Book 10,'Page 51; And

REGULAR MEETING AMU 1938 TUESDAY

Be it remekbered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session at the Mayor's office,at 7:30 P.M., Tuesday, - April 5, 1938, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor: R.X. Williams, Presiding Aldermen: Branham Hume, Alderman-at-large

T.E. Avent, Aldermen Ward 1 W.T. Chandler, Alderman, Ward 2 C.H. Roach, Alderman, Ward 4 * * * * * * * * * * * * * * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk C.A. Bretton, City Attorney V.C. Jones, Marshal

After the meeting had been opened according to law, the following business was . transacted:

;Pon motion duly made•and seconded it was ordered that the following accounts be allowed and that warrants be issued accordingly, From the CORPORATION FUND 483. R.S. Williams, Mayor, March salary - 480.00 484• Branham Berne, Alderman, " * 2. T.E. Avant, * • * * -411g,g'g « le .- . W.T. Chandler, " $10.00 487. W.L. Kennon, " • 9. - $10.00 488.C.H. Roach, * * *, $10.00 489. H.A. Moore, • • " . $50.00 490.V.C. Jones, Marshal • * * ------#125.00 491. Sam Keel, Night W * * $100.00 492.R.N. Whitfeild, Bandmaster for March, $49.00 493. C.A. Bretton, Attorney for March- $40.00 494.Mrs. O.E. Holcomb, Matron for March $20.00 495. Lillian Jones, Secretary for " #40.00 496. H.A. Moore, T.C., Labor tickets, etc $94.91 497. J.B. Shultz, Installing pump $6.00 490. Belk Garage, Rep. to gas tank $1.5o 499. Elliott Lumber Company, Supplies $7.49 500.Porter Hardware Co., #13.31 501. Alex-Load, Payment on uniforms- #100.00 502.Arkansas Fuel Oil Co., Gas $3.52 503.Detex Watohclock Crop., Repair to clock 504. Bederman Brothers, Supplies 4:22 50 ,C.E. Harrison, 'chief and 17 firemen $27.40 506.Keuffel & Esser Co., Supplies $8.31 507.J.E. Neilson Co., Supplies $6.28 50o. Geo. Z. Mayer Co., " $18.15 509. S.C. Too!To Co., * $21.47 510.Geo. D. Barnard, * $31.45 511.C.A. Bratton, Fees in L.A.Smith&s court. $9.50 512. N.B. Pettis, Surveying in March $83.94 (Continued on page 2 REGULAR MEETING, APRIL 5, 1938

CORPORATION FUND(Continued)

513.L.G. Lynch, Coal, Pas $54.46 514.Oxford Eagle, Election Notice 45.70 515.A.B. Avant, Supplies for rest room $4A75 516.Hughes Hardware, Supplies X38 .75 517.HUE. Dean, Exp. in Buie case 47.50 Total $1124.61

STREET FUND

518.S.E. Spears, Foreman,2March salary 4100.00 519.H.A. Moore, T.C, Labor tickets, etc $430.29 520.Commercial Print Shop, Tickets $2.75 521.W.T. Jones, Keeping prisoners for Mar. $42.50 522.Hell Blacksmith, Laobron truck 41.35 523.J.B. Carpenter & Son, Greasing truck-- .75 524.Davis-Mize, Supplies $2.25 525.Blek Garage, Keeping fire truck, etc $49.30 526.C.G. Huggins, Supplies, Rep. to truck $7.55 527.L.G. Lynch, Gas $49. 05 52b. Hughes Hardware Co., Supplies $1.00 529. A.B. Avent, n .70 Total $687.49 SCHOOL FUND

530.G.S. Byers, Janitor for March $60.00 531.O.D. Smith, Pro rata share of Mar. salary $16.87 532.H.A. Moore, T.C., Telephone 42.90 533.J.B. Shultz, Rep. to water line $12.50 534, Z.E• Neilson, Supplies 415.04 . T.A., Martin, Jr., " 14.40 Gaylord Brothers, " 535537. American Badge Co., Supplies 246 536. Alex-Loed, supplies :14::: 539.Porter Hardware Co., SupplieS $7.5$ n 540.Frazier & Coers, $7.91 541• L.P. McOarty & Son, 542.Oxford Eagle, Supplies Ilit 543.R.H. Gillespie, Engelopes, tuning piano $21.92 544.L.F. Patton, Supplies $1.07 545 Scott, Foreman &Co.,Supplies $2.09 546.Educational Test•Bureau, " $7.81 547.A.L. Kraemer Co., n $17.70 , n 548.Davis-Mize Co., 549.A.C. McClurg & Co., " 4304410.2. i.g Total 9.71

• 4

550.C.E. Harrison, Supt., March salary $245.00 551.G.10. Johnson, Chief Eng.,? " $125.00 552.A.L. Wiling, * 0 " #115.00 553.Louis Campbell, Engineer " " $105.00 554.5, Howard Winter, Lineman " " $105.00 55§. H.A, Moore, March salary $50.00 557. Lillian Jones," " $40.00 5516. T.A. Dunn, Rett for March $50.00 559.Mrs. Lillie Yates, Rent for March $10.00 560.Mrs. H.F. Wilkins, " " " 561.H.A. Moore, T.C., Labor tickets, etc $44g.(1)(0) 562.Commerkial Print Shop, Labor tickets $1.75 563.Patton-Courtney, Supplies $440 564.Hughes Hardware Co., " . 75 . Belk Garage, " $6.0 556. Porter Hardware Co., " $4.00 $42 .39 O Riechman-Crosby Co., " . Henry H. Cross, Fuel oil $584.94 569.Sinclair Refining Corp., Fuel oil flb4.43 570.Graybar, Supplies $63.60 571.Texas Company, Ursa oil $79.67 572.Westinghouse, Supplies $17.10 573.De La Vergne Engine Co., Supplies .336.77 574.Vahan Electric Co., Supplies 2 .39 N.O. Nelson Co., 9, $4b.29 S.C. Toof Co., Payment on supplies $50.00 Crane Company, Supplies $5 .02 Davis-Naze, " . 50 5 . StandardP0il Co., Oil $2.92 . J.E. Dilworth Co., Supplies $5.00 581.Miss. Foundry Co., Supplies 582.Tenn. Valley Electric Co., Supplies 583.Fischer Lime & Cembnt Co., " * 584. 2Parta Sewer Machine Co., $96.50 12. Geo. Paper Stock Co., Supplies 5 . American Locomotive Co., " 17. Pittsburgh Equitable Meter CO., Supplies Ili.ii

8. L.G. Lynch, Gas- - !!!!! ;

$3242.33

FRONT-FOOT FUND

589. H.A. Moore, T.C, Exchange on check $3.43 * * * * * * * * * * *

For value received and in consideration of a loan made to me this date by the Bank of Oxford, Oxford, Mississippi, due and payable monthly by the City of Oxford, I hereby assign and transfer my chose in action against said City of Oxford, Mississippi, for $1000.00, being legal services heretofore rendered in the matter of custodian of the will of Mrs. M.C. Buie, deceased, and as further evidenced by order City of Oxford, appearing on page 251, Minute Book 9, of the Minutes of the Mayor and Board of Alderman of the City of Oxford, Miss- issippi, at a Special Meeting undar date of November 9, 193, said transfer by me being as collateral security to my vote favor of said Bank of Oxford, Oxford, Mississippi, in the amount of $900.00 as of this date, due and apyable $100.00 per month and interest, beginning on May 5, 1938, and each succeeding month, on or about seine date, thereafter until the principal and interest on note to said Bank of Oxford, is paid in full. Witness my signature this the 2nd day of April, 1938 Bratton. Approved and accepted this the 4th day of April, 1938 R.X. Williams, .Mayor, City of Oxford, Miss.

W•T. Chandler, Clerk City of Oxford, *se. TUESDAY REGULAR MEETING, APRIL 5, 1938 OXFORD? MISS.

Upon motion duly made and seconded it was ordered that warrant be issued payable to Porter Hardware Company in the sum of $7.50 same being refund for erronious collection of Privilege tax for 1936. * * * * * * * * * * * * * * * * * * * * * *

Uppn motion duly made and seconded, it th ordered that this Board do now recess until 3 o'clock P.M., Zuesday, April 19, 1938.

* * * * * * * * * * * * * * * * * * * * *

OXFORD, MISSISSIPPI TAOSDAY, APRIL 19, 1938

The Bthrad met pursuant to the above and foregoing recess order of April 5, 1936, at 3 o'clock P.M., when and where were present the following members:

R.X. Williams, Mayor

$ranham Hume , Aldermanl-at,-large

T.E. Avent, Alderman, Ward 1

W.T. Chandler, Alderman, Ward 2

C.H. Roach, Alderman, Ward 4 * * * * * * * * * * * * * * * * * * ** H.A. Moore, Deptty City Clerk C.A. Bretton, City Attorney OXFORD, MISSISSIPPI APRIL 19, 1938

On motion of Alderman Hume and second by Alderman Chandler, it is ordered that the City of Oxford appropriate the sum of 4,5000 out of Corporation fund for the Oxford Band for trip to Jackson on April 28th, 1938. Those voting yea: Alderman Hume and W.T. Chandler and Mayor Williams. Those voting Nay: Alderman Avant and Alderman C.H. Roach. * * * * * * * * * * * * * * * * * * * * * * *

Mption came on for consideration to permit W.B. Mayfield or his agent to construct a set of steps not more than three feet in width and to comply with the requirements of the Superintendent of the City Light and Water Plant, of his building located on the South east corner of the city square just north of Van Buren Avenue. The steps or addition to be removed at any time upon the order of the officials of the City of Oxford, Mississippi. * *B* * * * * * * * * * * * * * * *

Upon motion duly made and seconded, this Board did now adjourn sine dial

&Oar ,AL.e.(9 XX/tai7710.,(/-1,, ,T. Chandler, Clerk R.A1Z ems, Mayor

REGULAR MEETING MAY 3, 1938 TUESDAY * * * * * * * * * * * * * * * * * * * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi in regular session at the Mayor's office at 7:30 P.M., Tuesday, May, 3, 1935, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor: R.X. Williams, Presiding Aldermen: Branham Hume, Alderman-at-large T.E. Avent, Alderman, Ward 1

W.T. Chandler, " " 2

W.L. Kennon, “ 3 C.H. Roach, " 4 * * * * * * * * * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk C.A. Bretton, City Attorney V.C. Jones, Marshal

After the meeting had been opened according to law, the following business was transacted: Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants be isued accordingly, From the CORPORATION FUND

595• R•X• Williams, Mayor, April salary $80.00 596.Branham Hume, Alderman " " $10.00 597.LE. Anent, " " " $10.00 598.W.T. Chandler, " s s 410.00 599.W.L. Kennon, " " " 600. C.H. Roach, " " " :10. °0! 601.H.A. Moore, " s $50.00 602.V.C. Jones, Marshal " " *125.00 603.Sam Keel, Nightwatchman " " $100.00 604.R.N. Whitfield, Bandmaster, April salary $40.00 605.C.A. Bratton, Attorney " " $40.00 606.Mrs. O.E. Holcomb, Matron " " $20.00 607. Lillian Jones, Sectretary s s • 6o8. H.A. Moore, T.C., Supplies, etc $1g2 .

609. Geo. D. Barnard, Supplies- -- $1.11 610.Oxford Insurance Co., Insurance $1$170.00 611.Oxford Eagle, Ballots, ribbons, etc $33.50 612.John Murphrey, Hauling poles *15.00 613.Ole Miss UMCA, Ad. in M Book $10.00 614.Hall Blacksmith, Repairing $2.05 61 5.444 Service Station, Supplies 616.C.E. Harrison, Chief and 47 firemen 05. 00 617.S.C. Toot Company, Supplies :07: 618.Alex-Coed, Bal. due on uniforms $52.50 619.Phil Carnathan, Manager, 2 elections 620. Jones Porduce Company, Coal *in 621.J.E. Neilson Co., Supplies $13.25 (Continued on next page)

REGULAR MEETING MAY 3, 1938 7

CORPORATION FUND (Continued)

622. Earl Freeman, 8 days work on street $28.00 623. E.H. Tucker, 5 * " " * $16.67 624. 0.D. Livingston, 26 days work on street $95.33 625. Porter Hardware Co., Supplies $2.24 626. 0.H. Douglass, Upkeep of cementary for April $50.00 627. C.A. Bratton, Attorney fee in Buie case $100.00 $1640.82

STREET FUND

628. S.E. Spears, Salary for April $100.00 629. H.A. Moore, T.C., Labor tickets, etc-4323.52 630. Henry I. Lovelady,Truck hire $1.50 631. W.T. Trusty Co., Disk harrow $40.50 632. Elliott Lumber Co., Supplies $16.68 633. L.G. Lynch, Gas, hauling sand $178.70 634. Walter D. Pettis, Surveying $34.10 635. Davis-Mize Company, Supplies $3.60 636. Standard Service Station, Supplies $2.13 VI) 63Z. J.A. Wolf, Lumber $7.50 C.;,) 696. Arkansas Fuel Oil Co., Kerosene $22.83 C\L 639. C.G. noggins, Supplies $9.31 LI.. 640. Elliott Lumber Co., Supplies $3.59 641. Belk Garage, Fire truck service, etc $66.30 642. Hughes Hardware Co., Supplies $10.36 643. Van Oswalt, Rep. to-mower $3.65 644. Porter Hardware Co., Supplies $22.47 645. Pittsburgh Plage Glass, " $42.50 646. Road Building Equipment Co., Tires $46• 60 647. Hall Blacksmith, lawn mower roller ..75 646. W.T. Jones, Keeping city prisoners $18.75 Total $955.74

SCHOOL FUND

649. G.S. Byers,' Janitor for April $60.00 650. 0.D. Smith, Pro rate share of April salary-$16.87 651. H.A. Moore, T.C., Telephone, etfe $4.02 652. Porter Hardware Co., Supplies ----$4.14 653. Brown & Brummett, Coal $1..0 6543 Patton-Courtney, Supplies 6!)5. Davis-Mize, Supplies $2.50 656. Cleveland Safety Council, Supplies $1.00 Total $90.04

BOND FUND

657. H.A. Moore, T.C., Ex. on check, fee on check $5.14

MAY 3. 1938 REGULAR MEETING

LGGHT AND WATER FUND

658. C.E. Harrison, Supt., April salary $245.00 659. G.W. Johnson, Ehief Eng.," et $125.00 660. A.L. Mullins, " " $115.00 661. Louis Campbell, 2 " " $105.00 662. Howard Winter, Lineman " * $105.00 664. H.A. Moore, " " $50.00 665. Lillian Jones, Secretary " " $40.00 666. T.A. Dunn, Rent for April $50.00 667. Mrs. Lillie Yates, Rent for April $10.00 668. Mrs. H.F. Wilkins, " " " $15.00 669. H.A. Moore, T.C., Labor tickets, etc $592.87 670. Lighting Fixture Co., Supplies $22.95 671. True-axon Lumber Co., " $2.45 672. L.G. Lynch, Gas $6.75 673. Elliott Lumber Co., Supplies $1.50 674. Patton-Courtney Hdw. Co., Supplies $1.74 675. F.W. Belk Garage, Supplies $2.00 676. Hughes Hardware Co., " $2.30 6777. Westinghouse, Supplies $119.73 678. Te n. Valley Electric Supply Co., Supplies a 4 6 . Duncan Electric Manfacturing Co., " 6 . Standard Oil Company, Supplies $2.92 681. Cabell Electric Company, " 682. Graybar " " " 683. J.E. Dilworth Company " 684. Porter Hardware Co., " 11:14. 112 ..:97: 85. S.C. Toot Company, " $9059 . ! 86. Mceomwell Sales Corp., " $11.00 687. James R. Kearney Corp., " $14.50 688. Pidgeon Thomas Iron Co., " $6.50 689. Gregory Electric Co., ," $195.50 690. Diesel Plant Specialities Co., Supplies $4.19 691. Riechman Crosby, Supplies $21.7§ 692. Wood Preserving Corp., Supplies $97.42 693. American Locomotive Co., " $11107 694. Henry H. Cross Co., " $286.33 695. Avent Drug Store, " .75 696. Hall Blacksmith, Repairs .75 Total $2626.51 * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, this Board does now reOess.until Friday, May 6, 1938 at 7:30 P.M. FRIDAY, MAY 6, 1938 RECESSED MEETING

The Board met pursuant to the above and foregoing recess order of May 3, 1938, at 7:30 P.M., when and where were present the following:

R.X. Williams, Mayor T.E. Avent, Ward 1 W.T. Chandler, Ward 2

C.H. Roach, Ward 4 Branham Hume, Alderman-at-large * * * * * * * * * * * * * * * * * * H.A. Moore, Deputy City Clerk C.A. Bratton, City Attorney

After the meeting had been opened according to law the following business was had to-wit: ORDINANCE NUMBER

AN ORDINANCE FOR THE I SUANCE OF THIRTEEN THOUSAND ($13,000.00)DOLLARS MUNICIPAL SCHOOL BONDS FOR THE PURPOSE OF ERECTING AND EQUIPPING AND ADDI- TION TO THE GRAMMAR SCHOOL BUILDING OF THE CITY OF OXFORD, MISSISSIPPI, AND FIXING THE TIME OF THE MATURITY OF SAID BONDS TO BE SERIALLY OVER A PERIOD OF FIFTEEN (15) YEARS. Whereas, the City of Oxford, Mississippi, applied for, and was granted, the sum of TEN THOUSAND SIX HUNDRED THIRTY-SIX ($10,636.00) DOLLARS by the Federal Emergency Administrator of Public Works upon the City issuing their bonds in the sum of THIRTEEN THOUSAND ( 13,000.00) DOLLARS, dated June 1, 1938, bearing 4% interest per annum, payable semi-annually on June 1st and December 1st in each year, and extending over a period of Fifteen (15) years for the purpose of financing the construction of addition to and equipping the Grammar School Building in the City of Oxford, Lafayette County, Mississippi; and,

WHEREAS, it is necessary to have said addition and equipment, and the said City of Oxford is desirous of availing itself of said offer; and, WHEREAS, it is the opinion of the Board of Mayor and Aldermen of the said City of Oxford, Mississippi, and so adjudged that it shall issue it's Municipal School Bonds in the said sum of THIRTEEN THOUSAND ($13,000.00) DOLLARS, and payable serially over' a period of Fifteen (15) years, being numbered from One to Twenty-six both inclusive, and payable as follows, to-wit:

No. 1 $500.00 due June 1st, 1939 No. 2 500.00 due June 1st, 1940 No. 3 500.00 d e June 1st, 1941 No, 4 500.00 due June 1st, 1942 No. 5 & 6 500.00 deaoLlinelitne4dI, 1943 No. 7 & 8 500.00 deacludaelinnellat, 1944 No. 9 & 10 500.00 deachxidue2Janejlq, 1945 No. 11 & 12 500.00 deachddaa4analldio, 1946 No. 13 & 14 500.00 Bach due June 1st, 1947 No. 15 & lb 500.00 each due June 1st, 194 No. 17 & 18 500.00 each due June 1st, 1949 No. 19 & 20 500.00 each due June lst, 1950 No. 21 & 22 500.00 each due June 1st, 1951 No. 23 & 24 500.00 each due June let, 1952 No. 25 & 26 500.00 each due June 1st, 1953

Whereas, the City of Oxford has less than 12,000 inhabitants, and the amount of the bonds to be issued is not more than 130,000.00, as is provided in Chapter 50 Mississippi Code of 1930, Section 2490, therefore, be it ordained by the Board of Mayor and Aldermen of the gity of Oxford, Mississippi, as follows, to-wit:

SECTION ONE: That said City issue said Municipal School Bonds in the sum of $H1RTEEN THOUSAND ($13,000.00) DOLLARS for the purpose of erecting and equipping an addition for the Grammar School Building in the City of Oxford, Lafayette County Mississippi. RECESSED MEETING MAY 6, 1938

Said bonds shall be in denomination of $500.00, and be numbered from One to Twenty-six, both inclusive, and dated June 1, 1938, and due as heretofore stated.

SECTION TWO: That said bonds shall be executed on behalf of the City of Oxford, Mississippi, the full faith and credit of the said City being hereby pledged for the payment of said bonds and interest coupons to be attached thereto, and a levy of a sufficient amount to be made each year against all the taxable property of the said City for the payment of said bonds and interest.

SECTION THREE: That said bcnds shall be designated as "City of Oxford Municipal School Bonds", and it bear interest at the rate of 4% per annum, payable semi-annually on the 1st day of' Vecemlrstnd June each year. The first installment of interest to be evidenced by coupons attached to said bonds, and both principal and interest shall be payable at the Office of the City Treasurer of the City of Oxford, Oxford, Lafayette County, Mississippi. Said bonds shall be signed by the Mayor and counter-signed by the Clerk of the City of Oxford, Mississippi, under the Seal of the said City, and the interest coupons attached thereto shall have printed or engraved thereon the facsimile signatures of said Mayor and Clerk.

SECTION FOUR: That said bonds and coupons attached thereto shall be substantially in the follswing forms, to-wit:-

UNITED STATES OF AMERICA STATE OF MI SISSIPPI COUNTY OF LAFAYETTE CITY OF OXFORD

CITY OF OXFORD MUNICIPAL SCHOOL BONDS

No. $500.00

The City of Oxford, Mississippi, in Lafayette County, Mississippi, acknowledges itself indebted, and for value received promises to pay to bearer FIVE HUNDRED DOLLARS ($500.00) in lawful money of the United States of America, on the first day of June, 193 , with interest thereon at the rate of FOUR PERCENTUM (4%) per annum, payable semi-annually on the first day ofD-o embtrand the irst day of June of each year upon presentation and surrender of the respective coupons hereto attached as they severally become due, both principal and interest of this bond are payable at the Office of the City Treasurer of the City of Oxford, Oxford, Lafayette County]; Mississippi, and the City of Oxford is hereby firmly bound and the revenue to be derived b a levy on all of the taxable property of the City of Oxford hereafter to be made, and also the full faith, credit, revenue and property of the City of Oxford, Mississippi, are hereby pledged for the punctual payment of the principal and interest hereof at maturity. This bond is one of a series of like date, tenor and effect, except as to number, of an authorized issue of THIRTEEN ThOUSAND DOLLARS (3,000.00), numbered from One to Twenty-six, both inclusive, issued by the said City for the purpose of erecting and equipping an a dition to the Grammar School Budiling of said City, and is issued under authority and in strict compliance with the Constitution and Statutes of the State of Mississippi, including, among others, Chapter 50, Mississippi Code of 1930.

t is hereby certified, recited and declared that all acts, conditions, and things required to exist, happen to be performed precedent to and in the issuance of this bond issue, have ben properly done, have ahappened and have been performed in regular and due form and time as required by law, and that the indebtedness evidenced by this bond does not exceed any Statutory of Constitutional limitations, and that this bond is exempt from taxation in the State of Mississippi.

In testimony whereof, the City of oxford, Mississippi, has caused this bond to be signed by its Mayor and the Clerk of the said City, and the corporate seal to be hereto affixed and the interest coupons hereto attached to bear the facsimile signatures of the said Mityor and Clerk, and this bond shall be dated the First day of June, 1938.

Clerk of the City of Oxford Mayor of the City of Oxford

FORM OF COUPON

No. 1 ,j( $10.00 On iht;e4muirlst, 1939, the City of Oxford, Mississippi, will pay the bearer the sum of $10.00 in lawful money of the United States of America, at the office of the City Treasurer of the City of Oxford, Oxford, Lafayette County, Mississippi, being Sii Months interest then dje on this City of Oxford Municipal School Bond for erecting and equipping an addition to the Grammar School Building, dated .11-.-Jhne 1st, 1938.

the City of Oxford Clerk of the City of Oxford Mayor of RECESSED MEETING MAY 0, 1938

SECTION FIVE: Be it further ordained by the Board of Mayor and Aldermen that there shall be levied a tax annually as provided by law and especially by the above cited laws, against all of the property of the City of Oxford, for the purpose of paying said bonds and interest thereon; a lien is hereby declared to exist on all of said property for said purposed together with fuall faith, credit and revenue of the City of Oxford, Mississippi, and hereby pledges itself for the punctual and prompt payment of these bonds and interest coupons hhereon.

SECTION SIX: Be it further ordaihed that the money derived from this sale of bonds hereon to be issued by placed in a fund to be known as "City of Oxford Municipal Bond Fund for erecting and equipping an addition to the Grammar School Building and the erection and equipping of said addition, and for no other purpose.

SECTION SEVEN: Be it further ordained that for good and sufficient reasons shown to the Board this ordinance shall take effect and be enforced from and after its passage.

The above ordinance having been first reduced to writing, was read, considered, passed and adipted Section by Section, then was read and considered, passed and adopted as a whole, and each instance by a "yea" and "nay" vote, all aldermen voting "yea" on this the 6th day of "*y, 1938, at a regular recessed 1..(J sedition of this Board. C.) (7.■1 * * * * * * * * * * * * * * * * * * * * *

AN ORDINACNRE MAKING ALL OFFENSES AGAINST THE STATE, OFFENSES AGAINST THE CITY.

SECTION ONE: :Be tt ordained by the Mayor and Board of Aldermen of the City of Oxford, Lafayette County, Mississippi, that all offenses against the Laws of the State of Mississippi, which are less than felonies, shall be offenses against the City and punishable as such.

SECTION TWO: The public necessity demanding it, the above ordinance shall be in Pull force and effect from and after its adoption and publication. The above ordinance having been previously reduced to writing was first read and sdopted Section by ection, and was then read and adopted as a whole; those voting "yea" being Alderman/ Avent, Chandler,,Roach and. Hume; those voting "nay" none.

