DISTRICTS SOCIAL SECRETARY: AUSTRALIAN DRAW PRIZES: Melissa Kirkham..................03 5796 9304 1. $60.voucher AQUARIUM SOC KILLIFISH ASSOC 2. .$30 voucherMeets on the 4th Friday of the TRADING TABLE: 3. .chocolatesmonth at Nunawading Civic . Centre, David Green..............................9874-2392Meets BI-monthly Whitehorse Road, Nunawading. in members’ homes. TABLE SHOWS: Details see page 3. LIBRARIAN: Write to PO Box 3005, Contact: Sandra Robotis....................0433 985 344 MEMBERSHIPNunawading FEES 2005 3131. Emma Jenkin 9442 3408. Ordinary ............................................$30.00 SHOW SECRETARY: GE FOR RENT FamilyGE FOR RENT ................................................$35.00 Greg Lawrence ....................0407 701 110 A Junior/ConcessionA Card Holder ........$15.00 Overseas............................................Victorian$35.00 CichlidSub-Committee Society Chairpersons: (new memberships add $8 joining fee) BAA: Peter Robinson. MEMBERSHIPConstitution: APP DarylLI HutchinsCAT. IONS MEMBERSHIPHandbook: APP DarylL HutchinsICA. TIONS COVER PICTURE:or Nandopsisother enquiries dovii - Mailing: may Peter be Robinson. directed to: Greg Lawrence Species Maintenance: Andrew Kiefer. The Secretary, Graham Rowe LIFE MEMBERS: 23 Mangana Drive,Graham Mulgrave Rowe, Heinz VicStaude, 3170 cichlids.web.com cichlids.web.com THIS P Kevin Archibald, Keith Patford, THIS P Ph/fax: 9560 7472 © Copyright, Victorian Cichlid Danny Genovese, Daryl Hutchins and SocietyE-mail: Inc victoriancic2006 [email protected] McCormick. Anyone wishing to reprint material from `The Cichlid Monthly’ for non-commercial purposes, Ormay dogo so to HONORARYour website: MEMBER: (unless the item is copyright by the author) provided Max Davenport. due credit is given to the author and `TCM’ and one copy of the relevant publication is forwarded to the FELLOW OF THE SOCIETY: author, care ofcichlids.web.com cichlids.web.comthe Secretary. Enquiries re the use of Graham Rowe. material in other publications may be directed to [email protected]. PUBLIC OFFICER: David Green. cichlids.web.com cichlids.web.com © Sturmbauer.| 2002. Phylogeny 182 of the Lake Tanganyika cichlid 193 S PreviouslyPreviously ...... atat aa VCSVCS MeetingMeeting species| flock and its relation- 2006 VCS Calendar ship to the central and East MAY 2006 MINUTES T Meeting Details......................................................................................1 Meeting Committee Home Show Auction Art & Photo Social The meeting opened at 8.09 pm with the President in the chair. He welcomed every- African| haplochromine cichlid 2006 VCS Calendar ................................................................................3 one present. He noted that attendance was light on due in part to the wintry condi- fish faunas. Systematic tionsJanuary and the lackNo ofMeeting the magazine.TBA He apologised on behalf of the Editor BBQ and 8/1 BiologyN OS I51,Pet Table113-135. Show Calendar ..................................................................3 Committee for the lack of a magazine, but the Editor had been and still was ill. | February 110 Seehausen, O. et al. 2003. The Secretary read the minutes and Jeff Staude moved a motion that they be An ecosystem under stress....................................................................4 accepted.March This was110 seconded by Dave Thorn and carried. There was no businesscw games NuclearE markers reveal unex- arising. Dean Hepper was welcomed to the society and presented with his badge pected| Central genetic American variation Correspondent and a ............................................................7 andApril handbook by5 AGMthe President. 21 8 TheMay Treasurer reported that the Auction finished at 4.10. There were 93 lots and a Congolese/NiloticT origin of the 31228 Member Cichlid Profile ..........................................................................11 turnover of $5618. The society received $1189.05 in commission, $136 from the raf- Lake| Victoria cichlid species June 716 Non-endemic haplochromines..............................................................12 fle, $296.20 from the kitchen and there were 2 new members and 5 renewals. The flock. Proceedings of the bank balance was $3938.49 N July 514 This report was accepted on a motion moved by David Green and seconded by Royal| MinutesSociety of London the Previous B, Meeting 270, ..........................................................19 DarylAugust Hutchins. Correspondence2 11 was videoreceived HS from Robert Tan regardingDinner a pH TBA 129-137. meter he purchased at the auction. This had been satisfactorily resolved. Eastern The Last Word ....................................................................................20 September 6 15 d’line 15/9 7 Shaw,O P.W., G.F. Turner, M.R. Districts AS has asked us to jointly review the fish names in the Breeders Idid,| R.L. Robinson, and