* * * * * * * * * * * * * * * * * * * * * * * *

1113011 motion duly made and seconded it was ordered that this Board do now recess until Wednesday, May 11, 1938 at 0 3:30 P.M. in the Mayor's office of the city of Oxford, Miss., 12

WEDNESDAY, MAY 11, 1938 RECESSED MEETING

The Board met pursuant to the above and foregoing recess order of May 6, 1938, at 3:30, P.M., when and where were present the following:

R.X. Williams, Mayor, Presiding T.E. Avent, Alderman, Ward 1 W.T. Chandler, Alderman Ward 2

Branham Hume, Alderman at-large

C.H. Roach, Wlderman Ward 4 * * * * * * * * * * * * * * * * * * * * * * *

The erection of a wash shed in the streets on Jefferson Avenue, being constructed by Dudley Grimes, was called to the attention of the Board. After discussion a motion was made and seconded that Mr. Grimes be instructed to remove wash shed from city property at once. Those voting "Yea"; were T.E. Avant, W.T. Chandler, C.H. Roach and Branham Hume. Those voting "Nay"; none * * * * * * * * * * * * * * * * * * * *

The matter of employing a cityg attorney was called to the attention of the Board by Alderman Hume, there being no record in the minutes for City Attorney. Nominations were opened for city attorney and Alderman Hume nominated L.C. Andrews and T.E. Avant nominated C.A. Bratton. No other nominations being made a secret ballot was taken. After counting the votes L.C. Andrews received two votes and C.A, Bratton received two voted. There being a tie due to the absence of Dr. W.L. Kennon, Mayor R.X. Williams voted for C.A. Bratton as he was of the opinion that this is the wrong time to change am employees for city without charges being filed for same, making three votes for C.A. Bratton and two votes for L.C. Andrews. * * * * * * * * * * * * * * * * *

Motion made by Branham Hume and seconded by T.E. Avent that the salary for the city attorney be fixed at $40.00 per month. Those voting "Yea": T.E. Avant, W.T. Chandler, C.H. Roach and Branham Hume. Those voting "Nay"; none. * * * * * * * * * * ** * * *

On motion duly made and seconded, it was ordered that this Board do now adjourn sine die. W,T, Chandler, Clerk /0(92111" -4L14-4--I 4frv R.X. Williams, Mayor REGULAR MEETING JUNE 7, 1938 TUESDAY * * * * * * * * * * * * * * *

* * * * * *

Be ti remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session at the Mayor's office at 7:30 P.M., Tuesday, June 7, 1938, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor: R.X. Williams Presiding

1J.7. Aldermen: Branham Hipp, Alderman-at-large C3 T.E. Avent, Alderman Ward 1

W.T. Chandler,.Alderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H. Roach, Alderman Ward 4 * * * * * * * * * * * * * * * *

H.A. Moore,, Dputy Clerk C.A. Bretton, City Attorney V.C. Jones, Marshal

CORPORATION FUND

714.R.X. Williams, Mayor May salary $80.00 715.Branham Hume, Alderman " _ _It $10.00 716.T.E. Avent, " " .» $10.00 717.W.T. Chandler, " " » $10.00 718.W.L. Kennon, " " " $10.00 719. C.H. Roach, " " " $10.00 720.H.A. Moore, » "- $50.00 721.V.C. Jones, Aarhsal » " $125.00 722.Sam Keel, Night Marshal " " $100.00 723.R.N. Whitfield, Bandmaster, May $40.00 024. C.A. Bratton, Attorney " . » $40.00 725.Mrs. 0.E. Holcomb, Matron " » $20.00 726.Lillian Jones, Secretary " " $40.00 727.O.H. Douglass, Upkeep of cemetery 0Or May $50.00 728.H.A. Moore, T.C., Supplies, etc $92.99 729.Avant Drug Store, Supplies $4. 739. Tom Q. Ellis, Exp. in Ritz Theatre trial $20A 731. Guy McLarty, " " " " $38.70 732.Elliott Lumber Company, Supplies $12.85 733.H.J. Lovelady, hauling sand $5.50 734.Geol D. Barnard, Supplies $22.05 735.Oxford Eagle, Supplies $1. 736.Hughes Hardware, " 5 .737. Dr. B.S. L'utyon, Treatment on J. Barringer $2.00 738.Oxford Service Station, Tires & tubes for fire truck-$285.00 739.Patton-Courtney, Supplies- $1.69 740.1.E. Nielson Co., » $1.22 741.Commercial Print Shop, Supplies $4.50 742.Coers Variety Store, " $1.15 (Continued) 14 JUNE 7, 1938 REGULAR MEETING CORPORATION FUND (continued)

743.J.L. Herndon, Supplies $1.28 744.Walter D. Pettis, Surveying $78.00 745.Hall Blacksmith, Repairs 03.5 746.Belk Garage, -abor on truck $2.05 747.Patton-Courtney, Supplies $2.55 748.American La France &Fommite $3.10 1 . 35 $115

STREET FUND

749.S.E. Spears, May salary-- $100.00 750.H.A. Moore, T.C. Labor tickets, etc $538.49 751. S.E. Spears, 197 loads of sand $29.55 752. W.T. Jones, Keeping prisoners 054.50 753. Commercial Print Shop, Supplies 04.50 754. Davis-Mize Co., ” $2.25 75 . Dr. J.R. Simms, Treatment on R.Liggins---$8.00 756.Earl Freeman, 28 days work $98.00 757.E.H. Tucker, 23i days work $78.33 755. O.D. Livingston, 1 month work $110.00 72°. John Cooper, 14 days work $53.67 7b0. S.D. Carson, " " " $49.00 761.J.R. Patterson, 92 days work $20.90 762.Joe Powell, gasoline $14.57 763.Porter Hardware Co., Supplies $19.55 764.Patton Courtney Hdw. Co., Supplies $1.74 765.C.G. Huggins, Rept.to truck $1Z.79 76b. L.G. Lynch, Gas 00.52 7677. L.G. Lynch, hauling sand $150.45 768.Belk Garage, Fire truck service, rep.---$40.95 769.Hughes Hardware, Supplies $2.75 770.Hall Blacksmith, Rep. to fork $1.00 Total $1144.57

SCHOOL FUND

771.G.S. Byers, Janitor for May $60.00 772.O.D. Smith, Pro rata share salary $16.87 773.H.A. Moore, T.C., telephone 774. Webster Publishing Company, Supplies V.:31 775.Elliott Lumber Co., .• $8.85 776.Vinton School Forum Co., Supplies $1. 777.True-Hixon Lumber Co., " $6.b5 770. C.X. Gregory Co., Supplies $6.45 7 9. A.D. Wiley, Janitorial service 7 . Oxford Insurance Co., Insurance $26.25 7 1. American Library Association, Supplies-411.80 782. Public School Publishing Co., " $22.15 783. Scott, Foreman & Co., Supplies $3.15 784. Hughes hardware 04-59 785.Patton-Courtney, $6.23 786.Coars Variety Store, $6.35 787.Porter Hardware $2.45 $203.27 JUNE 7, 1938 REGULAR MEETING

LIGHT AND WATER FUND

788. C.E. Harrison, Supt., May salary $245.00 7§9.GA. Johnson, $125.00 824. A.L. Mullins, $115.00 090. Louis Campbell, $105.00 791-2. Howard Winter, $105.00 793. H.A. Moore, $50.00 794. Lillian Jones, $40.00 795, T.A. Dunn, Rent for May $50.00 796.Mrs. H.F. Wilkins, Rent for May $15.00 797. Mrs. Lillie Yates, " " $10.00 798. H.A. Moore, T.C.? Lkbor tickets, etc $570.2A 799. Patton-Courtney, Supplies 4.68 800. Elliot Lumber Company, Supplies $1.77 801. Robert L. Tomlinson, Rep!! to clock *1.00 802. LIG. Lynch, Gas $40.03 803. Hall Blacksmith,-Rep. tp pick .50 804. Belk Garage, Rep. to bumper $1.00 805. Choctaw Culver & Machinery, Supplies $117.60 80b. Pittsburgh Equitable Meter Co., Supplies 807. Well Machinery Co., Supplies $ 1 4. 808. Woodward Governor Co., " $1.29 809.Tennessee Valley Electric Supply Co., Supplies----$26.92 810. Duncan Electric Company, Supplies 811. Graybar, Supplies 812. N.O. Nelson Co., Supplies $24. 5 813. Mueller Company, 814. General Electtic $36.54 815. W.M. Matthews Corp., " $36.00 816. Tecas Company, Ursa Oil $53.27 817. Standard Electric Stove Co., Supplies $2.38 818. Westinghouse, Supplies $63.00 819. Arkansas Fuel,Oil Co., Ftel oil $480.12 820. Hughes Hardware Suppliew $2.75 Total $2518.23

BOND.FUND

821. C.E. Slough, Validation of. bonds $21.96 822. H.A1 Moore, T.C., Exc. on check $4.10 823. G. Garland Lyell, Validation of bonds 152.50 Total *78.56 * * * * * ** * * * * * * * * Whereas, it appears that the University High School is indebted to the City of Oxford for lights and water from June 30, 1937 to July 1, 1938 and ,

Whereas, it appears that it has heretofore been the custom to make a donation to the said University high School for the purpose of taking care of part of the lights and water account.

It is, therefore, on motion and seconded ordered by the Board of Mayor and Aldermen in regular session that the said University High S hool be, and is hereby allowed the sum of $250.00 as a credit on said account for the period above indicated. * * * * * * * * * * * * * * * * * * * * * * JUNE 7, 1938 REGULAR MEETING

A RESOLUTION EXTENDING THE TIME FOR THE BEGINNING OF THE WORK ON Vile PROJECT GRANUAR SCH&I, BUILDING, OXFORD, MISSISSIPPI.

Whereas, it appears that the City of Oxford made application to the 4.1Its- authorities for a grant for the - construction of an tddition and equipping the same for the Grammar Schoo. Building -in the City of Oxford, Lafayette County, Mississippi and,

iihereas, it appears that said Project was approved and a grant was made, and that in said application the time specified in the accepted offer of the Govern- ment, the work was to begin on July 6, 1938; and

Whereas, it appears that on account of certain necessary changes in the plans it will require three weeks or more before said plans could be submitted; and,

Whereas, it further appears that three months time for the completion of the job, after the starting of the same, will not be enough; therefore,

Be it resolved by the Board of Mayor and Aldermen that an extention of time gor the starting of work be, and the same is hereby requested of the Federal Emergengy Administration of Public Works, and also an extention of time for the completion of said work from three, to four months hereby requested.

The above resolution was this day offered and adopted by the Board of Mayor and Aldermen in rggular session convened on this the 7th day of June, 1938.

H.A. Moore, Deptly R.X. Williams, Mayor Clerk of the City of of the City of Oxford. Oxford

State of Mississippi Lafayette County,

This day personally appeared before me B.A. Moore, Deputy City Clerk, and R.X. Williams, Mayor of the City of Oxford, who acknowledge that they signed the foregoing instrument for the purposes and on the date therein stated.

Witness my signature this the 8th day of June, 1938.

R.X. Williams, Mayor OfttEe City of Oxford

May Commission expires January 1st, 1939. (SEAL)

THE STANDARD FORM OF AGREEMENT BETWEEN OWNER AND ARCHITECT.

THIS AGREEMENT made the Twenty-sixth day of May in the year Nineteen Hundred and Thirty-eight by and between the City of Oxford, Mississippi, E. 4". Williams, Mayor and hereinafter called the Owner and James T. Canizaro, Lampton Building, Jackson, Mississippi, hereinafter called the Architect, witnesseth, that whereas thr Owner intends to erect Addition to Grammar School.

NOW, EBEREFORE, the Owner and the Architect, for the considerations hereinafter named, asgree as follows:

The Architect agrees to perform, for the above named work, professional services as herinafter set forth.

The Owner agrees to pay the Architect for such services as a fee of Six per cent of the cost of the work, with other payments and reimbursements as hereinafter provided, the said percentage being hereinafter referred to as the "basic rate". P.W.A. picket No. 1219 - Total and Grant $24,000.00 Approximate. TUNE 7, 1938 REGULAR MEETING

The parties hereto further agreet to the following conditions:

1. THE ARCHITECT'S SERVICES. The Architect's professional services consist of the necessayr conferences, the proparation of preliminary studies, working drawings, specifications, large scale and full size detail drawings; the drafting of forms of proposals and contracts; the issuance of certificates of payment; the keeping accounts, the gneeral administration of the business and supervision of the work.

2. SEPARATE CONTRACTS 1 The basic rate applies to work let under a single contract. For any portions of the work let under separate contracts, on account of extra service thereby required, the rate shall be four per cent greater, and if substantially all the work is so let the higher rate shall apply to the entire work; but there shall be no such increase on any contracts in connection with which the Owner reimburses the Engineers's fees to the Architect, or for articles not designed by the Architect but purchased under his direction.

3. EXTRA SERVICES AND SPECIAL CASES. If the Architect is caused extra dr- aughting or other expense due to changes ordered by the Owner, or due to the delinquency or insolvency of the Owner or Contractor, or as a result of damage by fire, he shall be equitably paid for such extra expense and the service invol- ved.

Work let on any cost-plus basis shall be the subject of a special charge Cq in accord with the special service required.

If any work designed or specified by the Architect is abandoned or suspend- ed the Architect is to be paid for the service rendered on account of it.

4. PAYMENTS. Payments to the Architect on account of his fee shall be made as follows, subject to provision of Art. 3;

Upon completion of specifications and general working, drawings (exclusive of details a sum sufficient to increase payments on the fee to 60% of the rateor rates of commission arising from this agreement, computed upon a reasonable cost estimated on such completed specifications and drawins, or fd bids have been received, t en computed upon the lowest bona fide bid or bids.

From time to time during the execution of work and in propotion to the amount of service rendered by the Architect, payments shall be made until the agfregate of all payments made on account of the fee under this Article, but not includin any covered by the provisions of Article 3, shall be a sum equal to the rate or • rates of commission arising from this agreement, computed upon the final cost of the work.

Payments to the Architect, other than those on his fee, fall due from time to time as his work is done or as cost are incurred.

No deductions shall be made fromthe Architect's fee on account of penalty, liquidated damages, or other sums withheld from payments ton contracto7s.

5. SURVEY, BORINGS AND TESTS - The Owner shall, so Pas as the work under this agreement may require, furnish the Architect with the following information: A complete and accurate survey of the building site, giving the grades and lines of streets, pavements, and adjoining properties; the right restrictions, easements, boundaries and contours of the building site, and full information as to sewer, water, gas and electrical service. The Owner is to pay for borings or test ptts and for chemical mechainical, or other tests when required.

6. SUPERVISION OF THE WORK. The. Architect will endeavor to guard the Owner against defects and deficiencies in the work of contractors, but he does not guarantee the performance of their contracts. The supervision of en Archi- tect is to be distinguished from the continuous personal serptrintendence to be obtained by the employment of a clerk-of-the-works.

Wh en authorized by the owner, a clerk-of-the-works acceptable to both Owner and Architect shall be engaged by the Architect at a salary satisfactory bo the owner and paid by the owner, upon presentation of the Architect's monthly statements. JUNE 7, 1338 REGULAR MEETING

7. PRELIMINARY ESTIMATES. When requested to do so the Architect will furnish preliminary estimates on the cost of the work, but he does not guarantee the accuracy of such estimates.

8. DEFINITION OF TEE COST OF THE WORK. The cost of the work, as herein referred to, means the cost to the Owner, but such cost shall not include any architect's or engineer's fees or reimbursements or the cost of a clerk-of-the- works.

When labor or material is furnished by the Owner beldw its market cost the cost of the work shall be computed upon such market cost.

9. OWNERSHIP OF DOCUMENTS. Drawings and speCifications as instruments of service are the property of the Architect whether the work for which they are made be executed or not.

10. SUCCESSORS AND ASSIGNMENTS. The Owner and the Architect, each binds himself, his partners, successors, executors, administrators, and assigns to the pther party to this agreement, and to the partners, successors, executors, ad- mintstrators and assigns of such other party in respeft of all convenants of this agreement.

Exvept as above, neither the Owner nor the Architect shall assign, sublet or gransfer his interest in this agreement without the written consent of the other.

11.ARBITRATION. All questions in dispute under this agreement shall be submitted to arbitration at the choice of either party.

The Owner and the Architect hereby agree to the full performance of the covenants contained herein.

IN WITNESS WHEREOF they have executed this agreemrnt, the day and year first above written.

City of Oxford, Mississippi By R.X. Williams, Mayor.

James T. Canizaro, Architect.

Sworn and subscribed before me, R.X. Williams, Mayor of the City of Oxford, Mississippi, on this the 8th day of June, 1938.

R.X. Williams, Mayor of Oxford, Mississippi. My Commission expires January 1st, 1939.

rt0/7 A RESOLUTION ADOPTING A MINIMUM WAGE SCALE FOR-VRA PROJECT- OXFOFD GRAYNAR SCHOOL BUILDING.

Whereas, it appears that under the rules and regulations of the Federal Amergenyy Administration of Pulbic Works that a minimum wate scale be adopted; and, Whereas, the Federal Emergency Administration of Public Works idis approved a project, designated as addition to the Grammar School Building for the City of Oxford, Missisippi, Docket No. Miss. 1219-DSO. and,

Whereas, the said Federal Emergency Administration of Public Works has approved a minimum wage scale for the present project now under construction by the University of Mississippi at Oxford,. Lafayette County, Mississippi; now,

Therefore, be it resolved by the Board of Mayor and Aldermen that the same minimum wage scale be, and the same is hereby adopted for the Gramar SChool Building Project of said City of Oxford, Lafayette County, Mississippi, to-wit: 19 JUNE g, 1938 REGULAR MEETING

PREDETERMINED MINIMUM WAGE SCALE

HOURLY OCCUPATION HOURLY OCCUPATION RATE RATE

Carpenter .5o Concrete Rubber .30 Electrician .65 Reinforcing Rodmen Concrete Finisher •65 Sheet Metal Worker •,5 Marble and Tile Roofer •b5 Setters •75 Truck Driver Ton & Under) •25 Terrozzo Finisher .6o Truck Driver Plumber .75 (Over li Ton) .30 Welder Team Driver .25 Bricklayer Handy Man .25 Pipe Layer-Water .40 (Apprentices & Pipe Layer-Sewer .40 Helpers) Painter .65 (to all trades not Iron Worker .b5 otherwise given) .40 Plasterer .65 Mortar Mixer .35 Lather •65 Concrete Mixr. Opr. .35 td-D Steam Fitter .75 Hoist Operator .5o Tractor .5o Clazier .5o Cg Dump Men .25 All Common Caluker .65 Labor .20 Floor Finisher .6o

It is, therefore, ordered by the Board of Mayor end Aldermen that said wage scale be, and is hereby adopted, and it is ordered that four copies of the same be made. Ordered in regular session of the Board of Mayor and Aldermen on this the 7th day of June, 1938.

H.A. Moore, Deputy R.X. Williams, Clerk of the City of Oxford Mayor of the City of Oxford

State of Mississippi Lafayette Count

This day personally appeared before me H.A. Moore, Deputy City Clerk, and R.X. Williams, Mayor fiat of the City of Oxford, who acknowledge that they signed the foregoing instrument O Cr the purposes and on the date therein stated. Witness my signature this the 8th day of June, 1938.

R.X. Williams, Mayor City of Oxford, Miss. My Commission expires Junuary 1st, 1939. * * * * * * * * * * * * * * * * * * * * * * *

A RESOLUTION AUTHORIZING THE CITY OF OXFORD TO EXECUTE IT'S NOTE IN THE SUM OF $1,355.10 FOR SPECIAL IMPRIVEMENTS ON FILMORE AVENUE.

Whereas, it appears that the City of Oxford by proper resolution authorised special improvements on Filmore Avenue in said City; and, Whereas, it appears that said improvements hate been completed according to the plans and specifications of the engineer in charge, and now in file in the City hall; and, Whereas, it appears that the benefits have been assessed against the property abutting on said Filmore Avenue, and have been assessed on special assessment roll and that said special assessment roll has been approved by this Board; and,

L 20 JUNE 7, 1938 REGULAR MEETING

Whereas, it appears that certain property holders have paid their assessment, but that certain property holders are desirous of availeing themselves of paying their assessment over a period of 10 years in equal installments; and,

"hereas, it further appears that by virtue of Section 2570, Chapter 50 Mississippi Code, of 1930,.this Board is authorized and empoweree in their discretion to borrow money for said purposed improvement, and_to give notes therefore;

Therefore, be it resolved by the Board of Mayor and Aldermen of the City of Oxford, Mississippi, that they issues their note in the sum of $1,355.10 to bear interest at the rate of, not exceeding 6% per annum, for said sum, and that they take the notes of the abu ting property holders for the amount due under said special assessment, which shall be as collateral to the City's note in an equal sum.

Ordered in regular session of the Board of Mayor and Aldermen on this 'Oa 7th day of June, 1938.

H.A. Moore, Deputy City R.X. Williams, Mayor, Clerk, Oxford, Miss. City of Oxford, Miss.

* * * * * * * * * * * * * * * ** *

Be it remembered that notice is given by publication on dates of May 12th, 1938, May 19th, and May 26th of the intention of the Board of Mayor and Aldermen to issue its School Bonds in the sum of $13,000.00 for the purpose of erecting and equiping an addition to the Grammar School Building of the City of Oxford, Oxford, Mississippi, Lafayette County, and fixing the time of maturity of said bonds interest coupons, and Fate of interest; and it further appearing that it was provided in said notice that said bonds would be issued on June 1st, 1938; and

It further appearing that no written protest was filed by the qualified electors of the municipality against the issuance of said bonds on or before the said dtte to-wit: June 1st, 1938.

It is, therefore, round by said Board of Mayor and Aldermen that it is 1404 . necessary to call an election as provided in Section 2490, Mississippi, Code of 1930. * * * * * * * * * * * * * * * * * * *

RESOLVED that the committee of the City proceed to immediatly act with Miss Kate Skipwith, Mr. Will Lewis and Mr. D.G. Neilson in building of an Art Muesum authorized under the will and decree of the Coutt in the Buie will.

The above resolution was offered by Alderman Hume and adopted by a "yea" and "Nay! vote. Those voting '"yea" were Alderman Hume, a.T. Chandler, W.L. Kennon, T.E. Avent and C.H. Roach. Those voting "nay"; None. ** * * * * * * * * * * * * * * * *

It was moved and seconded that Mayor Williams accompany Mr. Will Levisi 414140g4 to Pike County Arkansas and appraise the property in Arkansas divised to the city under the will of Mrs. Buie and confirmed by decree of the Chancery Court of Lafayette County, at the cost of the city. * * * * * * * * * * * * * * * RELEASE CONTRACT BY AND BETWEEN JOHN SMITH BARRING R OF OXFORD, MISSISSIPPI? PARTY OF Th FIRST PART, AND THE CITY OF OXFORD, INC. PARTY OF THE SFCOND DART.

Whereas, it appears that the City of Oxford was engaged in placing light poles and light wires at the Athletic Field for the University High School; and,

Whereas, it appears that John Smith Barringer, colored of Oxford, Mississippi, was employed as a laborer about the erection and stringing of wires to light said Athletic Field; and,

Whereas, it appears that said John Smith Barringer received a scalp wound to his head which cut a nerve on the right side of his head while so engaged about said work; and,

Whereas, it appears that the said City of Oxford had Dr. John Gulley to examine and treat said party of the first part; and,

Whereas, it appears that in said examination the said Dr. Culley found that the said Barringer was suffering from "syphilis" now,

Therefore, in consideration of the City of Oxford employing and paying the said Dr. John Cylley to give the said Barringer a series of three treatments for said "syphilis", and the further consideration of the City of Oxford, holding up during good behavior a fine heretofore imposed on said Barringer on a charge of Assault and Battery the said Barringer hereby releases the said City of Oxford for all claims or demands on account of said injury while engaged about the erection and equipping of the Athletic Field at the Cq University High School on or about the 29th day of April, 1938. "itness the signatures of the said Barringer, party of the first part, add 0.1! the City of Oxford by its Mayor, Hon. Robert X. Williams, Jr., on this the 14th day of May, 1938.

John Smith Barringer Witnesses; Party of the First Part.

C.E. Harrison Robert X. Williams, Jr., City of Oxford, Inc., by its Mayor, Party of the Second Part C.A. Bratton.

AMOUNT PAID BY CITY FOR JOHN SMITH BARRINGER

Avent Drug Store, Prescription & supplies $3.00 Dr. B.S. "uyton, Examination $2.00 Dr. J.C. Culley, treatment $45.00 27 days work 2 $1.50 per day $40.50 (actually worked 3 days) Fine that held up #101.00 Total $191.50 * * * * * * * * * * * * * * * * * *

Came on for consideration the bids submitted for the purchase of fire hose and fire equipment for the11 re department. Upon motion duly made and seconded, it was ordered the further con ideration of the bids be and the same is hereby continued until 3 o'clock P.M., Wednesday, June 8th, 1938. * * * * * * * * * * * * * * * * * *

On motion duly made and seconded it was ordered that this Board do now recess until 3 o'clock P.M., Wednesday, June 8th, 1938, 22

JUNE 8th, 1938 RECESSED _MEETING, WEDNESDAY

The Board met pursuant to the above and forego¢ng recess order of June 7th, 1938, at 3 o'clock P1M., when and where were present the following members:

R.X. Mayor Presiding

Branham Hume, Alderman-at-large

T.E. Avent, Alderman, Ward 1

W.T. Chandler, Alderman, Ward 2

WIZIOMEIIMEMUIDEXiiiiDIPCKMIX3X C.H. Roach, Alderman, Ward 4 _* * * * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk V.C. Jones, Marshal * * * * * * * * * * * * * * * * * * *

for bids Due advertisement having been made according to law/for the purchase of equipment for the Oxford Fire Department, 4bids wereopened publicly and so considered. The Board having considered the same, doth adjudge the bid of the Eureka Fire Hose Coapany as having the lowest and best bid, and upon motion duly made and seconded it was ordered that the Mayor be authorized to sign a contract in confirmity with said bid. * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that this Board do now recess until June 10th, 1938, at 3 o'clock P.M. Friday.

JUNE 10, 1938 RECESSED MEETING FRIDAY

The Board met rsuant to the above and foregoing recess order of June 10th, 1938, at 3 441'clock P.M., when and where were present the follbwing members:

R.X. Williams, Mayor Presiding

T.E. Avent, Alderman Ward 1

W.T. Chandler, Alderman Ward 2

C.H. Roach, Waderman Ward 4 * * * * * * * * * * * * * * * * * * * *

Moore, Deputy Clerk

* * * * * * * * * * * * * * * * * * * *

1.(7) Upon motion made by Alderman Avent and seconded by Alderman Chandler, and duly passed that a warrant be issued for part time payment on Policy (7./. No. VFC-352, United States Fidelity and Guaranty Company and renewal voucher RV-A-42093, dated April 6, 1938, date of expiration and cancelled <1:1 on June 10th, 1938. * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now adjourn sine die. W.T. Chandler, Clerk al-etic,iLy A R.Ailliams, Mayor By 24 NOTICE OF SPFAIAL MEETING

To the Members of the Board of Mayor and Aldermen of the City of Oxford, Mississippi.

Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, at the City Hall at 7:30 o'clock P.M., on the 24th day of June,l938, for the purpose of condidering an offer of the United States of America to aid by way of grant in financing the construction of an addition to the Grammar School Bilding and equiping same and adopting a rsolution approving and authorizing the execution of stch an offer. Dated this 24th day of June, 1938. R. X. Williams, Mayor City of Oxford,Mississippi.

CONSENT TO MEETING

We. the unde rsigned members of the Board of Aldermen of the City of Oxford,Mississippi, hereby accept service of the above and foregoing notice, waiving any and all irregularities 4 n such service and such notice and consent and agree that said Board of Aldermen shall meet at the time and place therein named, and for the purpose therein stated. Branham Hume, W. T. Chandler. C. H. Roach. T. E. Avent. * * * * * * * * * * *

OXFORD, MISSISSIPPI. June 24, 1938. 7:30 P.M.