G.R. AchievementOctober Awards.413 We will do this. Robert* VH* Dodd TBAsent further information regard- ing the future oil drilling in Lake Tanganyika. John McCormick has mentioned it on November 110 Carvalho.C 2000. Genetic pop- several forums. ulation| structure indicates A congratulatoryDecember card6 was sent TBA to 15 Cameron and Melissa Kirkham prior to AGMtheir pizza recent sympatric speciation of Lake wedding. They have emailed their thanks for this gesture. The correspondence was received on a motion moved by Tony Ferguson* Video and Home seconded Show results by Andreasannounced. Kiefer. MalawiAims pelagic of the cichlids. Society: Graham Rowe then gave a brief talk on his experiences with Nanochromis trans- ProceedingsThe Victorian Cichlid of the Society Royal was formed by cichlidophiles in March 1972 thus vestitus. This was complemented by other members recounting their experiences Societybecoming London the first specialistB, 267, aquarist 2273- group in Victoria. Its main aims are: also. John McCormick moved a vote of thanks which was carried by acclamation. 1.To promote the keeping of cichlids; After a short break a brief mini auction was held. Andreas Kiefer was thanked for his 2280. 2.To gain and disseminate knowledge of cichlids, their habits and attributes donation.OSI The PresidentPet then Tthankedable all Sthoseho whow helpedCale makenda ther auction200 run6 Skelton,through P.H. the use1993. of slides, A com- films, books, lectures, practical demonstrations, smoothly. A presentation was made to Dave Thorn and Aussie Magnussen for their local and overseas magazines, articles by members and discussions with fellow sterling work out front.Kevin Geoff Archibald Wills Showwas not presentKeith toPatford accept Show his. pletemembers guide or to experts the freshwater in the field; After discussion,February it wasAny Americandecided to send the May Any magazine African out with the June issue fishes3.To assist, of southern in any way Africa. possible, the establishment and/or maintenance of approved public aquaria; unless weMarch encounteredAny Americanfurther problems. Any African Southern4.To be involved Book in Publishers,the education of the general public with regard to the benefits A DVD of theApril MightyAny Amazon American was then shown. Any African Halfwayof fishkeeping House, (particularly South Africa; cichlids), and the potentially harmful effects of Greg LawrenceMay reportedAny American that there was only one Any entry African in the OSIPet Table Show. animal mismanagement; Door PrizesJune of Pro’sDwarf Choice Americans* were accepted by DwarfDave Africans*Thorn, John McCormick, Manny cichlids.web.com cichlids.web.com xiv + 388 pages. Pickard, Amelio d’Angelo, Greg Lawrence and Pat Morris. cichlids.web.com cichlids.web.com 5.To promote fellowship between members; July Any American Any African Dave Thorn accepted both the $60 Rayonne and $30 Boronia vouchers on offer as 6.To further the conservation of species and their natural habitats; August Pairs American* Pairs African* 7.To further the identification, distribution,
Load more

Recommended publications
  • Jlb Smith Institute of Ichthyology
    ISSN 0075-2088 J.L.B. SMITH INSTITUTE OF ICHTHYOLOGY GRAHAMSTOWN, SOUTH AFRICA SPECIAL PUBLICATION No. 56 SCIENTIFIC AND COMMON NAMES OF SOUTHERN AFRICAN FRESHWATER FISHES by Paul H. Skelton November 1993 SERIAL PUBLICATIONS o f THE J.L.B. SMITH INSTITUTE OF ICHTHYOLOGY The Institute publishes original research on the systematics, zoogeography, ecology, biology and conservation of fishes. Manuscripts on ancillary subjects (aquaculture, fishery biology, historical ichthyology and archaeology pertaining to fishes) will be considered subject to the availability of publication funds. Two series are produced at irregular intervals: the Special Publication series and the Ichthyological Bulletin series. Acceptance of manuscripts for publication is subject to the approval of reviewers from outside the Institute. Priority is given to papers by staff of the Institute, but manuscripts from outside the Institute will be considered if they are pertinent to the work of the Institute. Colour illustrations can be printed at the expense of the author. Publications of the Institute are available by subscription or in exchange for publi­ cations of other institutions. Lists of the Institute’s publications are available from the Publications Secretary at the address below. INSTRUCTIONS TO AUTHORS Manuscripts shorter than 30 pages will generally be published in the Special Publications series; longer papers will be considered for the Ichthyological Bulletin series. Please follow the layout and format of a recent Bulletin or Special Publication. Manuscripts must be submitted in duplicate to the Editor, J.L.B. Smith Institute of Ichthyology, Private Bag 1015, Grahamstown 6140, South Africa. The typescript must be double-spaced throughout with 25 mm margins all round.
    [Show full text]
  • Identification and Biology of Diplotaxodon, Rhamphochromis and Pallidochromis
    190 Diplotaxodon, Rhamphochromis & Pallidochromis / Turner et al. Identification and Biology of Diplotaxodon, Rhamphochromis and Pallidochromis George F. Turner, Rosanna L. Robinson, Paul W. Shaw & Gary R. Carvalho Abstract Introduction We present preliminary morphological and mo- The genera Rhamphochromis Regan, 1922 and lecular taxonomic studies of the genera Rhampho- Diplotaxodon Trewavas, 1935 include the most chromis, Diplotaxodon and Pallidochromis, along with pelagic of Lake Malawi’s cichlids (Turner, 1996). notes on their identification, distribution and ecol- Pallidochromis Turner, 1994, a more benthic form, is ogy. We suggest that Rhamphochromis is comprised also considered in this chapter, as it appears mor- of eight to ten species: R. longiceps, R. woodi, R. phologically intermediate between Diplotaxodon macrophthalmus, R. esox, possibly R. ferox and four and Rhamphochromis (Turner 1994a). Rhampho- or five undescribed species. We suggest that R. chromis species are streamlined elongated predators lucius and R. brevis may be junior synonyms of R. of fish and zooplankton. They usually have large woodi. We also believe that Rhamphochromis teeth and jaws. Diplotaxodon comprises a heteroge- leptosoma and R. melanotus are junior synonyms of neous mix of small-toothed silvery species with R. esox. We consider that the two types of R. ferox upwardly-angled jaws. The genus includes zoo- are not conspecific and we designate a lectotype. planktivores and predators of small pelagic fish. However, we have not yet been able to positively The genus Rhamphochromis was described by identify this species from recent collections. Regan (1922), who took the type species as Diplotaxodon may contain anything from 11 to 22 or Rhamphochromis longiceps (Günther, 1864).
    [Show full text]
  • Movement of Transposable Elements Contributes to Cichlid Diversity
    bioRxiv preprint doi: https://doi.org/10.1101/2020.02.26.961987; this version posted February 26, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Draft manuscript BIORXIV/2020/961987 Movement of transposable elements contributes to cichlid diversity Karen L. Carleton1, Matt Conte1, Milan Malinsky2,3, Sri Pratima Nandamuri1*, Ben Sandkam1&, Joana I Meier4,5,6,%, Salome Mwaiko4,5, Ole Seehausen4,5, Thomas D Kocher1 1Department of Biology, University of Maryland, College Park MD 20742 USA 2 Wellcome Sanger Institute, Cambridge, UK. 3Zoological Institute, University of Basel, Basel, Switzerland 4Aquatic Ecology and Evolution, Institute of Ecology and Evolution, University of Bern, 3012 Bern, Switzerland 5Department of Fish Ecology and Evolution, Centre for Ecology, Evolution & Biogeochemistry, Eawag: Swiss Federal Institute of Aquatic Science and Technology, 6047 Kastanienbaum, Switzerland 6Computational and Molecular Population Genetics Lab, Institute of Ecology and Evolution, University of Bern, 3012 Bern, Switzerland *Current address: John A Moran Center, University of Utah, Salt Lake City UT USA &Current address: Department of Zoology, University of British Columbia, Vancouver, BC, Canada %Current address: Department of Biology, University of Cambridge, Cambridge UK bioRxiv preprint doi: https://doi.org/10.1101/2020.02.26.961987; this version posted February 26, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Whole-Genome Sequences of Malawi Cichlids Reveal Multiple Radiations Interconnected by Gene Flow