The Board of Mayor and Aldermen of the City of Oxford, Mississippi,met at the Mayor's Office at 7:30 P.M., June 24, 1938, as per the above"Notice of "Special Meeting" when and where the following members were present : R. X. Williams, Mayor, Presiding. Aldermen : Branham Hume. T. E. Avent. 4licallqar=mdchar, C. H. Roach. Absent : W.T.Chandler, W.L.Kennon. After the meeting had been opened according to law the following business was transacted, to-wit :

After discussion of the offer of the United States of America to aid by way of loan and grant in financing the construction of of an addition to the grammar School Building, the following resolution, numbered , and entitled "A Res- olution Accepting the offer of the United States bf America to aid by way of loan and grant in Financing the Construction of an addition to the Grammar School Building was proposed by T. E. Avent, and read in full :

RESOLUTION NO.

A resolution accepting the offer of the United States to the City of Oxford, Mississippi, to aid by wal of loan and grant in financing the construction of.grammar school building.

Be it resolved by the Mayor and Board of Aldermen :

Section 1. That the offer of the United States of America to the City of Oxford,Mississippi, to aid by way of loan and grant in financing the construction o! Grammar School Building, a cbpy of which reads as follows : Washington, D. C. Dated : Apr. 27, 1938 Docket No. Miss. 1219-DS City of Oxford, Oxford, LaFayette County, Mississippi.

1. Subject to the terms and conditions (PWAForm No.230) which are made a part thereof, the United States of America hereby offers•to aid in financing the construction of additions to and alteration of an existing school building inciuding necessary equipment therefor (herein called the "Project")by making a gr ant to the City of Oxford,LaFayette County, Mississippi,Herein called the "Applicant9 in the amount of 45 per cent of the cost of the Project upon completion,as determined by the Federal Emergency Administration of Public Works, but not to exceed in anywltVe sum of $10,636,and by pruchasing at the principal amount thereof plushinyerest thereon,fromthe Applicant, obligations of the description set fortlibelow (or such other description as shall be mutually satisfactory) in the aggregate principal amount of $13,000 : (al Obligator : City of Oxford; (b) Type : Negotiable,general obligayion,serial,coupon bond; (c) Dehothination $500 (d) Date : June 1, 1938 (e) Interest rate and interest payment dates: 4 per cent per annum, payable semi-annually on June 1 and Decemerbl, in each year; (f) Place of Payment : At the office of the City Trasurer of the City ofOxford,Oxford,LAVayette County,Mississippi; (g) Maturities :Payable on June 1 in the amounts and years as follows : A.A,44wcALAP.% $500 in 1939 to 1942 and $1,000 in 1943 to 19 j , inclusive ; (h) Payable as to both principal and interest from ad valorem taxes which may be levied without limit as to rate of amount upon all the taxable property within the territorial limits of the Applicant.

2. By acceptance of this order the Applicant covenants to begin work on the Project as early as possible but in no event later than tea weeks from the date of this offer and to complete such Project with all pradticahle dispatch, and in any event within 3 month from the commencement of construction.

LrD United States of America . Federal Emergency Administrate of Publis Works rz-4 By (Sgd.) H. A. Gray Assistant Administrator be and the same is hereby in all respects accepted.

Section 2. That said City of Oxford,Mississippi,agress to abide by all the terms and conditions relating to such loan and grant)a copy of which terms and conditions were annexed to the Governmant's offer and made a part thereof.

Section 3. That the. City Clerk be and he is hereby authorized and deirected forthwith to send to the Federal Emergency Administation of Public Works theree certified copies of this Resolution and three certified copies of the proceeding of this meeting in connnection with the adoption of this Resolution, and such Cutther documents of proofs in connnection with the acceptance of said offer as may be requested by the Federal Emergency Administration of Public Works.

The above resolution was seconded by Alderman Branham Hume, and was adopted, with the following yotin& aye; rRBrahham Hume,T.E.Avent. C.H.Roach; and the following voting nay : None

The Mayor thereupon declared said resolution carried and the Mayor thereupon signed said resolution in approval thereof.

Upon motion duly made and seconded it was ordered that this Board do now addourn sine die ) b\i't-tet-ILLtArt/1/ W. T. Chandler, Clerk mayor ByjiawattAllaaePutY

REGULAR MEETING JULY 5, 1938

TUESDAY * * * * * *

* * * *

* * *

Be it remebered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi met in regular session at the Mayor's office at 7:30 P.M. Tuesday, July 5, 1938, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor: R.X. Williams Presiding

Alderman Branham Hume, Alderman-at-large

T.E. Avent, Alderman, Ward One

C.H. Roach, Alderman, Ward Four * * * * * * ** * * * * * *

H.A. Moore, Deputy Clerk C.A. Bratton, City Attorney V.C. Jones, City Marshal

After the meeting had been opened according to law, the following business was transacted:

Uppn motion duly made and seconded it was ordered that the following accounts be allowed and that warrants be issued accordingly, From the

831. R.X. Williams, Mayor, June salary $80.00 832. Branham Hume, Alderman," t. $10.00 /1 833. T.E. Avent, ft " 410.00 W.T. Chandler, tip t. .. 410.00 834. I, If ., 5,3 . W.L. Kennon, $1o.00 83 . C.H. Roach, ft ft ft $1o.00 837. H...Mbore, U t. 836. V.0.,„Tones,'MArshal, " ,, $125.00000 839. Sam Keel, Night watchman, June salary $100.00 840. R.N. Whitfield, Bandmaster " t. $40.00 ft 041 . C.A. Bratton, Attorney " .00 842. " " . Fee in Buie case $100.00 843. Mrs. 0.B. Holcomb, Matron, June salary $20.00 844. Lillian Jones, Secretary, " tt $40.00 845. O.H. Douglass, Cemetray upkeep for June $50.00 846. H.A. Moore, T.C. Supplies, telephone, etc----$23.20 847. Elliott Lumber Company, Supplies $7,43 84.0xford Eagle, Notices $7b.00 849. Haney-ClieVrdlet Co;, Refund on'Ptivilege $7.75 850. L.G. Lynch, hauling sand & truck hire $35.00 851. H.J. Lovelady, hauling sand $20.75 852. S.E. Spears, 50 loads of sand $7.50 853. Geo. D. Barnard, Supplies $4.19 854.Porter Hardware Co., " - $2.70 855. Patton-Courtney, Supplies $2.45 856.Belk Garage, Rep. on truck $10.00 857, Walter D. Pettis, Surveying 4'5 .00 855. A.H. Avent, Supplies $ .55 Total $1239.52

REGULAR MEETING JULY 5, 1938

STREET FUND

859. S.E. Spear,s June salary $100.00 86o. H.A. Moore, T.C., Labor ticket6 $371.49 861. Oxford Eagle, Bids on fire Dept. mat. $6.60 862. Hughes Hardware, Supplies' s ' $2.20 863. Fischer Lime • Cement Co., Supplies $6.93 ,t; 864. P.A. Wilson, Rep. to tire $2.85 865. Blue Star Service, 1 ice book $5.00 866. Belk Garage, Fip5 truck, rep. $40.80 867. Davis-Mize Co.-, Supplies $2.25 868. Shapliegh Hardware Co., Brooms $9.00 869. C.G. Huggins, Rep. to truck $4. 0 870. Standard Service Station, Rep. to truck $ .05 871.L.G. Lynch, Gas & oil $446.25 872.0.D. Livingston; 18 days work $66.00 873.Hudson Walker, 3 days labor $7.50 874. E.H. Tucker, 3 days labor $10.00 875, John Cooper, 3 days labor $11.50 876. S.D. Carson, 3 days labor $10.50 877. J.R. Patterson, 2 days labor $4.40 878. Earl Freeman, 152 days labor $$3.25 879. Van Oswalt, Rep. mower $3.50 800. W.T. Jones, Keeping prisoners for June----$15.50 881 Porter Hardware Co., Supplies $5.65 882. Hughes Hardware, Supplies $3.10 883.444 Service Station, Rep. to tire $1.25 884. Stokes Motor Co., It .50 $803.45

SCHOOL FUND

5. O.S. Byers, Janitor for June $6o.00 886. O .D. Smith, Pro rate share of June sal pi $16.87 887. H.A. Moore, T.C., Telephone $2.55 888. Porter Hardware Co., Supplies $3.32 889. Oxford Insurance Agency, Insurance $15.75 890. Hughes Hardware Co., Supplies $2. 6 891. Patton-Courtney Hdw. Co., Supplies .10 Total 101.44 28

REGULAR MEETING JULY 5, 1938

LIGHT AND WATER FUND

892. C.E. Harrison, Supt., June salary- $245.00 893.G.. Johnson, Chief Eng., June salary $125.00 894. A.L. Mullin, Eng., June salary- $115.00 895. Louis Campbell, June salary $105.00 896,7- Howard Winter, Lineman, June salary--- $105.00 898. B.A. Moore, " I, $50.00 I. 899. Lillian Jones, secretary, " $40.00 900. T.A. Dunn, Rent for June $50.00 901. Mrs. H.F. Wilkins, Rent for June $15.00 ft 902. Mrs. Lillie Yates, " " $ 10.00 903. H.A. Moore, T.C, Labor tickets, etc----- 1351.04 904. L.G. Lynch, Gas $40.98 905. W.R. Boles, Rep. to strap $1.15 906. Patton-Courtney, Supplies .71 90 .Hughes hardware Co., Supplies $5.0 ., 908. Porter Hardware Co., $4.85 909. Blue Star Service, 1 ice book $5.00 910. Akransas Fuel Oil Co., Fuel Oil $478.0 911. Westinghouse, Supplies $112.30 912. Duncan Electric Manf. Co., Supplies $188.40 913. Graybar, Supplies- $34.40 914.Bristol Company, Supplies $4.39 915. Gould Pumps, “ ...II±Iiiiii/I/ii,IiIii'r t1 .3b 916.Tennessee Valley Electric Co., Su:mlies- $16.25 917. Brown Electric Co., Supplies $125.00 918. Lewis Supply Co., .• $16.40 919. Crane Company, Supplies 417.32 920. General Electric Co., Supplies--- $36.27 921. Pittsburgh Equitable Meter Co., Supplies $20.79 922. Mueller Company, Supplies $13.78 923. Pidgeon Thomas Iron Co., Supplies $14.71 924. Riechman Crosby Co., Supplies $13.72 925. Elliott Lumber Co., .. .80 Total $2362.83 * * * * * * * * *

RESOLUTION NO.

A RESOLUTION ACCEPTING THE OFFIR OF THE UNITES STATES TO THE CITY OF OXFORD, MISSISSIPPI, TO AID BY WAY CF LOAN AND GRANT IN FINANCING ThE CONSTRUCTICN OF A SCHOOL BUILDING AND EQUIPMENT.

Be it resolved by the Mayor and Board of Aldermen:

Section 1. That the offer of the United States of America to the City of Oxford, MississiTi, to aid by way of loan and grant in financing the construction of a School Building and Equipment, a copy of which offer reads as gollows: Washington, D.C., Dated: Jun 24, 1938 Docket No. Miss 1245-F

City of Oxford, Oxford, Lafayette County, Mississippi.

1. Subject to the Terms and Conditions (PWA Form No. 230, as amended to the date of this Offer) which are amde a part hereof, the United States of America (herein called the "Govern _ent") hereby offers to aid in financing the construction of a school building, including necessary equipment therefor (herein called the "Project"), by making a grant to the City of Oxford (herein called the "Applicant"), in the amount of 45 percent of the cost of the Project upon completion, as determined by the Federal Emergency Administrator of Public Works, but not to exceed, in any event, the sum of $20,454, and by purchasing, at the principal amount thereof plus accrued interest thereon, from the Applicant, obligations of the description set forth below (or such other description as shall be mutually satisfactory) in the aggregate principal amount of $19,000: 2 REGULAR MEETING JULY 5, 1938

(a) Obligor: City of Oxford;

(b) Type: Negotiable, general obligation, serial, coupon bond:

(e) Interest rate and interest payment dates: 4 percent per annum payable semi-annually on February 1 and August 1 in each year:

(f) Place of Payment: Office of the City Treasurer, Oxford, Mississi7Ti;

Maturities: $1,000 on August 1 in each of the years from 1939, inclusive:

(h) Payable as to both principal and interest from ad valorem taxes which may be levied without limit as to rate or amount upon all taxable property within the territorial limits of the City of Oxford.

2. This offer conditioned upon the Applicant's depositing in the Construct- ion "ccount described in the Terms and Conditions, prior to the payment by the gn Government for any obligations which it herein offers to purchase, the sum of C:1) $6,000 or such other amount as, in addition to the funds to be furnished by the C■/ Government, may ye necessary to complete the Project. 3. Dy acceptance of this Offer the Applicant covenants to begin work on the Project as early as possible but in not event later than 12 'leeks from the date of this Offer and to complete such Project with all practicable dispatch, and in any event within 5 months from the commencement of construction.

UNITES STATES OF AMERICA

Federal Emergency Administrator Of Public Works

By (Sgd.)' H.A. Gray Assistant Administrator

be and the same is hereby in all respects accepted.

Section2. That said City of Oxford, Missisippi, agrees to abide by all the terms and conditions relating to such loan and grant a copy of which terms and conditions were annexed to the Governemtn's offer and made a part thereof.

Section 3. That the City Clerk be and he is hereby authorized and directed forthwith to send to the Federal Emergency Administration of Public Works. three certified copies of this R e solution and three certified copies of the proceedings of this meeting in connection with the adoption of this Resolution, and such further documents or proofs in connection with the acceptance of said offer as may be requested by the Federal Emergency Administration of Public forks.

The above resolution was seconded by Alderman T.E. Avent and was adopted, with the following voting aye: Alderman Branham Hume, Alderman T.E. Avent, and Alderman C.H. Roach and the following voting nay: None.

The Mayor R.X. Williams thereupon declared said Resolution carried and the Mayor R.X. Williams thereupon signed said ReSolution in approval thereof. * * * * * * * * * * * * * * * * * * * * * * *

RESOLUTION NO.

A RESOLUTION ACCEPTING THE OFFER OF TEE UNITED STATES TO THE CITY OF OXFORD, MISSISSIPPI, TO AID BY WAY OF LOAN AND GRANT IN FINANCING THE CONSTRUCTION OF GRAMrAAR SCHOOL BUILDING.

Be it resolved by the Mayor and Board of Aldermen:

REGULAR MEETING JULY 5, 1938

Section 1. That the offer of the United States of America to the City of Oxford, Mississippi, to aid by way of loan and grant in financing th construction of Grammar fhool Bhilding, a copy of which offer reads as follows:

Washington, D.C.

Dated: Apr. 27, 1938

Docket No. Miss. 1219-DS.

City of Oxford, Oxford, Lafayette County, Mississippi. 1 1. Subject to t'e Terms and Conditions (PWA Form No. 230) which are made a part hereof, the United States of America. hereby offers to aid in financing the construction of additions to and alteration of an existing school building, including necessary equipment ttherefor (herein called the "Project"), by making a grant yo yhe City of Oxford, Lafayette County, Mississippi,(herein called the "Applicant") in the amount of 45 per cent of the cost of the Project upon completion, as determined by the Federal Emergency Administrator of Public Works, but not to exeeed, in any event, the sum of $10,636, and by purchasing at the principal amount thereof plus accrued interest thereon, from the Applicant, obligations of the description set forth below (or such other description as shall be mutually satisfactory) in the aggregate principal amount of $13,000:

(a) Obligator: City of Oxfo-d:

(b) Type: Negotiable, general bbligation, serial, coupon bond:

(e) Interest rate and interest payment dates: 4 per cent per annum, payable Am semi-annually on June 1 and December 1 in each year;

(f) Place of Payment: At the office of the City Treasurer of the City of Oxford, Oxford, Lafayette County, Mississippi;

(g) Maturities: Payable on June 1 in the amounts and years as follows:

$500 in 1939 to 1942, inclusive, end 1,000 in 1943 to 1953, inclusive;

(h) Payable as to both principal and interest from ad valorem taxes which may be levied without limit as to rate of amount upon all the taxable property within the territorial okmits of the Applicant.

2. By acceptance of this Offer the Applicant covenants to begin work on the Project as early as possible but in no event later than 10 weeks from the date of this Offer and to complete such Project with all practicable dispatch, and in any event within 3 months fr - m the commencement of construction.

UNITED STATES OF AJERICA

Federal Emergency Administrator of Public Works

By (Sgd.) H.A. Gray Assistant Administrator

be and the same is hereby in all respects accepted.

Section 2. That said City of Oxford, Mississippi, agrees to abide by all the terms and conditions relating to such loan and grant a copy of which terms and conditions were annexed to the Government's offer and made a part thereof. REGULAR MEETING JULY 5, 1938

SECTION 3. That the City Clerk be and he is hereby authorized and directed forthwith to send to the Federal Emergency Administration of Public Works three certified copies of this Resolution and three certified copies of the proceedin bs of this meeting in connection with the adoption of this Resolution, and such further documents or proofs in connection with the acceptance of said offer as may be requested by the Federal Emergency Administration of Public Works.

The above resolution was seconded by Alderman C.H. Roach and was adopted, with the following voting aye: Alderman C.H. Roach, Alderman Branham Hume and Alderman T.E. Avent. and the following voting nay: None

The Mayor R.X. Williams thereupon declared said Resolution carried and the Mayor R.X. Williams thereupon signed said Resolution in approval thereof. * * * * * * * * * * * * * * * * * * * * * *

RESOLUTION NO.

A RESOLUTION ACCEPTING THE OFFER OF THE UNITED STATES TO THE CITY OF OXFORD, MISSI7SIPPI, TO AID BY WAY OF LOAN AND G4 -ANT IN FIN:TCING TE CONSTRUCTION OF A MUNICIPAL BUILDING.

Be it resolved by the Mayor and Board of Aldermen:

Section 1. That the offer of the United Statds of America to the City of Oxford, Missisippi, to aid by way of loan and grant in financing the construction of a Municipal Building, a copy of which offer reads as follows:

Washington, D.C.

Dated: June 24, 1938

Docket No. Miss. 1220-F

City of Oxford Oxford, Lafayette County, Mississippi.

1. Subject to the Terms and Conti#ions (PWA Form No. 230, as amended to the date of this Offer) which are made a part hereof, the United States of America hereby offers to aid in financing the construction of a city h411, including necessary equipment therefor (herein called the "PoOect"), by making a grant to the City of Oxford (herein called the "Applicant"), in the amount of 45 percent of the cost of the Project upon completion, as determined by the Federal Emergency Admihistrator of Public Works, but not to exceed, in any event, the sum of $13,909, and bu purchasing, at the principal amount thereof pluc accrued in- Yerest thereon, from the Applicant, obligations of the description set forth below (or such other description as shall be mutually satisfOtory) in the aggregate principal amount of $17,000:

(at Obligor: City of Oxford;

(b)Type: Negotiable, general bbligation, serial, coupon bond;

(e) Interes rate and interest payment dates: 4% per annum, payable semi-annually on February 1 and August 1 in each year:

(f) Place of payment; Both principal and interest payable at the office of the Treasurer of the City of Oxford, Oxford, Mississippi.

(g) Maturities: $1,000 on August 1 in each of the years from 1939 to 1955, inclusive:

(h) Payable as to both principal and interest from ad valorem taxes which REGULAR MEETING JULY 5, 1938

may be levied without limit as to rate or amount upon all tamable property within the territorial limits of the City of Oxford.

2. By acceptance of this Offer the Applicant covenants to begin work on the Project as early as possible but in no event later than 9 weeks from the date of this offer and to complete such Project with all pradticable dispatch and in any event within 5 months from the commencement of construction.

UNITED STATES OF AMERICA

Federal Emergency Administrator of Public Works

By (sgd.) H.A. Gray Assistant Administrator be and the same is hereby in all respects accepted.

Section 2. That said City of Oxford, Mississippi, agrees to abide by all the terms and conditons relating to such loan and grant a copy of which terms and conditions were annexed to the eovernment•s offer and made a part thereof.

Section 3. That the City Clerk be and he is hereby authorized and directed forthwith to send to the Federal Emergency Administration of Public Works three certified copies of this Resolution and three certifi d copies of the proceedings of this meeting in connection with the adoption of this Resolution, and such further documents or proofs in connection with the acceptance of said offer as may be requested b the Federal Emergency Administration of Public Works.

The above resolution was seconded by Alderman Branham Hume and was adopted, with the following voting aye: Alderman C.H. Roach, Alderman Branham Hume and Alderman T.E. Avent, and the following voting nay: None.

The Mayor R.X. Williams, thereupon declared said Resolution carried and the Mayor R.X. Williams thereupon signed seid Resolution in approval thereof. * * * * * * h * * * * * * * * * * * * * * *

Upon motion duly made by Alderman Avent and seconded by Alderman Hume, City Attorney C. A . Bratton, - was direct , d to write a letter to Mr. T.B. Brown, Mr. T.W.T. Falkner and Rev. F.M. Purser, asking that the use of open sewer and open surface closets be discontinued and that connection be made with the City sewer System. * * * * * * * * * * * * * * * * * *

Upon mtion duly made by Alderman Roach and seconded by Alderman Hume, City Attorney C.A. Bretton was directed to write a letter to Dr. EIS. Bramlett - relative to his barking dogs asking that he correct this noise as soon as possible. * * * * * * * * * * * * * * * * * *

Upon motion duly made and se Jeded, it was ordered that this Board do now recess until Friday, July 8th, 1938, at 730 L.rq.

RECESSED MEETING JULY 8, 1938, FIRDAY

The Board met pursuant to the above and foregoing recess order of July, 5, 1938, at 7:30 P.M., when and where were present the following members:

IR114 Williams, Mayor Presiding

Branham Hume, Alderman-at-large

W.T. Chandler, Alderman Ward 2

C.H. Roach, Alderman, Ward 4 * * * * * * * * * * * * * * * * * * * * * * * **

H.A. Moore, Deputy Clerk

* * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was orderd that this Board do now adjourn sine die. • W.T. Chandler

By 04e1( 1-31-14 1 34 SPEC IAL MEETING

JULY 15, 1938 * *

NOTICE OF SPECIAL 1,[iTING

To the Members of the Board of AlBermen of the City of Oxford, Mississippi.

Notice is hereby given that a Special Meeting of the toard of Mayor and. Aldermen of the City of Oxford,Mississippi, will be held in the City of Oxford, at the City Hall at 7:30 o'cicok P. M., on the 15th day of July, 1938, for the purpose of considering, approving or rejecting the Budget for the 1938-1939 Term of the City Schools of the City of Oxford,Mississippi ; also for the purpose of considering the plans and specifications and the purchase and selection of a site for the location of the City Hall of said City; also, discussion and advisability of the City taking over and using or operating the machinery in compliance with Chapter 200, Laws of Mississippi, 1938, and all rules and regulations therein prescribed. Dated this the 15th day of July, 1938.

R. X. WITLIAES, Mayor, City of Oxford,Miss.,

CONSENT TO MEETING

We, the undersigned members of the Board of Aldermen of the City of Oxford,Mississippi, hereby accept service of the abo7 end foregoing notice, waving any and all irregularities in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and place therein named, amixtzxxtkzximpomme tioszzixxximmix and for the purpose therein stated. Witness our signatures on this the 15th day of July, 1938. C. H. Roach. Branham Hume W. L. Kennon. W. T. Chandler.

* * *

Oxford, Mississippi July 15, 1938 7:30 P. M.

The Board met persyaat to the above "Notice oe Special Meeting" when and where were present the following members : R. X. Williams, Mayor, Presiding ilderman, Branham Hume, City at Large. T. E. ,ivent, Ward One 2 W. T. Chandler, Ward Tao tt W. L. Kennon, Ward Three C. Roach Ward Four.

H.A.Moore, Deputy Clerk * * * *

After the meeting ha been opened according to law the following business was transacted to-wit : ftermAmill,

Upon motion „duly mt,.de econded it Was orderd that the City School Budget for the 1938-1939 term, as presented by the Board of Trustees, be and the same is hereby approved and ordered filed. * Came on for considoration the matter of selecting site and erecting City Hall, under P.W.A. program, the Board having heretofore accepted the grant end. loan proposal of the United States. After discussion pro and con upon motion duly made by Aldermen ?l ame and seconded by Alderman Roach it was ordered that the said building be erected on the south west corner of the City School lot e Jackson avenue. The building to be twe stories and archit.ot Cania.re, of Jackson, was. ins tructed to dr aw plans accordingly and submit same to the Board Tuesday, July 19, 1938, 7:30 o'clock p. m. CONTINUATION OF SPECIAL MEETING July 15, 1938. * * *

The metter of"taking over and operating the machinery in compliance with Chapter 200, Laws of Mississippi, 1938, and all rules and regulations therein prescribed", was, upon request of petrillman Lee, continued until some future date.

Upon motion duly made and seconded it was ordered that this Board do now recess until 7:30 o'clock P.M., Tuesday July 19, 1938 36

OXFORD, MISSISSIPPI JULY 19, 1938 7:30 P. M.

The Board met persuant to the foregoing Recess Order of July 15, 1938, when and where were present the following members :

Branham Hume, Mayor Pro Tempore, Presiding T. E. Avent, Ward One. W. T. Chandler, Ward Two. W. L. Kennon, Ward Three. C. H. Roach, Ward Four.

* * * H. A. Moore, Deputy Clerk

After the meeting had been oppned according to law, the following business was transacted, to-wit :

The Mayor, R. X. Williams, being absent on account of sickness and unable to attend this meeting, the Board decided to continue all business until Friday, July 22, 1938, at 7:30 P. M.

* * *

•

Upon motion duly made and seconded it was ordered that this Board do now recess until 7:30 o'clock P. M., July 22, 1938 3T

OXFORD, MISSISSIPPI JULY 22, 1938 7:3g P.M.

The Board met pursuant to the foregoing recess order of July 19th, 1930, when and where were present the following members:

Branham Hume, Mayor Pro Tempore, Presiding T. E. Avent, Ward One W. T. Chandler, Ward Two C. H. Roach, Ward Four.

* * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk * * * * * * * * * * * * * * * * * *

After the meeting had been opened according to law, the following business was transacted, to-wit:

A RESOLUTION ADOPTING A MINIMUM WAGE SCALE FOR WPA PROJECT - Bxford Municipal Building.