    ARTICLES https://doi.org/10.1038/s41559-018-0717-x Whole-genome sequences of Malawi cichlids reveal multiple radiations interconnected by gene flow Milan Malinsky 1,2,10*, Hannes Svardal 1,3,4,5,10, Alexandra M. Tyers6,9, Eric A. Miska 1,3,7, Martin J. Genner8, George F. Turner6 and Richard Durbin 1,3* The hundreds of cichlid fish species in Lake Malawi constitute the most extensive recent vertebrate adaptive radiation. Here we characterize its genomic diversity by sequencing 134 individuals covering 73 species across all major lineages. The aver- age sequence divergence between species pairs is only 0.1–0.25%. These divergence values overlap diversity within species, with 82% of heterozygosity shared between species. Phylogenetic analyses suggest that diversification initially proceeded by serial branching from a generalist Astatotilapia-like ancestor. However, no single species tree adequately represents all species relationships, with evidence for substantial gene flow at multiple times. Common signatures of selection on visual and oxygen transport genes shared by distantly related deep-water species point to both adaptive introgression and independent selec- tion. These findings enhance our understanding of genomic processes underlying rapid species diversification, and provide a platform for future genetic analysis of the Malawi radiation. he formation of every lake or island represents a fresh oppor- The species that comprise the radiation can be divided into seven tunity for colonization, proliferation and diversification of groups with differing ecology and morphology (see Supplementary Tliving forms. In some cases, the ecological opportunities pre- Note): (1) the rock-dwelling ‘mbuna’; (2) Rhamphochromis—typi- sented by underutilized habitats facilitate adaptive radiation—rapid cally midwater pelagic piscivores; (3) Diplotaxodon—typically deep- and extensive diversification of the descendants of the colonizing water pelagic zooplanktivores and piscivores; (4) deep-water and lineages1–3.
    [Show full text]
  • Sixth International Conference of the Pan African Fish and Fisheries
    SIXTH INTERNATIONAL CONFERENCE OF THE PAN AFRICAN FISH AND FISHERIES ASSOCIATION (PAFFA6) BOOK OF ABSTRACTS Sun N Sand Holiday Resort in Mangochi, Malawi 24th to 28th September 2018. “African Fish and Fisheries: Diversity, Conservation and Sustainable Management” About This Booklet This publication includes abstracts for oral presentations and poster presentations at the Sixth International Conference of The Pan African Fish And Fisheries Association (PAFFA6) held at Sun ‘n’ Sand Holiday Resort in Mangochi, Malawi from 24-28 September, 2018. Section One: Oral Presentations Oral presentations are grouped by conference theme. Please refer to the Conference Programme for details about date, time slot and location for each thematic session. Section Two: Poster Presentations Poster presentations are grouped by conference theme. Please refer to the Conference Programme for details about date, time slot, and location for group poster sessions. All presentations are subject to change after the printing of this publication. The 2018 PAFFA book of abstracts is sponsored by the Fisheries Integration of Society and Habitats Project (FISH) which is made possible by the generous support of the American people through the United States Agency for International Development (USAID) and implemented by Pact. "The contents, are the sole responsibility of LUANAR, Conference Organisers and Delegates and do not necessarily reflect the views of the FISH Project team and partners, USAID, or the United States Government (USG). 1 | P a g e “African Fish and Fisheries: Diversity, Conservation and Sustainable Management” KEY NOTE PRESENTATIONS – PLENARY SESSIONS (NYANJA HALL) Day 1, Monday, 24th September, 2018 Rapid Radiation of the Cichlids of Lake Malaŵi Jay R.
    [Show full text]
  • The Polycomb Orthologues in Teleost Fishes and Their Expression in the Zebrafish Model
    G C A T T A C G G C A T genes Article The Polycomb Orthologues in Teleost Fishes and Their Expression in the Zebrafish Model Ludivine Raby, Pamela Völkel, Xuefen Le Bourhis and Pierre-Olivier Angrand * University Lille, CNRS, Inserm, CHU Lille, Centre Oscar Lambret, UMR 9020 - UMR 1277 - Canther - Cancer Heterogeneity, Plasticity and Resistance to Therapies, F-59000 Lille, France; [email protected] (L.R.); [email protected] (P.V.); [email protected] (X.L.B.) * Correspondence: [email protected]; Tel.: + 33-320-336-222 Received: 21 February 2020; Accepted: 26 March 2020; Published: 27 March 2020 Abstract: The Polycomb Repressive Complex 1 (PRC1) is a chromatin-associated protein complex involved in transcriptional repression of hundreds of genes controlling development and differentiation processes, but also involved in cancer and stem cell biology. Within the canonical PRC1, members of Pc/CBX protein family are responsible for the targeting of the complex to specific gene loci. In mammals, the Pc/CBX protein family is composed of five members generating, through mutual exclusion, different PRC1 complexes with potentially distinct cellular functions. Here, we performed a global analysis of the cbx gene family in 68 teleost species and traced the distribution of the cbx genes through teleost evolution in six fish super-orders. We showed that after the teleost-specific whole genome duplication, cbx4, cbx7 and cbx8 are retained as pairs of ohnologues. In contrast, cbx2 and cbx6 are present as pairs of ohnologues in the genome of several teleost clades but as singletons in others.
    [Show full text]
  • Comprehensive RNA-Seq Analysis to Evaluate the Pigmentation-Related Genes Involved in Albinism of Cichlid Fish, Aulonocara Baenschi
    fmars-07-00723 August 22, 2020 Time: 11:7 # 1 ORIGINAL RESEARCH published: 25 August 2020 doi: 10.3389/fmars.2020.00723 Comprehensive RNA-seq Analysis to Evaluate the Pigmentation-Related Genes Involved in Albinism of Cichlid Fish, Aulonocara baenschi Sang Yoon Lee1* and Hwa Jin Lee2 1 The East Coast Research Institute of Life Science, Gangneung-Wonju National University, Gangneung, South Korea, 2 Department of Marine Biotechnology, Gangneung-Wonju National University, Gangneung, South Korea The Nkhomo-benga peacock, Aulonocara baenschi is a species inhabiting Lake Malawi and its population has decreased by over 70% over the past 10 years. Since 2018, the species has been included in the IUCN Red list and its status has been set to the critically endangered (CR) level. And the fish is known to have rare but naturally occurring albino strain. Despite that, little has been done to develop its genetic resources such as sequence-based data and expression patterns of genes. Accordingly, this study performed high-throughput sequencing on the caudal fin of the two different-colored Edited by: A. baenschi in order to identify their pigment-related genes and analyze the expression Andrew Stanley Mount, Clemson University, United States patterns of the genes on the transcriptome level. Through the Illumina sequencing Reviewed by: platform, we obtained 77,035,702 and 88,689,756 reads from the caudal fin of the wild- Vittoria Roncalli, type and the albino-type, respectively. In addition to that, using de novo assembly and University of Naples Federico II, Italy Simo Njabulo Maduna, various annotation databases, a total of 141,116 contigs, including 129,369 unigenes Norwegian Institute of Bioeconomy were obtained.
    [Show full text]
  • GC and Repeats Profiling Along Chromosomes—The Future of Fish
    G C A T T A C G G C A T genes Article GC and Repeats Profiling along Chromosomes—The Future of Fish Compositional Cytogenomics Dominik Matoulek 1, Veronika Bor ˚uvková 1, Konrad Ocalewicz 2 and Radka Symonová 3,* 1 Faculty of Science, University of Hradec Kralove, 500 03 Hradec Králové, Czech Republic; [email protected] (D.M.); [email protected] (V.B.) 2 Department of Marine Biology and Ecology, Institute of Oceanography, Faculty of Oceanography and Geography, University of Gdansk, 80-309 Gdansk, Poland; [email protected] 3 Department of Bioinformatics, Wissenschaftszentrum Weihenstephan, Technische Universität München, 80333 Freising, Germany * Correspondence: [email protected] Abstract: The study of fish cytogenetics has been impeded by the inability to produce G-bands that could assign chromosomes to their homologous pairs. Thus, the majority of karyotypes published have been estimated based on morphological similarities of chromosomes. The reason why chromo- some G-banding does not work in fish remains elusive. However, the recent increase in the number of fish genomes assembled to the chromosome level provides a way to analyse this issue. We have developed a Python tool to visualize and quantify GC percentage (GC%) of both repeats and unique DNA along chromosomes using a non-overlapping sliding window approach. Our tool profiles GC% and simultaneously plots the proportion of repeats (rep%) in a color scale (or vice versa). Hence, it is possible to assess the contribution of repeats to the total GC%. The main differences are the GC% of repeats homogenizing the overall GC% along fish chromosomes and a greater range of GC% scattered along fish chromosomes.