Whereas, it appears that under the rules and regulations of the Federal Idargency Administration of Public Works that a minimum wage scale be. adopted; and,

Whereas, the Federal Emergency Administration of Public Works has approved a project, designated as the Oxford Municipal Building for the City of Oxford, Mississippi, Docket No. Miss 1220-F, and,

5.herefore, be it resolved by the Board of Mayor and Aldermen that the same minimum wage scale be, and the same is hereby adopted for the Oxford Municipal Building fo said City of Oxford, Lafayette County, Mississippi, to-wit: PREDETERMINED MINIMUM WAGE SCALE

OCCUPATION HOURLY OCCUPATION HOURLY RATE RATE

Carpenter . 50 Concrete rubber .30 Electrician • 5 Reinforcing rodmen •i5 Concrete Finisher .65 Sheet metal Worker • 5 Marble and Tile Roofer .65 Setters .75 Truck Driver (li ton & Under) .25 Terrozzo Finisher .60 Truck Driver Plumber .75 (Ocer li Ton) .30 Welder Team Driver .25 Brick Layer Handy Man .25 Pipe layer-water .40 (Apprentices & Pipe layer-Sewer .40 helpers) Painter .65 (to all trades not Iron Worker .65 otherwise given .40 Plasterer .65 Mortar Mixer .35 Lather .65 Concrete Mixr. Opr. .35 Steam Fitter .75 Hoist Operator .50 (Continued)

38 (6ontinued) Special Meeting July 22, 1938 Oxford, Miss.

OCCUPATION HOURLY OCCUPATION HOURLY RATE RATE

Tractor .50 Glazier .50. Dump men .25 All common labor .20 gialuker .65 Floor Finisher .6o

It is, therefore, ordered by the Board of Mayor and Aldermen that said wage scale be, and is hereby adopted, and it is ordered that four copies of the same be made. Ordered in Special session of the Board of Mayor and Aldermen on this tthe 22nd day of July, 1938

H.A. Moore, Dpputy R.X. Williams, Clerk of the Zity of Oxford Mayor of the City of Oxford

State of Mississippi Lafayette County This day personally appeared before me H.A. Moore, Deputy Clerk at the City of Oxford and R.X. Williams, Mayor of the City of Oxford, who acknowledge that they signed the forego:_ng instrument for the purposes and on the date therein stated.

Witness my signature this the 22nd day of July, 1938.

R.X. Williams, Mayor City of Uxford, Miss.

My Commission expires January 1st, 1939. * * * * * * * * * * * * * * * * * * * * * ** *

Upon Motion duly made and seconded it was ordered that this Baprd do now =adjourn stria die.

Clerk Mayor OXFORD, MISSISSIPPI MY 26, 1938

SPECIAL MEETING

NOTICE OF SPECIAL MEETING.

To the Members of the Board of Aldermen of the City of Oxford, Mississppi.

Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, at the City Hall at 7:30 o'clock P.M., on the 26th day of July, 1938, for the purpose of adopting a resolution extending the time for the beginning of the workm on PWA Project, Grammar School Building, Oxford, Mississippi. DOcket No. Miss. 1219-DS; also, a reolution adopting a minimum wage scale for PWA Project, Oxford, Misssissipii, Grammar School Building. Docket No. Miss. 1219-DS.

Dated this July 26th, 1938.

R.X. Williams, Mayor, krD City of Oxford, Miss. C/ L.:at To the Marshal of the City of Oxford, Mississippi.

You are hereby commanded to execute the within process on the members of the Board of Aldermen, to-wit: Brankam Hume, W.T. Chandler, C.H. Roech, T.E. Avent and W.L. Kennon, and make your return thereon not later than 2:00 o'clock P.M., July 26, 1938.

R.X. Williams, Mayor, City Of Oxford, Miss.

City of Oxford, County of Lafayette, State of Mississippi.

I have this day executed the within process more than 3 hours prior to the meeting personally by delivering to T.E. Avent, C.H. "oach, W.L. Kennon, and W.T. Chandler, Aldermen of the City of Oxford, Mississippi, a true copy of this call. Alderman Branham Hume pouid not be found after diligent search and inquiry.

Witness my signature this the 26th day of July , 1938, at 2 o'clock P.M.

V.C. Jones, City Marshal Those present were R.X. Williams, Mayor, T.E. Avent, W.T. Chandler, W.L. Kennon and C.H.Roach After the meeting had been opened according to law, the following inessbus was transacted, to-wit:

A RESOLUTION EXTENDING THE TIME FOR THE BEGINNINU OF THE WORK ON FWA PROJECT GRAMMAR SCHOOL BUILDING? OXFORD, MISSISSIPPI, DOCKET MISS. 1219-DS

Whereas, it appears that the City of Oxford made application to the Public (- , works Administration authorities for a grant for the construction of an addition and equipping the same for the Grammar School Building in the City of Oxford, Lafayette County, Mississippi; and, _ "'Li- Whereas, it appears that said Project was approved and a grant was made, and that in said application the time specified in the accepted offer of the Govern- ment, the work was to begin on July 5, 1938; and,

4 Whereas, it appears that on account of certain necessary changes in the plans, and delays in getting legal proceedings in proper form, the work has not been started,'"nor advertisement for bids published; and,

' Whereas, it further appears that three months time for the completion of the job, after the starting of the same, will not be enough; therefore,

Be it resolved by the Board of Mayor and Aldermen that an extention of time bo September 15, 1938 for the starting of work is hereby requested of the 40 OXFORD, MISSISSIPPI JULY 26, 1938

Federal Emergency Administration of Public Works, and also an extention of time for the completion of said work from three, to four months is also hereby requested.

The above resolution was thid day offered and adopted by the Board of Mayor and Aldermen in special session convened on this the 2b day of July, 1938.

* * * * * * * * * * * * * * * * * * * * * *

AN ORDINANCE FIXING AND DETERMINING THE MINIMUM WAGE RATES TO BE PAID EMPLOYEES ENGAGED IN WORK ON ADDITIONS TO AND ALTEMATIONS OF AN EXISTING SCHOOL BUILDING TO BE CONSTRUCT& ED FROM PROCEEDS OF AN OFFER OF THE UNITED STATES OF AMERICA.

Whereas, by a certain offer dated April 27, 1938, the United States of America proposes to aid in financing the construction of additions to and alterations of • Ian existing school building by making a grant to City of Oxford, Mississippi, in the maximum sum of $23,636.00; and,

Whereas, it is the desire of this Board to cause to be paid equal to not less than the prevailing minimum hourly wage rates for each trade and occupation engaged in such construction; and,

Whereas, after due investigation as to such wages prevailing for work of similar nature in the locality in which the a ditthons to and alterations of an existing school building are to be constructed, it has been found and determined that such wages are as hereinafter completely set out:

NOW, THEREFORE, BE IT ORDAINED BY THE BOARD OF MAYOR AND ALDIMEN OF THE CITY OF OXFORD, MISSISSIPPI; AS FOLLOWS:

Section 1. It is hereby found, fixed and determined that the prevailing minimum hourly wage rates for each trade and occupation in the locality in which additions to and alterations of an existing school building desckibed in the preamble hereof are to be constructed, are as follows for such listed grades and occupations:

PREDETERMINED MINIMUM WAGE SCALE

OCCUPATION HOURLY OCCUPATION HOURLY RATE RATE

Carpenter .65 Concrete Rubber .30 Electrician .65 Reinforcing Rodmen • 5 Concrete Finisher .75 Sheet Metal Worker .5 Marble and Tile Roofer .65 Setters •75 Truck Driver Terrozzo Finisher (lt Ton & Under .25 Plumber 1.10 Truck Driver Welder (Over 11 Ton) .30 Bricklayer . t50 Team Driver .25 Pipe Layer-Water .40 Floor Finisher .6o Pipe Layer-Sewer .4o (Apprentices & Painter (Helpers Iron Worker .65 (to all trades not Plasterer .65 (otherwise given) .40 Lather .65 Mortar Mixer .35 Steam Fitter 1.10 Concrete Mixr. Opr. .40 Tractor .5o Hoist Operator .5o Dump Men •25 Glazier .5o Caulker .65 All Common Plumber of Steam Labor .25 Fitter Helpers .45 Section 2. It is hereby ordered that the minimum hourly wage rates to be paid for the trades and occupations hereinaboe set out in connection with the construction of the additions and alterations of an existing school building hereinabove referred to shall be as herein fixed and determined, and tht the plans and specifications, and contract documents for such work shall specifically provide for such rates to be the minimum hourly wage rates to be paid employees engaged in such trades and occupations employed in connection with the construction of said additions and alterations of an existing school building. 41 JULY 26, 1938 OXFORD, MISSISSIPPI

This ordinance shall take effect from and after its adoption.

Ordered in special meeting on this the 26th day of July, 1938.

* * * * * * * >lc * * * * * * * *

A RESOLUTION APPROVING AND ADOPTING THE PLANS, SPECIFICATIONS AND CONTRACT DOCUMENTS FOR THE CONSTRUCTION OF ADDITIONS TO AND ALTERATIONS OF AN EXISTING SCHOOL BUILDING, PWA PROJECT, DOCKET MISS. 1219-DS, AND AUTHORIZING THE ADVERTISING FOR BIDS.

WHEREAS‘ detailed plans, specifications and contract documents for the construction of additions to and alterations of an existttg school building, PWA Project, Docket Miss. 1219-DS, have been present by James T. Canizareo; and,

WHEREAS, this Board of Aayor and Aldermen of the City of Oxford, has fully considered sttd plans, specifications and contract documents, and finds that it is for the best interest of the City of Oxford, Mississi pi, to construct the building and equipping the same, as therein provided.

(IN/ NOW, THEREFORE, BE IT RESOLVED BY THE BOARD OF MAYOR AND ALDERME N L-• OF THE CITY OF OXFORD, MISSISSIPPI, AS FOLLOWS;

Section 1: That the plans, specifications and contract documents referred to in the preamble hereof for the construction of said buklding and equipping the same, be and the same are hereby, in all respects, approbed and adopted as the official plans, specifications and contract documents to be used in connection with the prosecution of the work in such construction. That for the purpose of identification, there shall be indorsed on one set of such plans, specifications and contract documents by W.T. Chandler, Clerk, the following:

"Duly adopted by Resolution of Bor,rd of Mayor and Aldermen, on the 26th day of July, 1938.

W.T. Chandler, City Clerk By H.A. Moore, Deputy

Such set of plans, specifications and contract documents with the indorsement thereon, shall remain on file in his office.

SECTION 2: That legal. notice be given by the publication in a newspaper published in Oxford, County of Lafayette, that sealed bias for the construction of additions to and alteration of an existing school building, PWA Project, Docket Miss. 1219-DS, in accordance with said plans, specifications and contract documents, will be received by thsi Board, at Oxford, Mississippi, until 4:00 o'clock P.M., on the 19th day of August,.1938. Such notice shall be in the form of an advertisement for bids, filed in the office of the City Clerk, as a part of.the approved plans, specifications and contract documents. -

The above reedlution was this day offered and adopted by the Board of Mayor and Aldermen in special session convened on this the 26th dity of July, 1938. * * * * * * * )I‘ * * * * * * * * * * * * *

Upon motion dyly made and seconde, it was ordered that this Board do now adjourn•sine die.

Mayor, City of Oxford, Miss. 42

REGULAR MEETING AUGUST 2, 1938

TUESDAY * * * * *

* * *

* * * *

* *

* * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session at the Mayor's office at 7:30 P.M., Tuesday, August, 2, 1938, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor R.X. Williams Presiding

Alderman T.E. Avent, Ward One

Alderman W.T. Chandler, Ward Tao

Alderman W.L. Kennon, Ward Three

Alderman C.E. Roach, Ward Four

* * * * * * * * * * * *

H.A. Moore, Deputy Clerk C.A. Bratton, City Attorney V.C. Jones, City Marshal

After the meeting had been opened according to law, the following business was transacted:

Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants be issued accordingly. From the

CORPORATION FUND

935. R.X. Williams, Mayor July salary 936. Branham Hume, Alderman et " f°)°0:(0° 937. T.E. Avent, n n " 938. W.T. Chandler, " " " $10.00 939•W•L. Kennon, " " " $10.00 940. C.H. Roach " 9 " $10.00 941.H.A. Moore, 9 " $50.00 942. V.C. Jones, Marshal, n n 5125.00 943. Sam Keel, Night watchman, July salary $100.00

944. R.N. Whitfield, Bandmaster, " " $40.00 945. C.4.. Bratton, Attorney " " $40.00 946. C.A. Bratton, Fee in Buie Case, $100.00 947. Mrs. O.E. Holcomb, Matron July salary $20.00 948.Lillian Jones, Secretary for July- $40.00 949. o.h. Douglass, Upkeep of cemett.ry for July $50.00 950. H.A. Moore, T.C., Telephone, Community House fund, etc-$321.92 951. Tom L. Ketchings, Supplies $14.41 952. N.O. Nelson Company " $24.07 953. Det4x Watchclock Corp., Supplies- $2.86 954. L.R. Cole, hauling sand $7.50 955. Blue Print Company, Supplies $2.85 956. Ketffel & Esser Company, Supplies $21.77 957. Graham Paper Company, Supplies $14.15 958. J.E. Neilson Company, " $13.02 959. henry J. Lovelady, Truck hire, etc $72.00 960. Walter D. Pettis, Surveying for July $131.90 961. Sinclair Refining Company, Gas $12.75 962. Belk Garage, Rep. to truck 401.00 963. L.G. Lynch, Gas for WPA truck $13.01 964. Hall B1-cksmith, Rep. to saw, etc $1.65 965. L.G. Lynch,Motor Company, Gas & oil $3.00 (CONTINUED) 43 REGULAR MEETING TUESDAY, AUG. 2, 1938 OXFORD,MISS

CORPORATION FUND Continued)

966. Hughes hardware Company, Supplies $16 .34 967. J.D. Herndon, Supplies $1.38 968, Patton Courtney Hardware Co., Supplies $4. 18 969. Elliott amber Company, Su plies $31.10 970. C.E. Slough, Recording deeds $15.85 Total $1421.71

STREET FUNDA

971. S.E. Spears, Foreman, July salary $100.00 972. H.A. Moore, T.C., Labor tickets, etc $365.28 973. W.T. Jones, Keeping city prisoners 437.75 974. Hughes hardware Company, Supplies $5.20 975, Oxford Hospital, Treatment for J. Barringer $40.00 976. Earl Freeman, 12 days work-- - $43.00 977.0.D. Livingston, 20 days work $73.33 978. Hudson Walker, 10 days work .25.0o 979. John Cooper, 15 days work $57.50 980. S.D. Carson, 15 days work $52.50 981. L.G. Lynch, Gas 41.98 982. ElliottLumber Company, Supplies $2.04 983. hall Blacksmith, Rep. to shovel, etc $2.10 984. Davis-Mize, Supplies $2.25 985. C.G. Huggins, Rep. to truck $62.19 986. Belk Garage, Fire,truck upkeep, etc 440.50 987. Patton-Courtney, Supplies #3.93 Total $96,4.55 SCHOOL FUND

988., G.S. Byers, Janitor for July $60.00 989. 0.D. Smith, Pro rata share of July salary $16.87 990. H.A. Moore, T.C., Telephone $6.00 991. W.W. Brummett, Coal $20.90 992. Illinois Central Railroad, Freight on coal $127.49 993, Oswalt Furniture Company, Rep. to mower 41.50 994. Bureau of Publication, Supplies .27 995. Kirkpatrick Coal Company, Coal ----$70.54 996. hducational Test Bureau, Supplies $2.53 997. Oxford Eagle, Supplies $6.00 998. Patton-Courney, ." - $1. 999. Slade & Crouch, Rep. on school building $2. 5 1000. Britimnica Junior, Supplies $68.68 1. Porter Hardware Company, Supplies $8.47 2. Joe Irby, Kindling $3.00 3. J.E. Neilson Company, Supplies $22.50 4. .T.1-i. Martin, Jr., Supplies-- $74.9 Total $494.00

L 44 REGULAR MFETETG AUGUST 2, 1938 TUESDAY

LIGHT AND WATER FUND

5. C.E. Harrison, Supt., July salary $245.00 6. G.vi. Johnson, Engineer, July salary $125.00 7. A.L. Mullins, 9 n n $115.00 8. Louis Campbell, " ft If $105.00 9. Howard Winter, Lineman " " $105.00 10. H.,A. Moore, " " $50.00 11. Lillian Jones, Secretary-7-July salary $40.00 12. T.A. Dunn, Rent for July--- $50.00 13. Mrs. H.F. Wilkins, Rent for July-- 415.00 14. Mrs. Lillie Yates, " n 9 010.00 15. H.A. Moore, T.C., Labor tickets, etc $694.44 16. Texaco Service Station, Grease $2.00 17.Oxford Service Station, Grease .75, 18. Texas Company, Ursa Oil $52.50 19. L.G. Lynch, Gas 437.75 20. Belk Garage, Re). to truck $2.05 21. De La Vergne Engine Co., Supplies - $189.00 22. Cabell Electric Company, Supplies $74.67 23. Davis Mize Co., Supplies '44-0 24. Detex Watchclock Corp., Supplies 41.65 25. Sargamo Electric Company, " $9.82 26. Georgia Paper Stock Company, Supplies $22.66 27. Brown Electric Company, Supplies $98.00 28. Miss. Foundry & Machine Company, Suppli e s *24.06 29. Cooper Petroleum Company, Supplies $252.80 30.Westinghouse, Supplies $66.99 31. American Locomotive Company, Supplies $157.00 32. Duncan Electric Company, Su2plies $113.57 33. I.E. Dilwoth Company, Supplies $42.04 34. Standard Oil Company, Gas $2.80 35. Arkansas FuellOil Company, Fuel Oil $383.05 36. Riechman-Crosby Company, Supplies $ 0.23 . Hughes hardware Company, Supplies $5.43 . Elliott Lumber Company, Supplies- $445 Total $3152.29

BOND FUND

39. H.A. Moore, T.C., Commission to Chase Nat. Bank $7.10 40. G. Garland Lyell, Validation of $27,500 bonds $27.50 41. First National Bank, Bond proceedings Total 3.35 * F * * * * * * * * * * * * * * * * * * * *

Came on for consideration the petition of Phil Stone, et al, concerning the operation of "The Pelican" a negro amusement hall. Upon motion duly made by Alderman Kennon and seconded by Alderman Avent, the following actions was taken by the Board: 2 In vies of signed representati made in a petition to this Board by Phil Stone and 44 other citizens and tac payers of Oxford concerning the operation and conduct of the negro entertainment hall known as "The Pelican" this Board wishes to express its official disapproval of the conduct as represented in said petition. This Board further wishes to state that the proper recourse for the aboe mentioned petitioners is in a court of law and not before the City Board. * * * 401‘ * * * * * * * * * * * * 45

OXFORD, MISSISSIPPI 411191ST 2, 1938 REGULAR MEETING

A RESOLUTION CHANGING THE TIME FOR THE BEGINING OF THE WORK ON PWA PROJECT MISSISSIPPI 1219-DS GRA:LIA.R SCHOOL BUILDING, OXFORD, MISSISSIPPI.

Vereas, it appears that the City of Oxford madeapplication to the Public Work Admin- ietration suthorities for a gent and a loan for the construction of an addition and equipping the same for the Grammar School Building in the City of Oxford, Lafayette County, Miss., and;

hereas, it appears that said Project was approved and a grant and loan was made, and that in said application the time specifired in the accepted offer of the Government, the work wos to begin on July 5, 1938, and:

Whereas, it appears that on account of certain necessary changes in the plans, and delays in getting legal proceedings in proper form the work has not been started, as advertising for bids and contracts was begun in the Lafayette County paper, the Oxford Eagle, in its July 25, 1938, issue, and it being necessary to have four publications under the Mississippi Law, it will not have the legal and proper advertisement until August 18, 1938, issue; and

Whereas, it further appears that the Mayor and Board of Aldermen of the City of Oxford, Mississippi, under the aforesaid advertisements can receive bids and award contracts on August 19. 1938, subject to the approval of the PWA authorities, and work can be started within ten days from the approval of the contracts by the Public Works Administration;

Be it resolved by the Mayor and Board of Aldermen that the extension of time to August 29, 1938, for the starting of work is hereby requested of the Federal Emergency Administration of Public Works, and also and extension fo time for the completion of said work to November 15, 1938, is also hereby requested.

It t$ further ordered that all orders or resolutions in conflict with this order be and the same are hereby repealed cancelled and held for naught.

The above resolution was this day offered and adopted by the Mayor and Board of Aldermen in regular session convened on this the 2nd day of August, 1938. * * * * * * * * * * * * * * * * * * Came on for consideration the location of offices and families for the Southern Forest Experiment Station, acting for the U.S. Department of Agriculture.

Motion was made and seconded that the City pay $20.0 per month for office rent and furnish free of charge for said offices, lights and water, motion carried and unanimously adopted. * * * * * * * * * * * * * * * * * * * * * * * * *

Request was made by the Mississippi Advertising Commission for $25.00 to be used for the advertising of the City of Oxford in the State-Wide Air Tour to visit Oxford on August 25, 1938, at 10:25 A.M. After due consideration and discussion as to the promotion of The Oxford Airport and The City as a whole, motion was made, seconded and passed unanimously to approve the above expenditure. * * * * * * * * * * * * * * * * * * * * * *

Came on for consideration the construction, operation, and location of a Cold Storage Plant in the City of Oxford withlthetithd and assistance of the Public Works Administration. Motion was made and seconded that the city permit the Cold Storage Plant to be located on the city lot east of and adjacent to the present City Hall on the South-east corner of the square, provided same could be constructed on a self liquidating plan through the PWA without cost or the issuing of bonds by the city. The Mayor was instructed to submit the project under these conditons, after due consideration motion was passed unanimously. * * * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that the Board do now recess until 7130 P.M. on Thursday, August 4, 1938.

RECESS MEETING. OXFORD,MISSISSIPPI

AUGUST 4, 1938

7:30 P. M.

The Board met persuant to the foregoing Recess Order of August 2, 1938, when and where were present the following Members :

R. X. Williams, Mayor, Presiding • W. L. Kennon, laddrman Ward Three

T. E. Avent, Ward tta. 07u2..

C. H. Roach Ward Fott

H. A. Moore, Deputy Clerk

Upon motion duly made and seconded it was ordered that Warrant No.13, payable to Mrs. H.F. Wilkins, for the sum of 415.00, drawn oh the Light & Water Fund, be cancelled and the same is hereby void.

* * * * fi * * * * x *

Upon motion duly made and seconded it..was ordered that this Baord do now adjourn sine die.

W. T. Chandler, Clerk By ..61_271661:14PePutY 47 SPECIAL MEETING

AUGUST 10, 1938

NOTICE OF SPECIAL MEETING

TO THE MEMB_RS OF THE BOARD CF ALDEMIEN OF THE CITY OF OXFORD, MISS.

Notice is hereby given that a Special Meeting of ghe Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, at the city hall at 4:00 P.M., on the 10th day of August, 1938, for the purpose of executing and filing an application on behalf of the City of Oxford, Miss., to the United States of America for a loan and grant to aid in financing the construction of a cold storage plant at Oxford, Lafayette County, Miss.

Dated this the 10th day of August, 1938

R.X. Williams, Mayor, City of Oxford, Miss.

CONSENT TO MEETING

We, the undersigned members of the Board of Aldermen of the city of Oxford, Mississippi, hereby accept the service of the above and foregoing notice, waving any and all irregularities in such service and such notice, and consent and agree that seid Board of Aldermen shall meet at the time and place therein named and for the purpose therein stated. 7 Witness our signatures on this the 10th day of Au ust, 1938. W.L. Kennon Branham Hume C.H. Roach W.T. Chandler T.E. Avent * * * * * * * * * * * * * * *

The Board met pursuant to the foregoing call of the Special Meeting of August 10, 1938, when and where were present the following members:

R.X. Williams, Mayor, Presiding

T.E. Avent, Alderman, Ward One W.T. Chandler, , Ward Two W.L. Kennon, Ward Three C.H. Roach, Alderman Ward Four Branham Hume, Alderman at large * * * * * * * * * * * * * * * * * H.A. Moore, Deputy City Clerk C.A. Bretton, City Attorney V.C. Jones, City Marshal

After the meeting had been opened according to law the following business was had to-wit:

APPLICATICN RESOLUTION

RESOLUTION NO. 20

A RESOLUTION AUTHORISING THE CITY OF OXFORD, MISSISSIPPI, TO FILE AN APPLICATION TO THE UNITED STATES OF AMERICA THROUGH THE FEDERAL EMERGENCY AD- MINISTRATION OF PUBLIC JORKS FOR A LOAN AND GRANT TO AID IN FINANCING THE CONSTRUCTION OF COLD STORAGE PLANT k D DESIGNATING R.X. WILLIAMS, MAYOR, W.T. CHANDLER, CLERK, TC FURNISH SUCH INFORMATION AS THE GOVERNMENT MAY RE- 4,UEST. Be it resol-ed by the Aayor and Board of Aldermen of the City of Oxford, Mississippi;

SECTION 1. That Mayor and clerk be and they are authorized to exegute and file an application on behalf of the City of Oxford, Mississippi, ikg the United States of America for a loan and grant to aid in financing the construction SPECIAL MEETING, AUGUST 10, 1938 of Cold Storage Plant.

SECTION 2. 'Ihat R.X. titiil liams, Mayor and W.T. Chandler, Clerk, be and they are hereby authorized and directed to furnish such information as the United States of America through the Federal Emergency Administration of Public iqprks may reasonably request in connection with the application which is herein authorized to be filed. * * * * * * * * *

Upon motion duly made and seconde, it was ordered that the Board do now adjourn sine die.

W.T. Chandler, Clerk 1_112.421/44444.4., 6_ Mayor

SPECIAL MEETING OXFORD, MISSISSIPPI AUGUST 19, 1938

NOTICE OF SPECIAL MEETING

TO THE 'EMBERS OF THE BOARD OF ALDERMEN OF TEE CITY OF OXFORD, MISSISSIPPI

Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford at the City Hall at 4:00 o'clock P.M., on the 19th day of August, 1938, for the purpose of opening bids submitted by contractors in accordance with the notice given on July 28, 1938, for the construction of an addition to the present Grammar School Building, including plumbing, heating and wiring, at Oxford, Mississippi, the same being PWA Project Docket Miss. 1219-DS; also, to pass resolutions accpeting and approving the plans for the City Hall at Oxford, Mississippi, Miss. Docket 1220; also, resolutions accepting and approving the plans for the construction of a colored school building, being PWA Project Miss. Docket 1P15-L; also, for the purpose of adopting a resolution employing architects and engineers for the filing of PWA Project for the construction of a Cold Storage Plant in the City of Oxford, Lafayette County, Mississippi, also, for the adopting of a resolution for the emplouing arhhitects and engineers for the filing of PWA Project for an addition to the Municipal Light Plant; also, for the purpose of making an amendment to the wage scale whereby common labor is raised from 1J" 350 per hour to 30¢ per hour; also, for the purpose of adopting a resolution declaring the intention of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, Tq to issue and sell $17,000.00 of bonds of said city for the purpose of constructing and equiping a City Hall; also, for the purpose of adopting a resolution declaring .c the intention of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, to issue and sell *13,000.00 of bonds of said city for the purpose of constructing and equipping an addition to the Grammar School Building in the city of Oxford, Mississippi; also, for the purpose of adopting a resolution declaring the intention of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, to issue and sell $19,000.00 of bonds of said city for the purpose of constructing and equipping a school building in the City of Oxford, Mississippi.

Dated this the 19th day of August, 1938.

R.X. Williams, Mayor

CONSENT TO MEETING.

We, the undersigned members of the Board of Aldermen of the City of Oxford, Miassissippi, hereby accept service of the above and foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agr,e that said Board of Aldermen shall meet at the time and place therein named, and for the purposes therein stated.

Witness our signatures this the 19th day of August, 1938, forenoon.

LT. Chandler, W.L. Kennon C.H. Roach T.E. Avant Branham Hume * * * * * * * * * * * * * * * * * * * * *

The Board met pursuant to the foregoing call of the Special Meeting of August 19, 1938, when and where were present the following members:

R.X. Williams, Mayor Presiding

T.E. Avent, Alderman, Ward One WIT. Chandler, " , Ward Two W.L. Kennon, AlderMan Ward Three C.H. Roach, Alderman Ward Four * * * * * * * * * * * * * * * * * * C.A. Bretton, City Attorney H.A. Moore, Deputy City Clerk V.C. Jones, Marshal

After the meeting had been opened according to law the following business was had to-wit: SPECIAL MEETING AUGUST 19, 1938

A RESOLUTION DECLARING TiE INTENTION OF TEE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI, TO ISSUE AND SELL NINETEEN THOUSAND ($19,000.00) DOLLARS OF BONDS OF SAID CITY FOR TEE PURPOSE CF CONSTRUCTING AHD E,UIPPING A SCHOOL BUILDING.

BE IT RESOLVED by the Mayor and Board of Aldermen of the City of Oxford, Mississippi;

SECTION 1. That it appears unto this Board, and this Board finds, determines and adjudges as follows:

(a) That it has been fixed, determined, and found necessary that the City of Oxford, Mississippi, construct and equip a school building.

(b) That the cost of such improvements will be approximately Forty-Five thousand Four hundred and fifty-four ($45,454) dollars, a portion of whicl will be paid by a grant from the United States of America.

(c) That the remainder of such cost will exceed the current revenues of the City of Oxford which will be available for such purpose and will have to be financed by the issuance and sale of bonds in the sum of Nineteen thousand ($15,000) dollars.

(d) That there are nine hundred qualified electors residing in Said city and authorized to vote upon the question of the issuance fo bonds; and

(e) That the City of Oxford is a city of less than 12,000 inhabitants and proposed bond issue is for less than thirty thousand (y30,000) dollars; '

(f) That the issuance and sale of bonds of the City of Oxford in the sum of nineteen thousand ($19,000) dollars for the purpose of making such improvetents, when added to all other bonded indebtedness of said(n4 , including all bonds authorized but not sold. and delivered, will not cause such bof' ded indebtedness, exclusive of bonds or other evident of indebtedness issued for water and light purposes and/or for the construction Bf special improvements parimarily chargeable to the property benefitted and/or for the purpose of paying the municipality's proportion of any betterment program, a portion cf which is primarily chargeable to the property benefitted, to exveed ten percentum (10%) of assessed value of the taxable property located within the corporate limits of the City of oxford according to the last cojpleted assessment for taxation, nor will the issuance and sale of such bonds in the said sum of nineteen thousand ($19,000) dollars, when added to all of the outstanding indebtedness of said municipality, both bonded and floating, for all'purposes, includiAg all bonds authorized but not sold and delivered, cause such indebtedness to exceed twenty percentum (20%) of the assessed value of all taxable property within said municipality.

SECTION 2. That the Board declares its intention to issue the bonds of the City of Oxford in the maximum amount of nineteen thousand ($19,000) dollars for the purpose of constructing and equipping a school. building for the City of oxford.

SECTION 3. That the said bonds will be issued at a meeting of this Board to be held at the regular meeting place of said Board in said City of Oxford pn the Itth day of Spptember, 1938, at 7:30 P.M., without any election thereon unless on or before that date twenty percentum (20%) of the qualified electors of the City of Oxford file a written protest against the issuance of said bonds, in whiCh event an election will be called and held as required by law.

SECTION 4. That the clerk of the City of Oxford is hereby directed to give not less than three (3) weeks notice of such intention by publishing this resolution in The Oxford Eagle, a newspaper of general circulation published in said City once a week for three weeks preceding said Special Meeting of September l 1938.

The above resolution was this day offered and adopted by the Mayor and Board of Aldermen in Special session convened on this the 19th day of August, 1938. * * * * * * * * * * * * * * SPECIAL MEETING, AUGUST 19, 1938

A RESOLUTION DECLARING THE INTENTION OF THE MAYOR AND BOARD OF ALDERMAN OF THE CITY OF OXFORD, MISSISSIPPI, TO ISSUE AND SELL THIRTEEN THOUS ND ($13,000) DOLLARS OF BONDS OF SAID CITY FOR TEE PURPOSE OF CONSTRUCTING AND EWIPPING A SCHOOL BUILDING.

BE IT RESOLVED by the Mayor and Board of aldermen of the City of Oxford, . Mississippi;

SECTION 1. That it appears unto this Board, and this Board finds, determines and adjudges as follows:

(a) That it has been fixed, determined, and found necessary that the City of Oxford, Mississippi, construct and equip a school building. (b) That the cost of such improvements will be approximately twenty-three thousand six hundred and thirty six 423,636) Dollars, a portion of which will be paid by a grant from the United States of America. (c) That the remainder of such cost will exceed the current revenues of the City of Oxford which will be available for such purpose and will have to be financed by the issuance and sale of bonds in the sum of thirteen thousand 013,000) dollars. (d) That there are nine hundred euqlified electors residing insaid, city and authorized to vote upon the question of the issuance of bonds; and (e) that the City of Oxford is a city of less than 12,000 inhabitants and the proposed bond issue is for less than thirty thousand ($30,000) dollars; L7 (f) That the issuance and sale of bonds of the Zity of Oxford in the sum of thirteen thousand ($13,000) dollars for the purpose of making such Lmprovements, when added to all other bonded indebtedness of saic'! art , including all bonds authorized but not sold and .delivered, will not cause such borfded indebtedness, exclusive of bonds or other evidence of indebtedness issued for water and light purposes and/or for the construction of special improvements, primarily chargeable to the property benefitted and/or for the purpose of paying the municipality's proportion of any betterment program, a portion of which is primarily chargeable to the property benefitted, to exceed ten percentum (10%) of assessed value of the taxable property located within the corporate limits of the city of Oxford according to the lak completed assessment for taxation, nor will the issuance and sale of such bonds in the said sum of thirteen thousand ($13,000) dollars, when added to all of the outstanding indebtedness of said municipality, both bonded and floating, for all purposes, including all bonds authorised but not sold and delivered, cause such indebtedness to exceed twenty percentum (20%) of the assessed calue of all taxable property within said municipality.

SECTION 2. That the Board declares its intention to issue the bonds of the City of Nford_in the maximum amount of thirteen thousand ($13,000) dollars Cor the purpose of constructing and equipping a school building for the City of Oxford.

SECTION 3. That the said bonds will be issued at a meeting of this Board to be held at the regular meeting place of said Board in said City of Oxford on the Arth day of September; 1938,•at 7:30 o'clock P.M. without any election thereon unless on or before that date twenty percentum (20%) of the qualified electors of the City of "xford file a written protest against the is s uance of said bonds, in which event an election will be called and held as required b law.

SECTION 4. That the Clerk of the City of Oxford is herby direCted to giii@ not less than three (3) weeks' notice of such intention by publishing this resolution in the Oxford Eagle, a newspaper of general circulation published in said city once a week for three weeks preceding said September 14, 1938.

The above resolution was this day offered and adopted by the Mayor and Board of Aldermen in special session co:vened on this the 19th day of September, 1938. * * * * * * * * * * * * * * * * * * * * *

A RESOLUTION DECLARING TEE INTENTION OF TEE MAYOR AND BOARD CF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI, TO ISSUE AND SELL SEVENTEEN ($17,000) DOLLARS OF BONDS OF SAID CITY FOR THE PURPOSE CF CONSTRUCTING AND EQUIPPING A CITY HALL. 4

BE IT RESOLVED by the Mayor and Board of Aldermen of the City of Oxford, Mississippi„; SECTION 1. That it appears unto this Board, and this Board finds, deterMines and adjudges as fo!lows: (a) That it has been fixed, determined, and found necessary that the City of Oxford, Mississippi, construct and equip a City Hall. (b) That the cost of such improvements will be approximately Thirty thousand (30,000) dollars, a portion of which will be paid by a grant from the United States of America. 52 SPECIAL IZETING AUGUST 19, 1938 (c) That the remainder of such cost will exceed the current revenues ofthe city which will be available for such purpose and will have to be financed by the issuance and sale of bonds in the sum of Seventeen Thousand ($17,000) dollars. (d) That there are nine hundred qualified electors residing in said city and authorized to vote upon the question of the issuance of bonds; and (e) ''hat the Ciy of Oxford is a city of less than 12,000 inhabitants and the proposed bond isue is for less than thirty thousand ($30,000) Dollars; (f) That the issuance and sale of bonds of the City of Oxford in the sum of Seventeen thousand ($17,000) dollars for the purpose iiimaking such improvements, when added to all other bonded indebtedness of said including all bonds authorized but not sold and delivered, will not cause suj bonded indebtedness, exclusive of bonds or other evidence of indebtedness issued for water and light purposes and/or for the construction of special improvements primarily chargeable to the property benefitted and/or for the purpose of paying the municipality's proportion of any betterment program, a portion of which is primarily chargeable to the property benefitted, to exceed ten percentum (10%) of assessed value of the taxable property located within the corporate limits of the City of Oxford according to the last completed assessment for teyetion, nor will the issuance and sale of such bonds in the slid sum of Seventeen Thousand ($17,000) dollars, when added to all of the outstanding indebtedness of said municipality, both bonded and floating, for all purposes, including all bonds authorized but not sold and delivered, cause such indebtedness to exceed twenty percentum (20%) of the assessed value of all taxable property within said municipality.

SECTION 2. That the Board declares its intention to issue the bonds of the City of Oxford in the maximum amount of Seventeen Thousand ($17.000) dollars for the purpose of constructing and ecuipping a city hall for the City of Oxford.

SECTION 3. That the said bonds will be authorized at a meeting of this Board to be held at the regular meeting place of said Board in said City of Oxford on the lith day of September, 1938, at 7:30 o'clock P.M. without any election thereon unless on or before that date twenty percentum (20%) of the qualified electors of the City of Oxford file a writ':en protest gainast the issuance of said bonds, in which event an election will be called. and held as required by law.

SECTION 4. That the Clerk of the City of Oxford is hereby directed to give not less than three (3) wkkks' notice of such intention by publishing this resolution in the Oxford Eagle, a newspaper of general circulation published in said city once a week for three weeks preceding said September 4, 1938. The above resolution was this day offered and adopted be the •Mayor and Board or Aldermen in Special Session convened 8/19/3e , * * * * * * * *

A RESOLUTION ORDLRING THE FILING OF BIDS.

WEEREAS, pursuant to advertisement, bids for the construction of A d dition to the Oxford Elementary School, have been filed by the following bidders: Newton & Small, Hattiesburgh, Miss., Flint & Jordon, Jackson, Miss., H.M. Day & Son, Oxford, Mississippi, W.I. McGee, Jackson, Mississippi, and Walter L. Perry, Philadelphia, Mississippi. That said bids have been duly receibed, opened and publicly read;

NOW, THEREFORE, BE IT RESOLVED that the bids listed in the preamble hereof be filed and presented to Tames T. Canizato, Consulting Architect, and that the said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliest practicable moment, report to this Board of Mayor and Aldermen, his findings as to the lowest and best bid.

The above resolution was this passed and adopted. * * * * * * * * * * * *

RESOLUTION AWARDING CONTRACT

Whereas, James T. Canizaro, consulting Architect, pursuant to a Resolution heretofore adopted, has tabulated and considered all bids heretofore received for the construction of addition to Grammar School Building and has duly made his recommendations to this Board of Mayor and Aldermen, and it appearing from said recommendations and report that Newton & Schmall is the lowest and best bidder for the construction of addition to Grammar School Building, in the Silt of $21,191.00; and that this Board of Mayor and Aldermen, after considerin e, said report and recommendations and all bids heretofore, filed, finds that the bid of Newton & Schmall is the lowest and best bid;

NOW, THEREFORE, BE IT RESOLVED BY THE BOARD OF MAYOR AND ALDERMEN, AS FOLLOWS: SECTION 1; That the bid of Newton &Schmall, for the construction of an acdition to Grammar School Building, •in the sum of 421,191.00 is hereby accepted, determined and declared to be the lowest and best bid; and that a contract for the construction of said ' _eork, as heretofore prescribed by the plans, specifications and contract documents, shall be furthwith executed for said construction.

SPECIAL MEETING AUGUST 19, 1938

SECTION 2: That R.X. Williams, idayor and W1T. Chandler, City Clerk, are hereby authorized and directed to execute said contract for and on behalf of the City of Oxford, Mississippi.

SECTION 3. It appearing that the award for the construction of the work herein, in the sum of $21,191.00, is in excess of the funds available from the allotment of the United States of America in the sum of $850.00, and it further appearing that it is the desire of this Board, to construct the project as specified by said plans and specifications, it is further resolved that the City of Oxford, from its own funds and with the understanding that no additional allotment is to be received from the United States of America, shall pay such additional co st; and that in addition to the funds representing 55% of the construction cost; .whiCh-is,toYbe:deposited into the Construction Account, there shall also be deposited in such Construction Account the sum of $850.00.

SECTION 4. That the Treasurer of the City of Oxford, Mississippi, is hereby authorized and directed to deposit said additional sum of $850.00, into said Construct- ion Account, and said sum is herby specifically appropriated from the purpose of supple- menting the funds heretofore made available for the construction of the Project.

The above resolution was this day ordered and adopted by the Mayor and Board of Aldermen of the City of Oxford, Mississippi. * * * * kr.) * * * * * * * * * * * * * * * C\1 A RESOLUTION APPROVING AM ADOPTING THE PLANS SPECIFICATIONS AND CONTRACT DOCUMENTS FOR TEE CONSTRUCTION OF TEE NEGRO ELEMENTARY AM) HIGH SCHOOL BUILDING AT OXFORD, MISSISSIPPI, AND AUTHORIZING THE ADVERTISE:ENT FOR BIDS. e Whereas, detailed plans, specifications and contract documents for the construct-/ ion of the Negto Elementary and high Sc hool Building at Oxford, Mississippi, have been/ presented by James T. Canizaro, Architect; and,

Whereas, this Board of Mayor and Aldermen has fully considered said plans, and specifications and contract documents, and finds that it is fop the best interest of the City of Oxford to construct the Negro Elementary and High School Building als therein provided:

NOW, THEREFORE BE IT RESOLVED by the Mayor and Board of Aldermen as follows:

- SECTIONd, That the plans, specifications and contract documents referred to in the preamble hereof for the construction of the Negro Elementary & nigh School Building, city of Oxford; Mississippi, be, and the same are hereby, in all respects, approved and adopted as the official plans, specifications and contract documents to be used in connection with the prosecution of the work in such construction. That for the purpose of identification, there shall be indorsed on one set of sash plans, specifications and contract documents by W.T. Chandler, City Clerk, the following:

Duly adopted by Resolution of the Mayor and Board of Aldermen on the 19th day of August, 1938.

much set of plans; specifications and contract documents with the indorsement thereon, shall remain on file in his office.

SECTION 2. that legal notice by given by the publication in a newspaper published in Oxford, County of Lafayette, that sealed bids for the construction of the Negro Elementary & i'igh School Building'in accordance with said plans, specifications and c2ntract documents, will be receibed by IlLBoard at Oxford, Mississippi,

until ' day of , 1938. Such notice shall be o&clbck, P.M., on the j in the form of an advertisement for bids, filed in the office of the City Clerk, as a part of the approved plans, specifications and contract documents. * * * * * * * * * * * * * * * * *

A RESOLUTION APPROVING AND ADOPTING THE PLANS, 'PECIFICATIONS AND CONTRACT DOCUMENTS FOR THE CONSTRUCTION OF THE CITY HALL AT OXFORD MISSISSIPPI, AND AUTHORIZING THE ADVERTISEMENT FOR BI S.

Whereas, detailed plans, specifications and contract documents for the construction of the city hall at Oxford, Mississippi, have been presented by James T. Canizaro, Architect; and,

Whereas, this Board of Mayor and Aldermen has fully considered said plans, specifications and contract documents, and finds that it is for the best interest of the City of Oxford to construct the City Ball as therein provided. SPECIAL MEETING AUGUST 19, 1938

NOW, THEREFORE, BE IT RESOLVED by the Mayor and Board of Aldermen as follows:

SECTION 1: That the plans, specifications and contract documents referred to in the preamble hereof for the construction of the City Hall, City of Oxford, Mississippi, be, and the same are hereby, in all respects, approved and adopted as the official plans, specifications and contract documents to be used in connection with the prosecution of the work in such construction. That for the purpose of identification, there shall be indorsed on one set of such plans, specifications and contract documents by W.T. Chandler, City Clerk, the following:

The above resolution was adopted by the following vote: Those voting "Nay" W.T. Chandler,; those voting '''Yae"; C.H. Roach, T.E. Avent, Branham Hume and W.L. Kennon.

Such plans, specifications and contract documents with the indorsement thereon, shall reamin on file in his office.

SECTION 2. That legal notice be given by the publication in a newspaper published in Oxford, County of Lafayette, that sealed bids for the construction of the City Hall in accordance with said plans, specifications and contract documents, will be received by this Board at Oxford, Mississippi, until 3:00 o'clock P.M. on the 9th day of September, 1938. Such notice shall be in the form. of an advertisement for bids, filed in the office of the City Clerk, as a part of the approved plans, specifications and contract documents. * * * * * * * *

Whereas, at a Special Meeting of the Mayor and Board of Aldermen called and held on the 19th day of August, 1938, at 4:00P.M., a Resolution was adopted, authorizing the Mayor to execute and file an Application on behalf of the City of Oxford to the United States of America for a loan and grant to aid in financing the construction of a Cold Storage Plant in the City of Oxford and designating W.T. Chandler, City Clerk, and James T. Canizaro, Architect, who was duly employed by said Board to prepare plans and specifications to furnish such information as might be requested in connection with the application; and,

Imo, therefore, be it resolved by the Board of Mayor and Aldermen of the City of Oxford that when the said application plans and specifications shall have been completed, that the Honorable R.X. Williams, Mayor, be and is hereby ahthoriz- ed to make application to the United States of America through the PWA authorities for a loan and grant for the construction of said Cold Storage Plant. * * * * * * * * * * *

Whereas, at a special meeting of the Mayor and Board of Aldermen called and held on the 19th day of August, 1938, at 4:00 P.M., a Resolution was adopted, authorizing the Mayor to execute and file an application on behalf of the City of Oxgotd yo he United States of America for a loan and grant to aid in financing an addition to the Municipal Light Plant in the City of Oxford and designating W:T.eChanlerCity'Clerk, and W.A. Fuller Company, who was duly employed by said Board to prepare plans and specifications to furnish such information as might be requested in connection with the application; and

Now therefore, be it resolved by the Board of Mayor and Aldermen of the City of Oxford that when the said application, plans and specifications shall have been completed, that the Honorable Williams, Mayor be and is hereby authorized to make application to the United States of America through the PWh. authorities for a loan and grant for the construction of an addition to the Municipal Light Plant. * * * * * * * * * * 55.

SPECIAL MEETING AUGUST 19, 1938

Whereas, ti appears that the Boar of Mayor and Aldermen of the city of Oxford had heretofore, to-wit:, on the 26th day of ZUly, 1938, adopt a wage scale on PWA Project Miss. 1219-DS of 25V per hour for common labor; and

Whereas, it appears that the said city of Oxford has been heretofore notified that said wage scale should be changed from 25V per hour for common labor to 30V per hour for Common labor; now

Therefore, be it resolved by the Board of Mayor and Aldermen in Special Session convened that the wage scale on Common labor for Grammar School Building Project being No. Miss. 1219-DS, be and same is hereby changed from 25V per hour to 30V per hour for common labor. * * * * * * * * * * * * * # * *

Upon motion dyoy made and seconded, it was ordered that this Board do now recess until Wednesday, August 24, 1938 at 3:00 o.8(lock OXF ORD , ivITSS I SSI _PP I SEPTEE= 6, 1cj:38

TUESDAY

Be it remembered that tie 1:.- car of Mayor and Aldermen of th- City of Oxford iississippi, met in regula:- session at the 1 ,ayor's office at 7:0 2.1,1., Tuesday, August 6, 1538,, it being the time and lace for the holding of said meet in,?, when and where were present th , following members:

Mayor R. Presiding

derman , Erinh all Hume, Alderman-at-lar ,e,

T . _vent, Alderman ;vard 1

A.T. Chandler, Alderman, WaTd 2

T;v.E. Kennon, lilderman Ward 3

c. n. Roach, Alderman 4

* 4. 4 *

a.A. bratton, 1,ttorney V.C. Jones, lairshal

After the business had been opened according tb law, the follow' business was transacted:

Upon motion duly made and seconded it Was ordered that the following accounts be allowed and that warrants be issued accordingly. From the

C ORPOT-IATI ON FT:1173

51. R.X. vvilliams, Mayor riusust salary $80.00 52. Branham Hume, iUderman - $10.00 53. T.E. Avent, ft $10.00 54. wi.T. Chandler, " $10.00 5. W.L. Kennon, $10.00 5 . Rocl, ao.00 7. H.A. Mbore $5o.co 58. V.C. Jones, Marshal $1:25.00 5s) . Sam K el, watchman " $100.00 60. R.N. Whitfield, Bandmaster " $40.00 el. C.A. Bretton, Attorney ,f 62. C.A. Eratton, Fee in Buie cas 41:JO.00 63. Mrs. 0.E. Hoclomb, "Matron " ,I $20.00 64. Lii ian Jones, Secretary " n $40.00 G. 0.H. Douglass, Cemetery upkeep for August $50.00 66. H.A. Moore, T.C., Telephone, supplies, etc--- $102.05 67. Oxford Eagle, Supplies Go 6. porter bardwae Co., ,:upplkes $11.26 69. Belk's Gara ge, Rep. to truck- .;2.25 70. L.G. Lynch, Gasoline fo , SPA $3.72 71. Bramlett Drug Store, Dupplies ------ .51 72. V.C. Jones, Trip to Water Valley- -- - _43.00 73. Hughes Hardware Co., 6upplies ,.., 4a5.10 74. Patton-Courtney hardware Co., supplies $10.4e 75. Tennessee Valley Electric Sueply Co., Suppkiee 46145- 76. George D. Barnard, Supplies $8.09 77..1.A. Martin, Jr., $11.77 78. blue Print Company, Supplies $4.03 75. E•P• Lowe, Engineering for August $75.00 (Continued) 57 REGULAR LEETING REPTEMBER 6, 1938

t CORPORI:TION FUND (Continued)

80. Walter D. Pettis, Surveying for Aug $126.73 81.Avent's Drug Store, Supplies 82. Lighting Ficture and Electric Supply Co., Supplies--$15.3 6

83. Hall Blacksmith, Supplies- - - 84. Elliott Lumber Company, Supplies $tt99g 85. Frazier & Coers, supplies - Total $1127. 1 STREET FUND

86. S. E. Spears, Foreman, August salary $100.00 H.A. Moore, T.C., Labor tickets, etc $242.72 F.W.'Belk, Fire truck service $50.70 ,._ 89. W.T.'Jones, Keeping prisoners for Aug $46.25 90. Akron Brass Manfacturing Co., Supplies $8.52 91. Keupple & Esser Company, Supplies $3.31 92. Davis-Mize Company, Supplies $4- 0 93. Pittsburgh Plet4 Glass Co., Supplies -$1.00 94. L.G."Lynch, Gas $58.37 95. Hall Blacksmith, hep. to truck() .50 96. Porter Hardware Co., Supplies $8.85 kr.) 9. HUghes Hardware Co., Supplies---- -$1.12 (...',' 98. C.G. Huggins, Eep. to truck $7.Z5 Cq 99. Blue Star Service, 2 ice books $5.05 rz-• 100. Patton-Courtney, Supplies .77 $16.00 ..14 101.. 0.D. Livingston, 4 days work 102. hudson Walker, 2 days work -$5.00 103. Earl Freeman, 8 days work $2 .00 Total $590.01

SCHOOL FUND

104.' C.S. Byers, Janitor for August $60.00 11. O.D. Smith, Pro rate share of Aug. salary $31.13 16 . H.A. Aoore, T.C, Telpphone, etc $5.71 107. R.H. Gillespie, supplies, 7tc $7.41 108. Webster Publishing Co., Supplies $14.52 109. A.C. McClurg & Company, Supplies $23.34 110. C.A. Gregory Co., Supplies $8.52 111. Pittsburgh Plate Glass Company, Supplies $§08 112. Tayloe Paper Company, Supplies $4.80 113. Scott, Foreman & Co., Supplies $12.55 114.McMillan Company, Supplies $13.54 11. Stratton Warren Hardware Co., Supplies $4. 00 11b. Mil- on Mills(Websterl Labor on school bldg.----$2 .00 117. romEercial Print Shop, Supplies $16.25 118. Porter Hardware Co., Supplies $15.50 119. J.B. Shultz, Rep. to fountain 120. L.M. Inmon, Work done by C. WortYam; - 8

121.Elliott Lumber Company, Supplies -- - 122. Orford Insurance Company, Insurance $168.00 123. Jack Harmon, Work on windows $2.50 124. Patton-ourttey, Supplies $7.21 Total $557.15

58 REGULARI•4=I.M , SEPTEMBER 6 , 1938

LIGHT AND '''ATER FUND

125. C. E. Harri 4 Supt. August salary 0e0P45.00( 126.G.W. Johnson, Engineer " $125.0 0- 127. A.L. Mullin, August salay $115.oer 12. Louis Campbell, August silary $105.0a 129. Howard ••inter, Lineman, Aug. salary $105.0:-1 130. H.L. 'Moore, $50.007 131.Lillian Jones, Secretary 9 tf $40.00/ 132. T.A. Dune, Rent for Aug.---- - $5o.oa' 133. Mrs. Lillie gates, Pent for Aug. $10.00/ 134. H.A. :bore, T.C., Labor tickets, etc $487.37' 135. Elliott Lumber Company, Supplies 136. Cofield Studio, Pictures• $10.00' 137. Hughes Hardware Co., Supplies - $5.08/ 13t. Patton Courtney Edw. Co., Sup -elies- $25.90- 139. E.G. Lynon, Gas $13.3(Y, 140. Porter Hardware Cc., Supplies $3.37! 141. Belk Garage, Supplies • 50 142. Tennessee Valley Electric Company, Supplies $49. 117- 143. ':,estern Union, Telegrros 144. J.B. Dilworth Company, Supplies $22.71 145. Diesel lant Specialities Co., :Supplies - $6:65, 14 . De LaVergne Eingine Co., Supplies ,$40.2a- 147. Gould rumps, Supplies $36 .5 145 . Crane Company, Supplies $15.,J3/ 149. Kethel Sheet ietal Supplies 150. ,,merican Locomotive Company, Supplies $5 .37' 151. Duncan Electric Company, Supplies 152. Landers, Frary_8c. Clark. Co., Supplies .73 153. ::estinghouse, Supplies -$5.28 154. Equitableeter Company, Supplies $1 ,- 2.20/ 155. Graybar, 4q.46 156. Arkansas Fuel Oil Co., Fuel Oil 45 8 .96/ .hiechman Crosby ;supplies- $7.34 15 Orgill Brothers Company, Supplies w1. Total 9

atND FUG D

159. H.A. Moore, T. 0 , Exc. on check .62 * * * * * * * *

Came on and for consideration the payment of albill presented by Bill Gates for the two sunnier editions of the University paper. Amount of bill presented is c1.4.50. As the bill had not been approved by the Board, motion was made by T.E. Avent and seconded by Branham Hume that $7.20 be paid on this bill. Passed unanimously. * *

Came on for consideration at the reeuest of Mr. H.F. Simpson, the release of Butch Robinson. from the remainder due on a fine. Motion made and seconded and .uninamously __proved that this not be allowed and that he should pay the balance due on Continue working for the city until it is

r +

Upon remommendation of the Mayor to the Board, it was ordered that a traffic light be installed at the inter-section of South 5th and University Avenue. Unanimously approved. * 4 *

Came on for consideration the recaAmendation of the City auditors 9inkler ofT.B.reating a revolving fund•to be used by the city clerk. Motion made be E Avent and seconded by C. H. Roach. and unanimously adopted with instructions as recommended by the auditor to be followed. REGULAR MEETING SEPTEMBER 6, 1938

Came on for consideration the employing of an engineer and architect to file plans and specifications for an addition to the Oxford Municipal Airport for the WPA. the bid of $75.00 made by W.E. Mallett of Jackson, Mississippi, being the best offer the contract was awarded to him. * * * * * * * * * * * * * *

Came for consideration the avasion of light and water bills as reported by C.E. Harrison, Superintendent of Light and Water Plant. Motion was made and seconded and unanimously adopted that all new customers who do not own their place of residence or business be required to make q deposit with the city clerk of $2.50 for lights and $2.50 for water or $5.00 for both, those customers having an electrical refrig- erator to be inclusde in the above, those having an electric stove or electric hot water heater or electrical equipment of similar capacity to be required a deposit ofd $7.50. All customers who have paid their bills by the 10th of each month and who have resided in the city of Oxford for a period of 12 months, beginning October 1st, 1938 or when their services have been terminated within that time and all bills paid, will be refunded the total amount deposited. ,This to apply to new cu. tomers only beginnin.q. October 1st, 1938: * * * * * * * * * * * * * *

Come on for consideration the administr , tion of the Buie estate with Miss Kate • C'D Skipwith as administrator. Motion made and seconded and unanimously adopted that the City of Oxford would accept the administration of this estate by Miss Cq KRte Skipwith without bond for their interest in same and that they will accept all lands from this estate without an abstract of title on same and request that the courts do not require the above bond in this case.