    [Show full text]
  • Understanding Explosive Diversification Through Cichlid Fish Genomics
    REVIEWS Understanding explosive diversification through cichlid fish genomics Walter Salzburger Abstract | Owing to their taxonomic, phenotypic, ecological and behavioural diversity and propensity for explosive diversification, the assemblages of cichlid fish in the East African Great Lakes Victoria, Malawi and Tanganyika are important role models in evolutionary biology. With the release of five reference genomes and many additional genomic resources, as well as the establishment of functional genomic tools, the cichlid system has fully entered the genomic era. The in-depth genomic exploration of the East African cichlid fauna — in combination with the examination of their ecology , morphology and behaviour — permits novel insights into the way organisms diversify. Model organisms Why is species richness so unequally distributed across and morphological diversity as a consequence of adap- Non- human species studied in the tree of life? Why did some organismal lineages diver- tation to novel or hitherto underutilized ecological detail in the context of a sify into new forms in a seemingly explosive manner, niches14,15 — combine the advantages of laboratory and particular research question whereas others have lingered phenotypically unvaried natural model species in the context of the genesis of with the motivation to be able to make more general over millions of years? These questions have puzzled biodiversity. Therefore, iconic examples of adaptive radi- statements about the generations of biologists ever since Darwin and Wallace ation, such as Darwin’s finches on the Galapagos archi- functioning of organisms. jointly introduced their theory of evolution by natural pelago, anole lizards on the islands of the Caribbean, selection1. 160 years of scholarly study later, there is a rea- threespine stickleback fish in post- glacial rivers and Clades sonable understanding of how and under which circum- lakes, and cichlid fish in East Africa (BOx 1), have long Branches on an evolutionary 2–7 tree, consisting of a common stances new species can originate .
    [Show full text]
  • BMC Evolutionary Biology Biomed Central
    BMC Evolutionary Biology BioMed Central Research article Open Access Phenotypic novelty in experimental hybrids is predicted by the genetic distance between species of cichlid fish Rike B Stelkens*1,2,3, Corinne Schmid1,2, Oliver Selz1,2 and Ole Seehausen*1,2 Address: 1Division of Aquatic Ecology & Macroevolution, Institute of Ecology and Evolution, University of Bern, Baltzerstr. 6, CH-3012 Bern, Switzerland, 2Department of Fish Ecology and Evolution, Centre for Ecology, Evolution and Biogeochemistry (CEEB), Eawag Swiss Federal Institute of Aquatic Science and Technology, Seestrasse 79, CH-6047 Kastanienbaum, Switzerland and 3Department of Ecology and Evolution, University of Lausanne, Biophore, CH-1015 Lausanne, Switzerland Email: Rike B Stelkens* - [email protected]; Corinne Schmid - [email protected]; Oliver Selz - [email protected]; Ole Seehausen* - [email protected] * Corresponding authors Published: 4 December 2009 Received: 8 March 2009 Accepted: 4 December 2009 BMC Evolutionary Biology 2009, 9:283 doi:10.1186/1471-2148-9-283 This article is available from: http://www.biomedcentral.com/1471-2148/9/283 © 2009 Stelkens et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Transgressive segregation describes the occurrence of novel phenotypes in hybrids with extreme trait values not observed in either parental species. A previously experimentally untested prediction is that the amount of transgression increases with the genetic distance between hybridizing species. This follows from QTL studies suggesting that transgression is most commonly due to complementary gene action or epistasis, which become more frequent at larger genetic distances.