Came on for consideration the installation of a street light back of the Duncan and Douglass building. Motion made and se0onded that this be installed nad unanimously adopted. * * *

Came on for consideration the purchase of automobile testing equipment as outlined by the 1938 Mississippi State Highway Patrol. Motion was made and seconded that the City attorney prepare advertisement for bids for this equipment, also, plans and specifications, which was unanimously .adopted.

* * * * * * * * * *

Came on for consideration the employment of someone to take the homestead exemption blanks as authorized by the 1938 se sion of the State Legislator and the servies cf Mr. Louis Stephens being approved for the next 10 days, beginning September 8, and ending September 19, 1938, To be paid $5.00 per day for same. Motion made and seconded and unanimously adopted that he be employed under these conditions. * * * * * -1‹ * * *

A RESOLUTION EXTENDING THE TIME FOR TEE BEGINNING OF THE WORK ON PWA PROJECT, OXFORD, MI - SISSIPPI, DOCKE2 Miss. 1220-F

Whereas, it appe:irs that the City of Oxford made application to the Public orks Administration authorities for a grant for the construction of a city Hall and equipping the same for the City of Oxford, Lafayette County, Mississippi, and Whereas, ti appears that said Project was approved and a grant was made, and that in said a)plication the time specified in the accepted offer of the Govern- ment, the work was to begin on August 2b, 1938; and,

whereas, it appears that on account of certain necessary changes in the plans, and that viississippi reJ,uires 21 days for advertising of bids, the work .-has not been started, but advertisement for bids has boen published; and, theret6e9

SEPTEMBER 6, 1538 REGULAR 1.i.EETII,TG

Be it resolved by the Board of Mayor and Aldermen that extention of time to eptember 193 9 , for the starting of work is hereby requested of the Federal Emergency Administration of public 'orks; no extension of time is requested for the completion of this project.

The above resolution was this day offered and adopted by the Board of Mayor and Aldermen in regular session convendd on this the 6th day of September, 1538.

' 1`

.whereas, it appears that Bud and Emma Kirkwood are t:Le owners of a certain lot in the City of Oxford., Mississippi, in Section 21, Township 8, Range 3 west, heretofore deed to them by S.H. Plant; and

'411ereas, it appears that the City of Oxford, by proper resolution, had the street north of said property paved in 1927 and that there was leties azainst the said property a Front-Foot assessment of $2.54; and

•thereas, it adpears that they are in areas for the years 1931,1932,1933,1934, 1935,1536 and 1937 and that the total amount due, Principal and Interest and printer's fee-is $378.26; and

Whereas, it appears that the City of Oxford is desirous of acquiring a strip of land 30 fcet wide across the west side of seid property and that they are willing to cancel said indebtedness and loth here'ey cancel said inddbredness and further hereby agree to remove the little house in which Dud and Emma Kirkwood now live and reconstruct same on the balance of the property at such point as may be design ated by Bud and Emma Kirkwcod, in consideration of the said Bud and Eima Kirkwood, conveying to the City of Oxford all of their title and interest in and to a strip of land 30 feet wide on the west side of their said lot, located in .ection 21, Township 8, Range 3 west, city of Oxford, Lafayette County, idississippi.

* * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess u#til Friday, September 9, 1538, at 3:00 o'clock P.m. B1 SPECIAL M1 ET SEPTEMBER 7, 1938

TO TEE MEMBLHS OF,,THE BOARD OF LADERMEN OF THE CITY OF OXFORD, MISISSIPPI

Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxfotd, at the City Hall at 3:00 P.M., on the 7th day of September, 1938, for the purpose of introduction and passing a resolution declaring the intention of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, to call an election in said city of Oxford, Mississippi, or. Friday, September 30, 1938, for the purpose od determining whether or not said City of Oxford shall issue its revenue bonds in the sum of not exceeding $67,500.00 for the purpose of construction an addition to the present power plant and equipping the same.

klasci for the purpose of issuing and selling $20,78.00 of bonds of said city for the purpose of constructing and equipping a cold Storage Plant.

Dated this the 7th day of September, 1938

R.X. Williams, Mayor

CONSENT TO MEETING

viitness our signatures on this the 7th day of September, 1938.

W.T. Chanler, W.L. Kennon C.H. Roach Branham huae of e The Mayor and all membr:.L.members Av thent Board, with the attorney being present the meeting was opened. * * * * * * * * * * * * * * * * * ** * *

A RESOLUTION DECLARING THE INTENTION OF TP7 MAYOR AND BOARD OF LADE- aN OF THE CITY OF MIME, MISSISSIPPI, TC ISSUE AND SELL TWENTY THOULLND7 SEVEN HUNDRED SEVENTY SEVEN DOLLARS AND SEVENTY SEVEN CENTS OF BONDS ($20,777.77) OF SAID CITY FOR THE PURPOSE OF CONSTRUCTING ND E UIPPING COLD STORAGE PLANT.

Be it resolved by the Mayor and Board of Aldermen of the City of Oxford, Mississippi:

Section 1. That it appears unto this Board, and this Board finds, determines and adjudges as follows:

(a) That it has been fixed, determined, and found necessary to the City of Oxford, Mississippi, to construct and equip a cold storage plant.

(b) t hat the cost of such improvements will be approximately $37,777.77 a portion o which will be paid by a grant from the United States of America.

(c) 1.r_at the remainder of such cost shall be paid by a loan secured by the revenue iroduced by the operation of said plant, and will be made available b;/ the sale of revenue producing bonds in the sum of Twenty Thousand Seven Hund- red Seventy Seven bllars and Seventy Seven Cents ($20,777.77)

(d) That the issuance and sale of the bonds of the City df Oxford in the sum of .Twenty Thousand, Seven hundred and Seventy Seven dollars and Seventy Seven cents ($20,777.77) . for the purpose of making such improvements, when added to all other bonded indebtedness of said City of Oxford, including all bonds authorized but not sold and delivered, will not cause such bonded indebtedness, exclusive of bonds or other evidences of indebtedness, when added together doeS not exceed the limit authorised by law.

SECTION 3. That the Board declared its intention to issue the bonds to the City of Oxford in the mxaimum amount of Twenty Thousand, Seven Hundred Seventy-seven dollars and Seventy seven cents, for the purpose of constructing a Cold Storage Plant in the City of Oxford, Mississippi.

SECTION 3. lhat the said Board will be authorized at a meetin: -4 of this Board to be held at the regular meeting place of said Board in the City of Ox- ford on Friday, September the thirtieth, at 3:30 P.A., 1938, without any election thereon unless on or before trig t date twenty percentum (20%) of the qualifidd € 2 SPECIAL =TING sEpTEmBER 7 1c7 8

electors of the City of Oxford file a written protest against he issuance of said bonds, in which eve n t an election will be called and held as required by law.

SECTICT 4. Eat the Clerk of the City of Oxford is hereby directed to give not less than three (3) weeks' notice of such intention by publishing this resolution in the Oxford Eagle, a newspaper of general circulation published in said City once a week for three we - ks proceeding September the thirtieth, 1538.

A RES OLUTI ON DECLARING TEA INTL1712I ON OF TEA 01,LD CF LIZERIEN OF TIE CITY CF OXFORD, r , TO I':::"LTE ;3‘ELT SILTY SEVEI,TTECUSAKD THREE IITTNDF ED SEVENTY-F IVE DOLLARS. ('i:67,375 00 ) OF I:EYE-I,7 BC ITS OF :LTD CITv FOR THE PURPO3E CF C ONSTRUCTING AND F...-UII-"PING ALL' I'll ON TO THE PRESENT PMEL PLANT OF SEAL CITY.

WHEREAS, it appears to the Board of Mayor and -..1dermen of the City of Oxford Mississippi, that the said city has a municipally owned power plant' and

WHEREAS, it further aopears to said Board of Mayor and Aldermen that said plant is now insufficient to supoly the needs of said City ;and

WHEREAS, said Board is of the opinion end has fixed, determined and found necessary that said plant be enlarged and new wuipment installed; and,

WIEHEr. the said umicipality has not the funds to erect and e:juip an addition to said power plant; and,

WHEREAS, the United. States of America is willing to make a grant and loan for said purposes:

THITgFORE, be it resolved by the Board of Mayor end Alderman of the said . City of Oxford that the said City shall issue its revenue producing bonds in the sure of Uixty Seven Thousand, Three Hundred Seventy Five Dollars, the same being fifty- five per cent (95%) of the estimated cost of such improvements, it having been found and determined that the estimated cost will be One Hundred Twenty Two Thousand, rice :Hundred Dollars (17:122,500.00).

SECTION 2. It is further ordered by the Board that an election for the purpose of determining whether or not said revenue improvement bonds shall be issued, an election is hereby called to be held in the City Hall, of Oxford, on Friday, L)eptember 39, 1938..

SECTION 3. Said ballot for said election shall have printed thereon "For Said Revenue Bonds" and "Against Said Revenue Bonds".

SECTION 4. `fit is further ordered that the Election Commissioners of the City of Oxford shall :e.ive notice of Soecial Election for the time and in the manner required by law in Oxford Eagle, a newspaper published in said city and having a general circulation therein, also, by posting notice of such election in three public places in said city, once a week for three weeks prior to said election.

SECTION 5. it is further ordered that the Election ;(pmmissioners of said city shall hold said election at the time and place hereinabove specified and shall canvass returns thereof and make known the same to the Board of Mayor and Aldermen by filing said returns with the clerk of said Board.

NOTICE OF SPECIAL ELECTION

Notice If hereby given that at a call meeting of the Board of Mayor and Aldermen held in the City Hall, in the City of Oxford, Mkfayette County, Mississippi, on this date, a Resolution was adopted by said Board declaring its intention to issue its revenue bonds in the sum of Sixty Seven Thousand, Three Hundred Seventy-five dollars ($67,375*03) for the purpose of erecting, and equipping: an addition to the present power plant of said city. Which said bonds shall be paid. together, with the interest thereon, by the revenues derived from the operation of said plant. Said election to be held in the city hall of the City of Oxford, on Friday, September 30, 1538. Wipiess our signatures this the 7th day of September, 1538. Phil Carnathan, Ro F Brown X Election Commissioners. Wright Patton Upon motion duly made end seconde it was ordered that this Board sine die. do now adjourn 63

SEPTEMBER 9, 1938 RECESS MEETING

The Board met pursuant to the above and foregoing recess order of September 6, 1938, at 3 o'clock P.M., when and where were present the following members:

R.X. Williams, Mayor Presiding

Branham Hume, Alderman-at-large

T.E. Avent, Aldermen, Ward 1

W.T. Chandler, Alderman Ward 2

W.L. Kennon, Alderman, Ward 3

C.H. Roach, Alderman, Ward 4 * * * * * * * * * * *

C.A. Bretton, : Oity Attorney V.C. Jones, Marshal H.A. Moore, Deputy Clerk * ** * * * * * * * * * * M *

A RESOLUTION ORDERING TIE FILING OF BIDS.

Walter L. Perry, Construction Company, Philadelphia, Miss. Newton& Schmoll, Hattiesburg, Miss. Flint & Jordon, Jackson, Mississippi.

NOW, THREFORE, BE IT RESOLVED that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, consulting Architect, and that the said James T. Canizaro, is hereby directed forthwith to tabulate e id bids, end at the earliest practicable moment, report to this Board of Mayor and Aldermen, his findings as to the lowest and best bid.

The above resolution was this day passed and adopted. * * * * * * * * * *

RESOLUTION AWARDING CONTRACT

Whereas, James T. Canizaro, consulting Architect, pursuant to esolution heretofore adopted, has tabulated and vonsidered all bids heretofor received for the construe on of a City Hall and has duly made his recommend ons to this Board of Mayor and A ermen, and it appearing from said Recommenda • ons and repott that Walter L. Perry nstruction Company Philadelphia, Missi ppi, is the lowest and best bidder _o the constructio Hall in e sum of $25,850.00; and that this Board o Mayor and Al ,en, after con derin,:,. said report and recommendations and all b s heretofore, filed, fin that the bid of Walter L Perry Construction Compan 's the lowest and be bid:

NOW THEREFORE, BE IT RES T TED BY TIT CARD -CF MAYOR AND ALDMTEN, AS FOLLOWS:

SECTION 1: That the bid of .alter Perry Construction Company for the construction of a city hall in t sum of $2 0.00 is hereby accepted, determined b ;11c1 declared to be the lowest d best bid; and t a contract for the construction of said work, as hereto •re prescribed by the ol q, spetifications and contract documents, shall be forthwith executed for said construc on.

SECTION 2: T st R.X. Mayor, and W.T. Chandler, .ty clerk, are hereby authorized nd directed to execute said contract for and on • elf of the City of Oxford

e above Resolution was this day ordered and adopted 1D the Mblyor and Boar of Aldermen of the City of Oxford, NIF:sissippi. * * * * * * * * * * -* * * 64 MEETING SEPT=ER 9, 1938

Be it resolved by the Mayor and Board of Aldermen of the City of Oxford, Mississippi, that R.X. be and is hereby desinated as local representative of this Board on the site of Locket No. Miss. 1219-DS and 1245 7F and Docket No. 1220-F, and such is authorized to received from all PWA officers and employees all requests, rulings, and other information dsemed by them necessary in the construction of the project and when necessary it is his duty to promptly report to this Board so that any action by the Board, which may be proper, may be taken and the said B.X. vii lianas, may make all proper and necessary certifications aS to work and material that may be required in the construction cf the project.

* * * * * * * *

On motion made and seconded and unanimously adopted it was ordered that a warrant be issued to Tames T. Canizaro for she sum of $764.88, or eo% of rchitectual fee for Docket No. Miss. 1219-DS, addition to Present Gra=ar Scho-1

On motion made and duly carried it was ordered that this Board do now recess until 7:30 'P.M., Friday, September 9th, 1938. 65

"'FRIDAY, SEPTEL'EM 5, 1938 RECESS =ING

The Board met bursuant to the above and foregoing recess-order of September 9, 1938, at 7:30 P.M., September 9, 1339 when and where were present the following members:

R.X. Williams, Mayor Presiding Branham Hume, Alderman-at-large T.E1Avent, Alderman .Ward 1 W.T. Chandler, Alderman Ward 2 CV.L.Kennon, Alderman Ward 3 C.H. Roach, Alderman Ward 4.

;f: * * *

C.A. Bratton, City Attorney H.A. Moore, Deputy Clerk Lillian,Jones, Secretary

Upon motion duly made and seconded and unanimously carried, it was ordered that this Board do recess until Friday, September 16, 1938 at 7:30 P.M. 66 CALL 'TTING SEPTEMBER 15, 1938

TO T1 MEMBERS CF TEE hOARD OF ,EDERZIT CF THE CITY CF OXFORD,

Notice is hereby given that a special meetin of the Board of Mayor and Aldermen of the city of Oxford, Missitippi, will be held in the city of Oxford at the City. Hall. at 10:00 o'clock A.M., on the 15th day of Spetember, 1938, for the purpose of introduction and easing of a resolution to change the allotment of Docket No. 1219-DS, '3chool, changed from a loan and grant to a grant only. for the purpose of awarding C ntract for Locket No. 1220-F, City Hall and setting the date for stnrting constructicn.

Dated this the 14th day of ',3eptember, 193,8

R.X. illiams, M4yor

CONSENT TO -.EETIN'

e, the undersigned members of the Board of ,, ldert:en of the City of Oxford, Mississippi, hereby accept the service of the above E-MC] foregoing notice, waving any and all irregularities in such srvice and such notice, and consent and agree that said Board of Aldermen shall meet at the time and. 1ace therein stated.

Witne7s our signatures on this the 1 , th day of 3eptember, 1938.

Chandler Br. anha n Hume ".L. 'en= C.H. "oach T.E. Avant

'f‘

The board met puruuont to the above and foregoing call of September at 10 o'clock AIM. when and where were present the following members:

R. A. rresIdin

T.L. iNent, Alderman, acrd 1 T. 'handler, I=Llderman hard 2 C. H. Roach, ride amen .l rd A Branham Hume, lildermen at large

nd where the f oll ow it busine - was had to

A RE":":OLUTION A- ARDINC COTTRI-_CT

'i.;ltereas, James T. Caniznro, Consulting .Th'...chitect, Iyursuant to a Resolution. heretofore adopted, .hqrs. tom'' Dted and considered. al bids •eYetoforo received for the construction of a City Nall and has duly m de his recommendations to this Board. of [ 1-ayor and -,.1dermen, and it appearing from said recommeadotions and report that alter L. Perry Construction Company, rIiiadelphin, is the lowent and best bidder for the con struction of a City hall in the snm of 2'j,k)0.00; and that this Board of jayor and Aldermen, after considerng sa_d. report and. recommendations and. all bids heretofore, filed, finds that the bid of.falter L. Perry Construction Company is the lowest and. 'a at .:id;

TIC Tin_l_LEFCT"'E EE IT ' 77301VIEE :7 TB E[C= OF :.]AYCR ND .nLDE.li,TEN FL:La:5:

SECTICN 1. That the bid of. alter L. Ferry Construction Com pany for the construction cf a city hall in the sum of c;,25,85.0.00 is hereby accepted, determined end declared to be the lowest and best bid; and that a contract for the construction of said worl•, as heretofore prescriped by the plans, pecifications and. contract documents, shall be forthtrith executed. for said construction.

SECTION 2. That ill it" M.ayor and 7i.T. Chandler, City Clerk are hereby nutherioed and. directed to execute said contract for and on behalf of the City of Oxford, i,4.ssissi'ppi.

The Above resolution was thi order d and adi ted. bo• a hy. or and Beard Alderme[o of the City of a± ford, foilssissippi. *** , * * * * * t *

Upon motion made ond duly carriod it ws ordered. that this Beard do now recess until Friday, •Thptember 1 E), 1(.. s7-

RECEaTED =TING SEPTEMBER 16, 1938

The Board met pursuant to the above and foregoing recess order of September 4 1938, at 7:30 ±.M., September 16, 1938, when and where were present the following members:

R.X. ailliams, Mayor Presiding T.E.kvent, Alderman, Ward One W.T. Chandler, Alderman Ward Two W.L. Kennon, Alderman, Ward Three C.H. Roach, Aldermen, Ward Four Branham Hume, Alderman at large * * * * * * * * * * C.A. Bretton, Attorney H1A. Moore, Deputy Clerk V.C. Jones, Ihrshal

* * i r * * x * * *

Upon motion duly made and seconded and unanimously carried, it was ordered that this Board do now recess until 7:30 P.M., Saturday, iVEJ4 September 17th, 1938.

L RECESSED MEETING

The Board met pursuant to the above and foregoing order of Septembet 10, 1938, at 7:30 P.M., on Saturday September 17, 1938 when and where the following were present: R.X. Williams, Mayor Presiding Avent, Alderman, Ward One W.T. Chandler, Alderman, Ward Two -#61..-hannon%lderman, Ward Three C.H. Roach, Alderman, Ward Four Branham Bume, Alderman,-at-large * * * * * * * * * * * * * * * * * * * *

C.A. Bretton, City Attorney H.A. Moore, Deputy Clerk V.C. Jones, Marshal * * * * * * * * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess until Monday, September 19, 1938 at 7:30 o'clock P.M. RECESSED MEETING

Be it remehbered that the Mayor and Board of Aldermen of the City of Oxford, Mississippi, met pursuant to a recess order of September 10, 1938, at the City Hall on this the 19th day of September, 1938, at 7:30 P.M., when and *thews the following were present:

R.X. Williams, Mayor Presiding Branham Hume, Alderman-at-large T.E. Avent, Alderman, Ward 1 M.T. Chandler, Alderman, Ward 2 W.L. Kennon, Alderman Ward 3 C.H. Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * * *

C.A. Bratton, &City Attorney H.A. Moore, Deputy Clerk V.C. Jones, City Marshal

Le'D After the meeting had opened according to law, the following proceedings were had to-wit:

LL-4 WHEREAS it appears that the City of Oxford, Mississippi, has this day approved an ordinance offering for sale three issues of bonds; One in the sum of $13,000.00, one in the sum of *17,000.00 and one in the sum of $19,000.00; and,

WHEREAS, the firm of Leftwich & Ross has offered to buy said bonds at 3 3/4% and accrued interest at time of delivery; now

THEREFORE, be it ordered by the Mayor and Board of Aldermen that said offer be and the same is hereby accepted.

Ordered in open session on this the 19th day of September, 1938.

The above. motion was mayde by C.H. Roach, seconded by Branham Hume and upon a vote of all members of "yea", the same was hereby accepted and passed. * * * * * * * * * * * * * * * * * * * * *

Hon. Mayor &Board of Aldermen, City of Oxford, Miss. Oxford, Miss.

You have for sale the following issues of bonds of the CitY7i0,,, Oxford, Mississippi, which are general obligations thereof, payable from unlimited ad valorem taxation:

$13,000.00 Grammar Schoo, dated June, 1938, due $500.00 from June 1, 1939 to 1942, $1,000 from 1943 to 1953:

$17,000.00 City pAll, dated August 1, 1938, due $1,000 from 1939 to 1955; $19,000.00 Negro School, dated August 1, 1938, due $1,000 from 1939 to 1957. We will pay you for said bonds, par and accrued interest to date of delivery, the said bonds to bear interest at 3 3/4% per annum, payable semi- annually, both principal and interest to be payable at the City Depository at Oxford, Mississippi, said bonds to be delivered to us in Memphis, Tennessee.

We will arrange to hate the said bonds printed and approved and will bill you for our costs in that connection that you may. reimburse us.

The foregoing offer is subject to said bonds being approved in all respects as to legality by Charles & Trauernicht, Attys., St. Louis, Missouri, as general obligations °friths 91ty of Oxford, payable from unlimited advalorem taxes, maturing as aforesaid without option of prior payment.

L 70 RECESSED MFTTING SEPTEMBER 19, 1938

It is further agreed that when the aforesaid issues are being validated in Chancery Court of Lafayette County, Mississippi, if there is an objection by any tax payer to any or all of the said issues, then this agreement shall become void with respect to those issues being contested.

I t is further agreed that we will within two days deposit with you a check on some solvent bank or trust company in the amount of 41,000.00, to be held by you pending our compliance with the aforesaid terms and conditions; and to be full liquidated damages if we fail or refuse to comply with the terms hereof.

Respectfully submitted,

LEFTWICH & ROSS Memphis, Tenn

By H.C. Ross Sept. 19, 1938

The foregoing was accepted by resolution of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, this the 19th day of September, 1938

* * * * * * * * * * * * * * * * * * * * * * Upon motion made by Alderman T.E. ;went and seconded by Alderman Branham Hume, the following Bedinance was adop-MVORDINANCE AUTHORIZING THE ISSUANCE OF THIRTEEN THOUSAND DOLLARS ($13,000.00) OF SCHOOL BONDS FOR THE PURPOSE OF CONSTRUCTING AND EQUIPPING AN ADDI- TION TO THE PRESENT Gi- AMMAR SCHOOL BUILDING.

WHEREAS heretofore, at a meeting held on t he 19th day of August, 1938, the Mayor and Board of Aldermen of the City of Oxford, Lafayette County, Mississ- ippi, did adopt a resolution declaring the intention of said Mayor and board of Aldermen to issue bonds of said city in the amount of Thirteen Thousand Dollars (413,000.00) for the purpose of erecting and equipping an addition to the present Grammar School Building for said city and by said resolution said Mayor and Board of Aldermen did declare that said bonds would be issued at a meeting of said Board to be held at 7:30 o'clock P.M., on the 16th day of September, 19356, unless twenty per centum (20%) of the qualified electors of said city should file a written protest against the issuance of said bonds on or before said day and hour; and

WHEREAS said resolution was spread upon the minutes of said Board in Minute Book 10,'page 51; and

WHEREAS, pursuant to said resolution and as required by law, the said resolution was published in the Oxford Eagle, a newspaper published and having a general circulation fo said city of Oxford, Mississippi, said resolullon being published in said newspaper on the 25th day of August, 1st, 8th and k§th day of September, 1938, as evidenced by the affidavit of the oublisher of said newspaper, now on file with the City Clerk and now before this Board; and

WHEREAS, twenty per centum (20%) of the qualified electors of said City of Oxford have not filed a written protest against the issuance of the aforesaid bonds in the amount of Thirteen Thousand Dollars ($13,000.00) for the purpose of erecting and equipping an addition to the present grammar school Building for said city and no protest against the issuance thereof has been filed by.any-person, and

WHEREAS, the time set by said resolution before which said written protest should be filed has now passed; and

WHEREAS, the said city of Oxford has a population of less than twelve thousand (12,000) inhabitants, and the amount of bonds proposed to be issued for each of said purposes separately or for both of said purposes together, is not more than Thirty Thousand Dollars ($30,000); and

WHEREAS, the assessed valuation of all the taxable property within said city according to the last completed assessment for taxation is One Million, Five Hundred fifty-four, seven Hundred Seventy Three dollars (41,554,773.00); and 71- RECESSED MEETING SEPTEMBER +9, 1938

WHEREAS, the bonded indebtedness of said city is the sum of Two Hundred and Twelve Thousand Dollars (212,000.00); and

WHEREAS, the amount of bonds proposed to be issued, when added to the now outstanding bonded indebtedness of said city, does not exceed ten per centum (10%) of the assessed value of the taxable property within said city according to the last completed assessment for taxation, after the deduction of all bonds or other evidence of indebtedness of said city for water and light purposes and for the construction of special improvements primarily chargeable to the property benefited or for the purpose of paying the City's proportion of any betterment, a portion of which primarily chargeable to the property benefited, and does not exceed, when added to all of the outstanding indebtedness, both bonded and floating, of said city twenty per centum (20%) of the assessed value of all the taxable property within said city; and

, WHEREAS the Mayor and Board of Aldermen are authorized, under the provisions of the Constitution and Statutes of the State of Mississippi, and particularly under the provisions of Chapter 50 of the Mississippi Code of 1930, to issue bonds in the aforesaid amounts for the aforesaid purposes;

NOW, THEREFORE, BE IT ORDAINED B THE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI, AS FOLLOWS:

Le-J SECTION 1. That there are herdby authorized and ordered to be issued bonds of the said city of Oxford, Lafayette County, Mississippi, in the amount of C3 Thirteen Thousand Dollars ($13,000.00) said bonds to be of the denomination of <1 .. Five Hundred each, to be dated the June let, 1938, numbered from One (1) to Four ..!!t (4) inclusive, and One Thousand Dollars each to be dated the June 1st, 1938, from Five (5) to 'fifteen (15) inclusive to bear interest at the rate of three and three-fourth -per centum (3 3/4%) per annum until the principal of said bonds shall have been fully paid, payable on the 1st dak of June, 1939, and annually thereafter on the 1st day of June in-each year. Interest accruing on said bonds on and prior to the maturity dates thereof, respectively, shall be payable upon presentation and surrender of interest coupons to be attached to said bonds, as said coupons shall severally become due. Provided, however, that no interest shall accure on said bonds after their respective maturity dates unless said bonds be presented for payment at maturity and be not theh paid. both the principal of and the interest on said bonds shall be payable in lawful money of the United States of America Si the City Treasury in the City of Oxford, State of Mississippi. Said bonds shall be numbered from One (1) to-Fifteen (15), both inclusive; aggregating ?hirteen ThoUsand Dollars ($13,000.00) shall be issued for the purpose of erecting and •equipping an addition to the present Grammar School Building for said city. And the said bonds shall mature, without option of prior payment, at the times and in thgoitmounte hereinafter setforth, as follows;

BOND NU/MUM AMOUNT MATURITY

1 $500.00 June 1st, 1939 2 $590.00 June 1st, 1940 3 $500.00 ZUne lst, 1941 4 $500.00 June 1st, 1942 $1,000.00 June lst, 1943 Z $1,000.00 June 1st, 1944 $1,000.00 June 1st, 1945 g $1,000.00 June 1st, 194b 9 $1,000.00 June 1st, 194! 10 $1,000.00 June 1st, 194 11 $1,000.00 June let, 1949 12 $1,000.00 June lst f 1950 13 $1,000.00 June 1st, 1951 14 $1,000.00 June 1st, 1952 15 $1,000.00 June 1st, 1953

SECTION 2. That said bonds shall be executed by the manual signature of the Mayor of said city of Oxford, countersigned by the Clerk thereof, under the Seal of the city and th* interest coupons to be attached to each bond shall bear the fac- simile signatures of said officer.

SECTION 3. That the said bondd and the interest coupons to be attached thereto, and the certificates of registration and validation to be endorsed thereon, shall be in substantially the following form4 to-wit: RECESSED MEETING SEPTEMBER 19, 1938

UNITED STATES OF AMERICA

STATE OF MISSISSIPPI

COUNTY OF LAFAYETTE

TOWN OF OXFORD 3 3/4% CITY OF OXFORD MUNICIPAL SCHOOL BONDS

No. $500.00

The city of Oxford, a municipal corporation in the County of Lafayette, State of Mississippi, for value received, acknowledges itself to be indebted and promises to pay to bearer the Sum of

FIVE HUNDRED DOLLARS

($500.00) on the first day of June, 19 , with interest thereon from the date hereof and until this bond shall have been paid, at the rate of three and three-fourths per centum (3 3/4%) payable on 19 and semi-annually thereafter on June first an December first in each year. Interest accruing on this bond on and prior to the maturity date hereof shall be payable upon presentation and surrender of the interest coupons hereto attached as the same become due. Both principal of and interest on this bond are payable in lawful money of the United States of America at the City Treasury, in the City of Oxford, States of Mississippi, and for the prompt payment of this bond at maturity, and the interest thereon as it accrues, the full faith, credit and resources of the City of Oxford are hereby irrevocably pledged. This bond is one of a series of Fifteen (15( bonds, numbered from One (1) to Fifteen (15) both inclusive, all of like date, tenor and effect, except as to number and date of maturity, aggregating the principal amount and sum of Thirteen Thousand Dollars ($13,000.00), being issued for the purpose of erecting and equipping of an addition to the present Grammar School Building for said city and this bond is issued under and pursuant to the Constitution and Laws of the State of Mississippi, including among others, Chapter 50 of the Mississippi Code of 1930, and pursuant to lawful ordinances and resolutions of the Mayor and Board of Aldermen of said city.

It is hereby certified, recited and declared that all things, conditions and actes required b7 law to exist, to happen to be performed precedent to and in the issuance of this bond in order to make the same a valid and enforceable general obligation of said city do exist, have happened and have been done and performed in due and regular time, form and manner, ad required by law; that provision will annually be made for the levy of a tax upon all taxable property Aft said city mufficient to provide for the payment of this bond and the interest thereon, according to the terms hereof, and that the amount of this bond and the series of which it is one, when added to all other outstanding indebtedness of said city, both bonded and floating, does not exceed any constitutional or statutory limitation of indebtedness.

IN TESTIMONY WHEREOF, the city of Oxford, Mississippi, has caused this bond to be signed by its Mayor and countersigned by its Clerk, under the seal of said city, and has caused the interest coupons hereto annexed to be signed with the fac-simile signatures of said officials, and this bond to be dated the 1st day of June, 19

CITY OF OXFORD, MISSISSIPPI

BY Mayer Countersigned:

clerk

7 3 (FORM OF COUPON) 1 No.

On the first day of June and the first day of December, 19 , the city of Oxford, Lafayette County, Mississippi, will pay to bearer Dollars ($ ) in lawful money of the United States of America at the City Treasury in the City of Oxford, State of Missisippi, for interest due that date on its City of Oxford Municipal School Bonds, datee June 1st, 1938, and numbered

CITY OF OXFORD, MISSISSIPPI

BY Mayor

Countersgined:

Clerk

CD (FORM OR REGISTRATION AND VALIDATION CERTIFICATE) C.) (73 STATE OF MISSISSIPPI) ss COUNTY OF LAFAYETTE )

I, W.T. Chandler, Clerk of the city of Oxford, I n Lafayette County, Mississippi, do hereby certify that the within bond has been registered in my office in a book kept for that purpose, as provided by law.

I do further certify that the within bond has b en validated and confirmed by decree of the Chancery Court of Lafayette County, Mississippi, rendered on the day of 1938.

Clerk of the City of Oxford, Mississippi.

'SECTION 4.. That for the purpose of making provision for the payment of the principal of and the interest on said bonds as the same shall mature and accurs t there shell be and there is hereby levied a direct continugin annual tax on all taxable property within said city of Oxford sufficient for said purposes after making due allowance for delinquencies and the cost of collection.

SECTION 5. That the proceeds of the sale of said bonds shall be used for the following specific purposes:

(1) The proceeds of the sale of bonds numbered One (1) to Fifteen (15) inclusive shall be used for the purpose of erecting and equipping an addition to the present Grammar School for said city ,of Oxford.

The proceeds arising from the sale of said bonds shall be kept separate and distinct, one from the other, and shall be used only for the purposes 1ereinabove set forth and Odr no Other.

SECTION 6. That the proceeds of the taxes levied for the payment of the principal of and the interest on the aforesaid bonds shall be deposited in a separate fund to be designated as the "City of Oxford Municipal School Fund", and shall be used for the purpose of the payment of the principal of and the interest on said bonds anf for no other purpose.

SECTION 7. that for the purpose of providing for the paymekt of interest which will accrue on the aforesaid bonds in the amount of of Dollars ($ t on the day of 1938, which said date is prior to the time when the first taxes to be levied hereunder can be codatected, there is hereby appropriated out of any available funds of the said city the sum of Dollars ($ ) which shall be applied to the payment of said interest.

SECTION 8. That the Clerk of said city is hereby authorized and directed to.prepare a transcript of all proceedings had in the issuance of the

L 74 RECESSED MEETING SEPTEMBER 19, 1938

aforesaid bonds and to submit the said transcript to the State's Bond Attorney in order that said bonds may be validated as provided under Chapter 10 of the Mississippi Code of 1930.

SECTION 9. That all ordinances or parts of ordinances in conflict with this ordinance shall be and the same are hereby repealed, to the extent of such conflict.

SECTION 10. That this ordinance shall be published in the Oxford Eagle one time immediately after its passage and approval.

SECTION 11. That for good cause and public interest requiring it, this ordinance shall take effect and be in force from and after its passage and approval. * * * * * * * * * * * * * * * * * * *

AN ORDINANCE AUTHORIZING THE ISSUANCE OF SEVENTEEN THOUSAND DOLLARS 417,000.00) OF MUNICIPAL BONDS FOR THE PURPOSE OF CONSTRUCTING AND EQUIPPING A CITY HALL.

WHEREAS, heretofore, at a meeting held on the 19th day of August, 1938, the Mayor and Board of Aldermen of the City of Oxford, Lafayette County, Mississippi, did adopt a resolution declaring the intention of said Mayor and Board of Aldernmn7 to issue bonds of said city in the amount of Seventeen Thousand Dollars 417,000.00) for the purpose of erecting and equipping a city hall for said city, and by said resolution said Mayor and Board of Aldermen did declare that said bonds woulb be issued at a meeting of said Board to be held at 11 7:30 o'clock P.M., on the 16th day of September, 1938, unless twenty per centum (20%) of the qualified electors of said town should file a written ppotest against the issuance of said bonds on or before -said day and hour; and

WHEREAS, said Resolution was spread upon the minutes of said Board iit Minute Book 10, page 51 and 52; and

WHEREAS, pursuant to said Resolution and as required by law, the said resolution was published in the Oxford Eagle, a newspaper published and having a gene eral circulation in said city of Oxford, Mississippi; said resolution being published in said newspaper on the 25th day of August 1st, 9th and Aldih day of September, 1938, as evidence by the avvidavit of the publisher of said newspaper, now on file With the city Clerk and now before this Board; and

WHEREAS • twenty per centum (20%) of the qualified electors of said City of Oxford have not filed a written protest against the issuance of the aforesaid bonds in the amount of Seventeen thousand Dollars ($17,000.00) for the purpose of erecting and equipping a city hall for said city, and no protest against the issuance thereof has been filed by any person; and

WHEREAS the time set by said resolution before which said written protest should be filed has now passed; and

WHEREAS, the said city of Oxford has a population of less than twelve thous- and (12,000) inhabitants, and the amount of bonds proposed to be issued for each of said purposes separately or for both of said purposes together, is not more than Thirty Thousand Dollars ($30,000.00) ; and

WHEREAS? the assessed valuation of all the taxable property within said city, according to the last completed assessment for taxation is One Million, Five Hundred Fifty-four, Seven Hundred Seventy three Dollars ($1,554,773,00); and

WHEREAS, the bonded indebtedness of said city is the sum of Two Hund- red Twelve Thousand Dollars ($212,000.00); and

WHEREAS the amount of bonds proposed to be issued, when added to the now outstanding bonded indebtedness of said city, does not exveed ten per centum (10%) of the assessed value of the taxable property w thin said city according to the last com leted assessment for taxation, after the deduction of all bonds or other evidence of indebtedness of said city for water and light purposes and for RECESSED MEETING SEPTEMBER 19, 1938

the construction of special improvements primarily chargeable to the property benefited or for the purpose of paying the City's proportion of any betterment, a portion of which primarily chargeable to the property benefited, and does not exceed, when added to all of the outstanding indebtedness, both bonded and floating, of said city twenty per centum (20%) of the assessed value of all the taxable property within said city; and

WHEREAS, the Mayor and Board of Aldermen are authorized, under the provisions fo the Constitution and Statutes of the State of Mississippi, and particularly under the provisions of Chapter 50 of the Mississippi Code of 1930, to issue bonds in the aforesaid amounts for the aforesaid iurposes;

NOW, THEREFORE, BE IT ORDAINED BY THE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI, AS FOLLOWS:

SECTION 1. That there are hereby authorized and ordered to be issued bonds of the said city of Oxford, Lafayette County, Mississippi, in the amount of Seventeen Thousand Dollars ($17,000.00), said bonds to be of the denomination of One Thousand Dollars ($1,000.00), oath, to be dated August 1st, 1938, numbered from One (1) to Seventeen (17) inclusive to bear interest at the rate of three and three-fourths per centum (3 3/4%) per annym until the principal of said bonds shall have been fully paid, payable on the 1st day of August, 1939, and annually thereafter on the 1st day of August in each year. Interest accruing on said bonds on and prior to the maturity dates thereof, respectively, shall be payable upon presentation and surrender of interest coupons to be attached to said bonda, as said coupons shall severally become due. Provided, however, that no interest shall accrue on said bonds after their respective maturity dates unless said bonds be pfesented for payment at maturity and be not then paid. Both the principal of and the interest on said bonds shall be payable in lawful money of the United States of America at the City Treasury in the City of Oxford, State of Mississippi. Said bonds shall be nufterad from One (1) to Seventeen (17), both inclusive; aggregating Seventeen Thousand Dollars ($17,000.00) shall be issued for the purpose of erecting and equipping a city hall for said city. And the said bonds shall mature, without option of prior payment, at the times and in the amounts hereinafter setforth, as follows:

BOND NUMBERS AMOUNT MATURITY

1 $1,000;00 August 1 1939. 2 $1,000.00 August 1, 1940 3 $1,000.00 August 1, 1941 4 iw $1,000.00 August 1, 1942 • $1,000.00 August 1, 1943 $1,000.00 August 1, 1944 $1,000.00 August 1, 1945 g $1,000.00 August 1, 1946 9 $1,000.00 August llf 194 10 $1,000.00 August 1, 194 11 *1,000.00 August 1, 1949 12 $1,000.00 August 1, 1950 13 $1,000.00 August 1, 1951 14 $1,000.00 August 1, 1952 $1,000.00 August 1, 1953 1 $1,000.00 August 1, 1954 17 $1,000.00 August 1, 1955

SECTION 2. That said bonds shall be executed by the manual signature of the Mayor said city of 'Oxford, countersigned by the Clerk thereof, under the Seal of the city and the interest coupons to be attached to each bond shall bear the fax-simile signatures of said officers.

SECTION 3. That the said bonds and the interest coupolls to be attached thereto, and the certificates of registration and validation to be endorsed thereon, shall be in substantially the following form, to-wit:

UNITED STATES OF AMERICA STATE OF MISSISSIPPI COUNTY OF LAFAYETTE CITY OF OXFORD

3 3/4% CITY OF OXFORD MUNICIPal, BONDS No. $1,000.00

The city of Oxford, a municipal oorporation in the County of Lafayette 76 RECESSED MEETZEIG SEPTEMBER 19, 1938

State of Mississippi, for value received, acknowledges itself to be indebted and promises to pay to bearer the sum of

ONE THOUSAND DOLLARS

(*1,000.00) on the first day of August, 19 , with interest thereon from the date hereof and until this bond shall have been paid, at the rate of three and three- fourth per centum (3 3/4%) payable on the 19 and semi- annually thereafter on August 1st and February 1st in each year. Interest accruing on this bond on and prior to the maturity date hereof shall be payable upon presentation and surrender of the interest coupons hereto attached as the same become due.

Both principal of and interest on this bond are payable in lawful money of the United States of America at the City Treasury, in the City of Oxford, State of Mississippi, and for the prompt payment of this bond at maturity, and the interest thereon as it accrues, the full faith, credit and resources of the city of Oxford are hereby irrevocably pledged.

This bond is one of a series of Seventeen (17) bonds, numbered from One (1) to Seventeen (17) both inclusive, all of like date, tenor and effect, except, as to number and date of maturity, aggregating the principal amount and sum of Seventeen Thousand Dollars (417,000.00) being issued for the purpose of erection and equipping a city hall for said city, and this bond .is ttsued under and pursuant to the Consti- tution and Laws of the State of Mississippi, including among others, Chapter 50 of the Mississippi Code of 1930, and pursuant to lawful ordinances and resolutions of the Mayor and Board of Aldermen of said city.

1t is hereby certified, recited and declared that all things, conditions and acts required by law to exist, to happen and to be performed precedent to and in the issuance of this bond in order to make the same valid and enforceable general obligation of said city, do exist, have happened and have been done and performed in due and regular time, form and manner, as required by law; that provision will annually be made for the levy of a tax upon all taxable property in said city sufficient to provide for the payment of this bond and the interest thereon, according to the terms hereof, and that the amount of this bond and the series of which it is one, when added to all other outstanding indebtedness of said city, both bonded and floating, does not exceed any constitutional or statutory limithation of indebtedness.

IN TESTIMONY WHEREOF, the city of Oxford, Mississippi, has caused this bond to be signed by its Mayor and countersigned by its Clerk, under the seal of said city, and has caused the interest coupons hereto annexed to be signed the fac-simile signatures of said officials, and this bond to be dated the 1st day of August 19 .

CITY OF OXFORD, MISSISSIPPI

B Y Mayor

Countersigned:

clerk (FORM OF COUPON)

No. #18.75

On the First day of August and the first day of February, 19 , the City of Oxford, Lafayette County, Mississippi, will pay to bearer Eighteen and 75/100 Dollars ($18.75) in lawful money of the United States of America at the city treasury in the City of Oxford, State of Mississippi, for interest due that date on its City of Oxford, Municipal Bonds, dated August 1st, 1938, and numbered

CITY OF OXFORD, MISSISSIPPI

Countersigned

clerk RECESSED MEETING SEPTEMBER 19, 1938

(FORM OF REGISTRATION AND VALIDATION CERTIFICATE)

STATE OF MISSISSIPPI ) COUNTY OF LAFAYETTE ) ss

I, W.T. Chandler, Clerk of the City of Oxford, in Lafayette County, Mississi- ppi, do hereby certify that the within bond has been registered in my office in a book kept for that purpose, as provided by law.

I do further certify that the within bond has been validated and confirmed by decree of the Chancery Court of Lafayette County, Mississippi, rendered on the day of 6 1938.

idlerk of the City of Oxford, Miss.

SECTION 4. That for the purpose of making provision for the payment of the Le'D principal of and the interest on said bonds as the same shall mature and accrue, C\i there shall be and there is her by levied a direct continuing annual tax on all .7- the taxable property within said city of Oxford sufficient for said purposes after making due allowance for delinquencies and the cost of collection.

SECTION 5. That the proceeds of the sale of said bonds shall be used for the following specific purposes:

(1) The proceeds of the sale of bonds numbered One (1) to Seventeen (170 inclusive shall be used for the purpose of erecting and equipping a city hall for said city of Oxford.

'he proceeds arising from the sale of said bonds shall be kept separate and distinct, one from theother, and shall be used only for the purpose hereinabove set forth and for no other.

SECTION 6. That the proceeds of the taxes levied fro the payment of the principak of and the innberest on the aforesaid bonds shall be deposited in a separate fund to be disignated as the "City of Oxford Municipal bond Fund", and shall be used for the purpose of the payment of the 'principal of and the interest on said bonds anf for no other purpose.

S SECTION 7. That for the purpose of providing for the payment of interest which will accrue on the aforesaid bonds in the amount of Dollars ($ ) on the day of 19.31 which said date si prior to the time when the first taxes to be levied hereunder can be collected, there is hereb appropriated out of any available funds of the said city the sum of Dollars ($ ) which shall be applied to the payment of said in erect.

SECTION p. That the Clerk of said city is hereby authorized and directed to prepare a transcript of all proceedings had in the issuance of the aforesaid bonds and to submit the saietranscript to the State's Bond Attorney, in order that said bonds may be validated as provided under Chapter 10 of the Mississippi Cede of 1930.

SECTION 9. That all ordinances on parts of ordinances in conflict with this ordinance shall be and the same are hereby repealed, to the extent of such conflict.

SECTION 10. That this ordinance shall bi published in the Oxford Eagle, one time immediately after its passage and approval.

SECTION 11. That for good cause and the public interest requiring it, this ordinance shall take effect and be in force from and after its passage and approval. * * * * * * * * * * * * * * * * * * * * * * * * r 78 RECESSED MEETING SEPTEMBER 19, 1938

AN ORDINANCE AUTHORIZING THE ISSUANCE OF NINETEEN THOUSAND DOLLARS ($19,000.00) OF SCHOOL BONDS FOR THE PURPOSE OF CONSTRUCTING AND EQUIPPING A SCHOOL BUILDING.

WHEREAS heretofore, at a meeting held on the 19th day of August, 1938, the Mayor and Board of Aldermen of the City of Oxford, Lafayette County, Mississippi, did adopt a resolution declaring the intention of said Mayor and Board of Aldermen to issue bonds of said city in the amount of Nineteen Thousand Dollars ($19,000.00) for the purpose of erecting and equipping rammer and high school building for said city, and by said resolution said Mayor and Board of Aldermen did declare that said bonds would be issued at a meeting of said Board of Aldermen did declare that said bonds would be issued at a meetin8 of said Board to be held at 7:30 P.M. o'clock PtCon the 16th day of September, 1938, unless twenty per centum (20%) of the qualified electors of said city should file a written protest against the issuance of said bonds on or before said day and hour.

WHEREAS said resolution was spread upon the minutes of said Board in mute Book 10, page 50; and 4' WHEREAS pursuant to said resolution and as required by law, the said resolution was published in the Oxford Eagle, a newspaper published and having a general circulation in said city of Oxford, Mississippi; and maid resolution being so published in said newspaper on the 25th dpy of August 1st, 8th and 15th day of September, 1938, as evidence by the affidavit of the publisher of said newspaper, now on file with the city clerk and now before this Board; and

WHEREAS Twenty per centum (20%) of the qualified electors of said city of Oxford have not tiled a written protest against the issuance of the aforesaid bonds in the amount of Nineteen Thousand ($19,000.00) for the purpose of erecting and equipping a high school and grammar school building for said city, and no protest against the issuance thereof has been filed by any personI and

WHEREAS' the time set by said resolution before which said written protest should be filed has now passed; and

WHEREAS • the said city of Oxford has a population of less than Twelve thousand (12,000) inhabitants, and the amount of bonds proposed to be issued for each of said purposes separately or for both of said purposes together, is not more than t hirty Thousand Dollars ($30,000.00); and

WHEREAS, the assessed valuation of the taxable property within said city, according to the last completed assessment for taxation is One Million, Five Hundred Fifty- four, Seven Hundred Seventy-three Dollars ($1,554,773.00); and

WHEREAS, the bonded indebtedness of said city is the sum of Two Hundred and Twelve Thousand Dollars ($212,000.00); and t WHEREAS the amount of bonds proposed to be issued, when added to the now outstanding bonded indebtedness of said city, does not exceed ten per centum (10%) of the assessed value of the taxable property within said Town according to the last completed assessment for taxation, after the deduction of all bonds or other evidences of indebtedness of said city for water and light purposes and for the construction of special improvements primarily chargeable to the property benefited or for the purpose of paying the City's proportion of any bettemment, a portion of which is primarily chargeable to the property benefited, and does not exceed, When added to all of the outstanding indebtedness, both bonded and floating, of said city, twenty per centum (20%) of the assessed value of all the t xable property within said city; and

WHEREAS, the Mayor and Board of Aldermen are authorized, under the provisions of the Constitution and Statutes of the State of Mississippi, and particularily under the provisions of Chapter 50 of the Mississippi Code of 1930, to issue bonds in the aforesaid amounts for the aforesaid purposes:

• NOW, THEREFORE, BE IT ORDAINED BY THE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD MISSISIPPI, AS FOLLOWS:

SECTION 1. That there are herbby authorized and ordered to be issued bonds of the said city of Oxford, Lafayette County, Mississippi, in the amount of nineteen Thousand Dollars ($19,000.00) said bonds to be of the denomination of One Thousand Doll- are each, to be dated the 1st day of August, 1938, to bear interest at the rate of three and three-fourths per centum (3 3/4%) per annum until the principal of said bonds shall have been fully paid, payable on the 1st day of August, 1939, and annually thereafter, on the 1st day of August in each year. Interest accruing on said bonds on and prior to

RECESSED MEETING SEPTEMBER 19, 1938

the maturity dates thereof, respectively, shall be payable upon presentation and surrender of interest coupons to be attached to said bonds, as said coupons shall severally become due. l'rovided, however, that no interest shall accure on said bonds after their respective maturity dates unless said bonds be presented for payment at maturity and be not then paid. Both the principal and the interest on said bonds shall be payable in lawful money of the United States of America at the City Treasury in the City of Oxford, State of Mississippi. Said bonds shall be numbered from One (1) to Nineteen (19), inclusive, aggregating Nineteen Thousand Dollars and shall be used for the erection and equipment of a grammar school and High School. Building for said city. And the said bonds shall mature, without option of prior payment, at the times and in the amounts hereinafter set forth, as follows:

BOND NUMBER AMOUNT MATURITY

1 41,000.00 August 1, 1939 2 01,000.00 August 1, 1940 3 $1,000.00 August 1, 1941 4 $1,000.00 August 1, 1942 $1,000.00 August 1, 1943 01,000.00 1,ugust 1, 1944 41,000.00 August 1, 194 tS 41,000.00 August 1, 194 Lf-D 9 14,000.00 August 1, 1947 ,:-. 10 41,000.00 August lm 194 c\t 11 01,000.00 August 1, 1949 G.:-. 12 01,000.00 August 1, 1950 -..1 13 41,000.00 August 1i 1951 14 41,000.00 August 1, 1952 $1,000.00 August 1, 1953 2 01,000.00 August lm 1954 $1,000.00 August 1, 195 lg 01,000.00 August 1, 195 19 01,000.00 August 1, 1957

SECTION 2. That said bonds shall be executed by the manual signature of the Mayor of said city of Oxford, countersigned by the Clerk thereof, under the seal of the city and the interest coupons to be attached to each bond shall bear the fac-simile signatures of said officer.