    [Show full text]
  • Species Commonname Accession Seqstart Seqcomment Class Order
    Species CommonName Accession SeqStart SeqComment Class Order Annotation Anabas testudineus climbing perch XP_026222100.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Anabantiformes zinc finger protein 423 Gouania willdenowi blunt-snouted clingfish XP_028305499.1 MSRRKQAKPRSVKVEEGESSECGGTWDESTLQTEVPVMSRRK has wide phylogeny Actinopterygii Blenniiformes zinc finger protein 423 isoform X2 Salarias fasciatus jewelled blenny XP_029952236.1 MSRRKQAKPRSVKVEEGESSECGGTWDESTVQTDVLASMSRRK has wide phylogeny Actinopterygii Blenniiformes zinc finger protein 423 isoform X2 Echeneis naucrates live sharksucker XP_029379029.1 MSRRKQAKPRSVKAVEEGESSECGGTWDESTVQTEVPASMSRRK has wide phylogeny Actinopterygii Carangiformes zinc finger protein 423 Astyanax meXicanus blind cave fish XP_007249250.1 MSRRKQAKPRSVKAVEEADSAEFTGSWDSTTAADAAVMSRRK has wide phylogeny Actinopterygii Characiformes PREDICTED: zinc finger protein 423 isoform X2 Pygocentrus nattereri red piranha XP_017546794.1 MSRRKQAKPRSVKAVDEAESAEFTSSWDSSAPADVAVMSRRK has wide phylogeny Actinopterygii Characiformes PREDICTED: zinc finger protein 423 isoform X3 Astatotilapia calliptera eastern happy XP_026032600.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes zinc finger protein 423 isoform X1 Haplochromis burtoni Burton's mouthbrooder XP_005945132.1 MSRRKQAKPRSVKAVEEGESSECGGTWDGSTVQTDVAAMSRRK has wide phylogeny Actinopterygii Cichliformes PREDICTED: zinc finger protein 423 isoform X2 Maylandia zebra Malawi blue cichlid XP_004569239.1
    [Show full text]
  • Age of Cichlids: New Dates for Ancient Lake Fish Radiations
    0%($GYDQFH$FFHVVSXEOLVKHG0DUFK $JHRIFLFKOLGV1HZGDWHVIRUDQFLHQWODNHILVKUDGLDWLRQV 5HVHDUFK$UWLFOH 0DUWLQ-*HQQHU2OH6HHKDXVHQ'DYLG+/XQW'RPLQR$-R\FH3DXO:6KDZ *DU\5&DUYDOKRDQG*HRUJH)7XUQHU 'HSDUWPHQWRI%LRORJLFDO6FLHQFHV8QLYHUVLW\RI+XOO&RWWLQJKDP5RDG+XOO+85;8QLWHG .LQJGRP ,QVWLWXWHRI=RRORJ\$TXDWLF(FRORJ\DQG0DFURHYROXWLRQ8QLYHUVLW\RI%HUQ%DOW]HUVWU&+ %HUQ6ZLW]HUODQG ($:$*(FRORJ\&HQWHU)LVK(FRORJ\DQG(YROXWLRQ&+.DVWDQLHQEDXP6ZLW]HUODQG 6FKRRORI%LRORJLFDO6FLHQFHV5R\DO+ROORZD\8QLYHUVLW\RI/RQGRQ(JKDP6XUUH\7:(;8QLWHG .LQJGRP 6FKRRORI%LRORJLFDO6FLHQFHV8QLYHUVLW\RI:DOHV%DQJRU%DQJRU*Z\QHGG//8:8QLWHG .LQJGRP &RUUHVSRQGLQJDXWKRU0DUWLQ-*HQQHU6FKRRORI%LRORJLFDO6FLHQFHV8QLYHUVLW\RI+XOO&RWWLQJKDP 5RDG+XOO+85;8.7HO )D[ 5XQQLQJKHDGOLQH0ROHFXODUGDWLQJRIFLFKOLGILVKUDGLDWLRQV .H\ZRUGVPROHFXODUFORFN*RQGZDQDQIUDJPHQWDWLRQIRVVLOUHFRUGDGDSWLYHUDGLDWLRQVSHFLDWLRQ 7KH$XWKRU3XEOLVKHGE\2[IRUG8QLYHUVLW\3UHVVRQEHKDOIRIWKH6RFLHW\IRU0ROHFXODU%LRORJ\ DQG(YROXWLRQ$OOULJKWVUHVHUYHG)RUSHUPLVVLRQVSOHDVHHPDLOMRXUQDOVSHUPLVVLRQV#R[IRUGMRXUQDOVRUJ Abstract Timing divergence events allows us to infer the conditions under which biodiversity has evolved and gain important insights into the mechanisms driving evolution. Cichlid fishes are a model system for studying s.eciation and adaptive radiation, yet we have lacked reliable timescales for their evolution. Phylogenetic reconstructions are consistent with cichlid origins prior to Gondwanan landmass fragmentation 165-121 million years ago, considerably earlier than the first known fossil cichlids (Eocene). (e eCamined the timing
    [Show full text]