SECTION 3. That the said bonds and the interest coupons to be attached thereto, and the certificates of registration and validaition to be endorsed thereon, and shall be in substantially the fialowing form, to-wit:

UNITED STATES OF AMERICA STATE OF MISSISSIPPI COUNTY OF LAFAYETTE CITY OF OXFORD

-33/4%

SCHOOL BUILDING EQUIPPING AND CONSTRUCTION BONDS

No. $1,000.00

The city of Oxford, a municipal corporation in the County of Lafayette, State of Mississippi, for value received, acknowledges itself to be indebted and promises to pay to bearer the sum of cr ONE THOUSAND DOLLARS

(01,000.00) on the 1st day of August, 19 , with interest thereon from the date hereof and until this bond shall have been paid, at the rate of three and three- rourths per centum (3 3/49) per annum, payable on August 1st, 1939, and annually thereafter on August 1st in each year. Tnterest accruing on this bond on and prior to the maturity date hereof shall be payable upon presentation and surrender of the interest coupons hereto attached as the same become due. 80 RECESSED MEEING SEPTEMBER 19, 1938

Both principal of and interest on this bond are payable in lawful money of the United States of America at the- City Treasury in the City of Oxford, State of Mississippi, and for the prompt payment of this bond at maturity, and the interest thereon as it accrues, the full faith, credit and resources of the city of Oxford are hereby irrevocably pledged.

This bond is one of a series of nineteen (19) bonds, numbered foam One (1) to Nine- teen (19) inclusive, all of like date, tenor and effect, except as to number and date of maturity, aggregating the principal amount and sum of Nineteen Thousand Dollars 019,000,00); being issued for the purpose of erecting and equipping a grammar and high school building for said city, and this bond is issued under and pursuant to the Constitution and Laws of the State of Mississippi, including among others, Chapter 50 of the Mississippi Code of 1930, and pursuant to lawful ordinances and resolutions of the Mayor and Board of Aldermen of said city.

It is hereby certified, recited and declared that all things, conditions and acts required by law to exist, to happen and tok be performed precedent to and in the issuance of this bond in order to make the same a valid and enforceable general obligation of said city do exist, have happened and have been done and performed in due and regular time, form and manner, as required by law; that provision will annually be made for the levy of a tax upon all tastable property in said city sufficient to provide for the payment of this bond and the interest thereon, according to the terms hereof, and that the amount of this bond and the series of which it is one, when added to all other outstanding indebtedness of said city both bonded and floating, does not exceed any constitutional or statutory limitation of indebtedness.

IN TESTIMONY WHEREOF, the city of Oxford, Mississippi, has caused this bond to be signed by its Mayor and countersigned by its Clerk, under the seal of said Town, and has caused the interest coupons hereto annexed to be signed with the fac-simile signatures of said officials, and this bond to be dated the 1st day of August, 1939.

CITY OF OXFORD, MISSISSIPPI

BY Mayor

Countersigned

Clerk

(FORM OF COUPON)

No. *18.75

On the 1st day of August and February, 19 , the City of Oxford, Lafayette County, Mississippi, will pay to bearer Dollars ($ ) in lawful money of the United States of America at the City Treasury in the City of Oxford, State of Mississippi, for interest due that date on its School Building Equipping and Construction Bonds, dated August 1st, 1938, and numbered from One (1) to Nineteen (19) inclusive.

CITY OF OXFORD, MISSISSIPPI

BY Mayor Cpuntersigned:

YY Clerk (FORM OF REGISTRATION. AND VALIDATION CERTIFICATE)

STATE OF MISSISSIPPI) COUNTY OF LAFAYETTE ) ss.

I; W.T. Chandler, Clerk of the City of Oxford, In Lafayette County, Mississippi, do hereby certify that the within bond has been registered in my office in a book kept for that purpose, as provided by law. RECESSED MEETING SEPTEMBER 19, 1938

I do further certify that the within bond has been validated and confirmed by decree of thb Chancery Court of Lafayette County, Mississippi, rendered on the dEk of 1938.

Clerk of the City of Oxford, Mississippi.

SECTION 4. That for the purpose of making prevision for the payment of the principal of and the interest on said bonds as the same shall mature and accrue, there shall be and there is hereby levied a direct continuing annual tax on all the taxable property within said city of Oxford sufficient for said purposes after making due allowance for delinquencies and cost of collection.

SECTION 5. That the proceeds of the sale of said, bonds shall be used for the folloWing specific purposes: . (1) he proceeds of the sale of bonds numbered from One (1) to Ninteeen (19) inclusige shall be used for the purpose of erecting and equipping a grammar school and High School Nuilding for said town of Oxford.

The proceeds arising Nom the sale of said bonds shall be kept separate and distinct, one from the other, and shall be used only for the purposes hereinabove set forth and for no other. C\2

L;-• SECTION 6. That the proceeds of the taxes levied for the payment of the principal of and the interest oh the aforesaid bonds shall be deposited in a separate fund to be designated* as the "City of Oxford Municipal Bond Fund For Erecting and 2-quipping a Grammar School and High School Building" and shall be used for the Purpose of the payment of the principal of and the interest on said bonds and for no other purpose.

SECTION 7. That the purpose of providing for the payment of interest which will accrue on the aforesaid bonds in the amount of Dollars ) on the day of 1039, which said date is prior to the time when the first taxes to be levied hereunder can be collected, there is hereby appropriated out of any available funds of the said city the sum of Dollars ($ ) which hhall be applied to the payment of said interest.

SECTION 81 That the Clerk of said city is hereby authorized and directed to prepare a transcript of all proceedings had in the issuance of the aforesaid bonds and to submit the said transcript to the State's bond Attorney, in order that said bonds may be validated as prbvided under Chapter 10, of the Mississippi Code of 1930;

SECTION 9. That all ordinances or parts of ordinances in conflict with ylaid otdinace shall be and the same are herehi repealed, to the extent of such conflict.

SECTION 10. That this oreinance shall be published in the Oxford Eagle one time immediately after its passage and approval.

SECTION 11. That for good cause and the public interest requiring it, this ordinance shall take effect and be in force from and after its passage and approval. * * * * * * * * * * * * * * * AN ORDINANCE FIXING AND DETERMINING THE MINIMUM WAGE RATES TO BE PAID EMPLOYEES ENGAGED IN WORK ON THE CITY HALL TO BE CONSTRUCTED FROM THE PROCEEDS OF AN OFFER OF THE UNITED STATES OF AMERICA.,

WHEREAS, by a certain offer dated June 24, 1938, the United States of America proposes to aid in financing the construction of a City Hall by making a grant to City Of Oxford, Aoissisippi, in the maximum sum of $13,909.00; and,

WHEREAS, it is the desire of this Board to cause to be paid equal to not less than the prevailing minimum hourly wage rates for each trade and occupation engaged in such construction; and

WHEREAS, after due infestigation as to such wages prevailing for work of similar nature in the locality in which the construction of City Hall is to be constructed, it has been found and determined that such wages are is hereinafter completely setout: ,IWIT•11■11.1•MMIN

82 RECESSED MEETING SEPTEMBER 19, 1938

NOW, THEREFORE, BE IT ORDAINED BY THE BOARD OF MAYOR AND ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI, AS FOLLOWS:

SECTION 1. It is hereby found, fixed and determined that the prevailing minimum hourly wage rates for each trade and occupation in the locality in which the construction of the cit hall described in the preamble hereof are to be constructed ;-1- artlas follows for such listed grades and occupations: PREDETERMINED MINIMUM WAGE SCALE

OCCUPATION HOURLY OCCUPATION HOURLY RATE RATE

Carpenter .65 Concrete Rubber .30 Electrical .65 Reinforcing Rodmen Concrete Finisher •75 Sheet Metal Worker • 5 Marble and Tile Roofer .65 Setters Truck Driver Terrozzo Finisher (1* Ton & Under) .35 Plumber 1.10 Truck Driver Welder .g5 (Over Ton) .4o Bricklayer . o Team Driver .30 Pipe Layer-Water .40 Floor Finisher .bo Pipe Layer-Sewer .4D Apprentices & Painter Helpers to all Iron Worker .b5 trades not otherwise Plasterer .65 given .40 Lather .65 Mortar Mixer .35 Steam Fitter 1.10 Concrete Mixr. Opr. .40 Tractor .5o Hoist Operator .5o Dumpmen .3o Glazier .5o Caulker .25 All Common Labor .3o Plumber of Steam Fitter Helpers .45 SECTION 2. It is hereby ordered that the minimum hourly wage rates to be paid for the traded and occupations hereinabove set out in connection with the construction of a city hall hereinabove referred to shall be as herein fixed and determined, and that the plans and specifications, and contract documents for such work shall specifically provide for such rates to be the minimum hourly wage rates to be paid employees engaged in such trades and occupations employed in connection with the construction of said City Hall. * * * * * * * * * * * * * * * * * * * *

AN ORDINANCE FIXING AND DETERMINING THE MINIMUM WAGE RATES TO BE PAID EMPLOYEES ENGAGED IN WORK ON THE NEGRO SCHOOL BUILDING TO BE CONSTRUCTED FROM THE PROCEEDS OF AN OFFER OF THE UNITED STATES OF AMERICA.

WHEREAS by a certatn offer dated June 24th, 1938, the United States of America, proposes to Aid in financing the construction of a Negro School Building by making a grant to City of Oxford, Mississippi, in the maximum sum of $20,454.00; and

WHEREAS ] it is the desire of this Board to cause to be paid equal to not less than the prevailing minimum hourly wage rates for each trade and occupation engaged in such construction; and

WHEREAS, after due investigation as to such wages prevailing for work of similar nature in the locality in which the construction of Negro School Build- ing is to be constructed, it has been found and determined that such wages are as hereinafter completely setout:

RECESSED MEETING SEPTEMBER 19, 1938

4 NOW THEREFORE BE IT ORDAINED BY THE BOARD OF MAYOR AND ALDERMEN OF THE CITY'OF OXFORD,'MISSISSIPPI, AS FOLLOWS:

SECTION 1. It is hereby found, fixed and determined that the prevailing minimum hourly wage rates for each trade and occupation in th4 locality in which the construction of the Negro School Building described in the preamble hereof are to be constructed, are as follows for such listed trades and occupation:

PREDERTERMINED MINIMUM WAGE SCALE

OCCUPATION HOURLY OCCUPATION HOURLY RATE RATE

Carpenter .65 •Concrete Rubber .30 Electrical .65 Reinforcing Rodman • Concrete Finisher /75 Sheet metal worker • 5 Marble and Tile Roofer .65 Setters • Truck driver Terrozzo Finisher . Z05 Ton Under) •35 Plumber 1.10 Truck driver Welder (Over liTon) .40 Bricklayer g(5) Team Driver Pipe Layer-Water .4D Floor Finisher .b0 Pipe Layer-Sewer Apprentices & Painter :g05 elpers to all Iron Worker .65 trades not otherwise Plaster .65 given .40 Lather .65 Mortar Mixer .35 Steam Fitter 1.10 Concrete Mixr. Opr. Tractor .50 Hoist Oper4tor .50 Dumpmen .30 Glazier •50 Caulker .25 All common labor .30 Plumber of Steam Fitter Helpers .45 SECTION 2. It is hereby ordered that the minimum hourly wage rates to be paid for the trades and occupations hereinabove set out in connection with the construction of a Negro School Building hereinabove peferred to shall be as herein fixed, and determined, and that the plans and specifications, and contract documents for such work shall specifically provide for such rates to be the minimum hourly wage rates to-be paid employees engaged in such trades and occupations employed in connection with the construction of said Negro School Building. * * * * * * * * * * * * * * * * * * *

A RESOLUTION AMENDING THE ACCEPTANCE BY THE CITY OF OXFORD, MISSISSIPPI, OF THE OFFER, DATED ABRIL 27, 1938, MADE BY THE GOVERNMENT' THROUGH THE PUBLIC WORKS ADMINISTRATION, TO FINANCE THE CONSTRUCTION OF AN ADDITION TO THE GRAMMAR SCHOOL, SAID PROJECT IDENTIFIED AS DOW= NO. MISS. 1219-DS. MISS., BY PURCHASING CERTAIN BONDS FROM THE CITY OF OXFORD AND MAKING A GRANT IN ANA:BOUM-100F *10,636.001

WHEREAS, the City of Oxgord, Mississippi, has determined to sell all of the bonds applicable to this project to purchasers other than the Government and on terms as favorable as those offered by the Government, and

4 WHEREAS the City of Oxford, Mississippi, has accepted an offer made by the government•to purchase bonds and make a grant, known ad a Loan and Grant, and ad provided for in P.W.A. Form No. 230, Terms and Conditions, Part 3 t which Form has been made a part of the Offer), relating to'changing from a Loan and Grant to a Grant only, the Administrator for the Public Works Administration shall be notified by the Applicant of the change. 84 RECESSED MEETING SEPTEMBER 19, 1938 NOW, THEREFORE, BE IT RESOLVED by the Board of Mayor and aldermen of the City of Oxford, Mississippi, as follows;

(1) It is hereby determined that all bonds, to provide funds to supplement grant that is to be made by the ,‘Iovernment, for the Construction of an Addition to the Grammar School, will be sold to purchasers other than the Government and on terms as favorable as those offered by the Gtvernment.

(2) the Clerk for the Board of Mayor and Aldermen is hereby authorized and directed to prepare five (5) copies of this resolution and forward to Mr.

H.T. bole , Regional Director, Public Works Administration, 150 hurt Building, Atlanta, Georgia, as formal notice that the City of Oxford, Mississippi, has sold the bonds to other purchasers and wish to accept a Grant only.

* * * * * * * * * * * * *

A RESOLUTION AMENDING THE ACCEPTANCE BY THE CITY OF OXFORD, MISSISSIPPI, THROUGH THE OUBLIC WORKS'ADMINISTRATION, TO FINANCE THE CONSTRUCTION OF A NEGRO ELEMENTARY AND HIGH SCHOOL? SAID PROJECT IDENTIFIED AS DOCKET NO. MISS. 1245-F, BY PURR CHASING CERTAIN BONDS FROM THE CITY OF OXFORD AND MAKING A GRANT IN AN AMOUNT OF $20, 454.0D.

WHEREAS, the City of Oxford, Mississippi, has determined to sell all of the bonds applicable to this project to purchasers other than the Government and on terms as favorable as those offered by the Government, and

WHEREAS, the City of Oxford, Mississippi, has accepted an offer made by the Government to purchase boild and make a grant, known as a Loan and Grant, and as provided for in P.W.A. Form No. 230, Terma and Conditions, Part 2 (which Form has been made a part of the Offer) relating to changing from a Loan and Grant to a Grant only, the Administrator for the Public Works Administration shall be notified by the Applicant of the ch ange.

Mae THEREFORE, BE IT RESOLVED BY the Board of Mayor and Aldermen of the City of Oxford, Mississippi, as follows;

(1) It is hereby determined that all bonds,.to provide funds to supplement grant that is to be made by the Government, for the construction of a Negro Ele- mentary and high School, will be sold to purchasers other'than the Government and on terms as favorable as those offered by the Government.

(2)The Clerk for the Board of Mayor and Aldermen is hereby authorised and directed to prepare five (5) copies of this resolution and forward to mr; -H.T. Cole Regional Director, Public Works Administration, 150 Hurt Building, Atlanta, Georgia, as formal notice that the City of Oxford, Mississippi, has sold the bonds to other purchasers and wish to accept a Grant only. * * * * * * * * * * * * * * * * * * r * * *

A RESO ION AMENDING THE ACCEPTANCE BY THE CITY OF OXFORD, MISSISSIPPI, OF THE OFFER, DATED 1; MADE BY THE GOVERNMENT, THROUGH THE PUBLIC WORKS ADMINISTRATION, TO FI THE CONSTRUCTION OF A CITY HALL, SAID PROJECT IDENTIFIED AS DOCKET NO. MISS. 1220-F, BY PURCHASING CERTAIN BONDS FROM THE CITY OF OXFORD AND MAKING A GRANT IN AN AMOUNT OF $ 13,909.00.

WHEREAS the City of Oxford, Mississippi, has accepted an offer made by the Government to pArchase bonds and make a grant, known as a Loan and Grant, and as provided for in Form, No. 230, Terms and Conditions, Part 3 (which Form has been mate a part of the Offer), relating to changing from a loan and Grant to a Grant only, the Administrator for the Public Works Administration shall be notified by the Applicant of the change. 85 RECESSED MEETING SEPTEMBER 19, 1938

NOW, THEREFORE, BB IT RESOLVED BY the Board of Mayor and Aldermen of .the City of Oxford, ississippi, as follows;

(1) It is hereby determined that all bonds, to provide funds to supplement grant that is to be made by the govimment, for the construction of a City Hall, will be sold to purchasers other than the Government and on terms favorable as those offered by the Government.

(2) The Clerk for the Board of Mayor and Aldermen is hereby authorized and directed to prepart five (5) copies of this resolution and forward to Mr. H.T. Cole, Regional Director, Public Works Administration, Hurt Building (150) Atlanta, Georgia, as formal notice that the City of Oxford, Mississippi, has sold the bonds to other purchasers and wish to accept a Grant only.

* * * * * * * * * * * * * * * *

Upon motion duly made and seconded this board does now adjourn sine die.

LZ-24,1111442d:ad.dal . handler, Clerk R.X. Williams, Mayor 86 SPECIAL MEETING SEPTEMBER 26, 1938

NOTICE OF SPECIAL MEETING

TO THE MEMBERS OF THE BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI:

Notice is hereby given that a special meeting of the Board of "iyor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, at the City Hall at 3:00 o'clock P.M., on the 26th day of Spptember, 1938, for the purpose of passing an amending order to an ordinance passed September 19, 193, being an ordinance for the purpose of "Authorizing The Issuance of $13,000.00 of Municipal ''onds For the Purpose of eonstructing and equipping an ad iton to the present Grammer Schoo. Building", said amendment being for . the purpose of making mete certain the dates of interest payments;, also, for the purpose of amending said ordinance so as to strike out the provision author- izddg the validation of said bonds under Chapter 10, Laws of Mississippi, 1930; also, for the purpose of amending said ordinance as to the bond indebtedness of the City of Oxford, Mississippi.

'"lso, for the purpose of amending the ordinance authorizing the issuance of 417,000.00 of Municipal bonds for the "Purpose of constructing and Equipping a City Hall", said amendment to be made for the purpose of more specifically fixing the semi-anual interest payment dates; also, for the purpose of arced ring and setting out the present indebtedness of the City of Oxford, Mississippi, also, for the purpose of striking down that clause of said ordinance authorizing the validation of said bonds under Chapter 10, Laws of mississippi, 1930.

"lso, for the purpose of amending the ordinance authorizing the issuance of *19,000.00 of municipal bonds for the "Purpose of Constructing and Equipping a School Building", said amendment to be made for the purpose of more specifically fixing the semi-annual interest payment dates; also, for the purpose of amending and setting out the present indebtedness of the City of Oxford, Mississippi; also, for .the purpose of striking down that clause of said ordinance authorizing the validation of said bonds under Chapter 10, Laws of Mississipi, 1930.

Dated this the 26th day of September, 1938.

R.X. Williams, Mayor.

CONSENT TO MEETING

We, the undersigned members of the Board of Aldermen of the City of Oxford, Mississippi, hereb accept service of the above and foregoing notice's waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and place therein named, and for the purpose therein stated.

"itness bur signatures this the 26th day of September, 1938, forenoon.

T.'. Avent Brnaham Hume 0 .T. Chandler W.L. Kennon C.H. 'coach * * * * * * * * * * * *

SPECIAL MEETING SEPTEMBER 26, 1938

Be it remebered that the mayor and Board of Aldermen met pursuant to the foregoing order of a Special meeting on the 26th day of September, 1938, at 3:00 o'clock P.M., when and where the following were present: R.X. Williams, Mayor, Presiding Branham Hume, Alderman-tlarge T.E. Avant, Alderman Ward 1 W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 0:11. Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * * * *

C.A. Bretton, City Attorney / 7 H.A. Moore, Deputy Clerk V.C. Jones, Marshal

when and Where the following proceedings were had to-wit:

krJ Alderman W.T. Chandler: Offered the following Resolution:

A RESOLUTION AND ORDINANCE AMENDING CERTAIN RESOLUTIONS AND ORDINANCES L7.-+ PASSED ON SEPTEMBER 19, 1938, AUTHORIZING AND ISSUING $17,000,00 OF BONDS OF THE CITY OF OXFORD, MISSISSIPPI, DATED AUGUST 1, 1938 FOR CONSTRUCT- ING AND EQUIPPING A CITY HALL IN SAID CITY: $13,000.00 OF BONDS OF SAID CITY OF OXFORD, DATED JUNE 1, 1938 FOR CONSTRUCTING AND EQUIPPING A GRAMMAR SCHOOL ADDITILN IN SAID CITY: AND $19,000.00 OF'BONDS OF SAID CITY OF OXFORD, DATED AUGUST 1, 1938 FOR ERECTING AND EQUIPPING A HIGH SCHOOL AND GRAMMAR SCHOOL IN SAID CITY. "hereas this Mayor and Board of Aldermen did, by proper Resolution and ordinance passed on September, 193, 1938 authorize the issuance of bonds of the City of Oxford, Mississippi, as follows: $17,000.00 Lof Bonds of the City of Oxford, Mississippi, dated August 1, 1938 for constructing and equipping a city hall in said City. $13,000.00 of Bonds of said City of Oxford, dated June 1, 1938, for constructing and equipping a Grammar School addition in said city. $19,000.00 of Bonds of said City of Oxford, Dated August 1, 1938, for erecting and equipping a High School and Grammar S chool in said City.

whereas, said Resolutions and ordinances in Section 1 thereof failed to set out clearly and definitely that the interest to become due on each issuance and all of the issues of the aforesaid bonds is to be paid semi-annually throughout the life of each of said issues, and WHEREAS, it was the intention of this Board and it is to the best financial interests of the City of txford to make the interest on each of the aforesaid issues of bonds payable semiannually throughout the life of each of said issues, and Whereas, the aforesiad Resolutions and Ordinances of September 19, 1938, in authorizing said issues of bonds did in e ror set out the bonded indebtedness of said City of °xford as being $212,000.00, and Whereas, said erroneous statement should be corrected and set out in further detailm and Whereas, the aforesaid Resolution and Ordinances of September 19, 1938, did authorize and direct the Clerk of this Board to have theaaforesaid issues of bonds validated in Chancery Cout as provided 4 Chapter 10 of the Code of Mississippi for 1930, and Whereas, this Board does not find that, in their present opinion, there will be expense and delay in effecting the validation of said issues of bonds and that said validation should not be undertaken, unless, in the opinion of the Municipal gone Attorneys who are to pass upon the legality af the issuance of said bonds said 88 SPECIAL MEETING SEPTEMBER 26, 1938

validation should become essential to the issuance of said bonds.

NOW THERE ORE BE IT RESOLVED AND ORDAINED BY THE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI:

SECTION 1.

hat those parts of Section 1 of those Resolutions and Ordinances passed by this Board on September 19, 1938, which refer to the time or times of payment of interest on the bonds therein authorized be and they are hereby amended as follows with respect to the time or times of payment of said interest.

lhat the interest to become due and payable on 417,000.00 of bonds of the City of ‘)xford, Aississippi, issued for constructing and equipping a City Hall in said city shall be payable at 3 3/4% per centum per annum, on the first days of Fedruary and August of each year throughout the life of said issue.

That the interest to become due and payable on 413,000.00 of bonds of the City of Oxford, Mississippi, issued for constructing and equipping a Grammar School addition in said city shall be payable at 3 3/4* per centum per annum on the first days of 'lune and December of each year throughout the life of said issue.

That the interest to become due and payable on $19,000.00 of bonds of the City of Oxford, Aississippi, issued for rerecting and equipping a High School and Grammar School in said City, shall be payable at 3 3/4% per centum per annum, on the first days of February and August of each year throught the life of said issue.

That all of the aforesaid bonds shall be and are as to time, form, denomination, amounts and maturities, as set out and provided in those Resolutions and Ordinances of September 19, b538, except that the provision on each bond for a validation certificate shall be and is hereby repealed, and the form of bond is hereby authorized to br amenddd ao as to state in its face that the interest thereon shall be payable semi-annually as provided for each issue in this Section.

SECTION 2. what the total outstanding bonded indebtedness of the City of Oxford, Aississippi, is $229,500.00 exvlusive of the aggregate of $49,000.00 of bonds hereinabove referred to and more particularly described in the resolutions and Ordin- ances passed by this Boatd on September 19, 1938; that the addition of said $49,000. 00 of bonds will make a total outstanding bonded inddbtedness of $278,500.00 which is less than 20% of the present assessed valuation of said City of $1,554,773.00 that there are outstanding $105,900.00 of Water and Light Bonds. $2,000.00 of Street mprovement bonds and $40,500.00 of Street 4 Intersection Bonds of said Ciy of Oxford, m4ing a total deduction from the gross bonded indebtedness as provided by law of $148,400.00 leaving a net bonded indebtedness of $130,100.00 which is less than 10% of the aforesaid assessed valuation.

SECTION 3.

That there is hereby repealed Section 8 of each and every one of t those certain Resolutions and ordinances of thsi Bord passed on September 19, 19381 whereby the Clerk of this Board was authorized rind directed to have the bonds therein authorized validated under Chapter 10 of the Code of "ississippi for 1930. It is further declared however, that if the Municipal Bond Attorneys, who are to pass upon the legality of thelproceedings authorizing said bonds should state in writing that a validation of said issues is essential to the proper and legal issuance of said bonds then the Clerk of this Board be and he is himeb authorized and empowered to prosecute to completion such validation proceedings without the necessity of further action b this Board.

SECTION 4. 'hat all Resolutions and ordinances in conflict herewith be and they are hereby repealed, and those not in conflict herewith be and they are hereby confirmed.

RMOC SPECIAL MEETING SEPTEMBER 26, 1938

I he foregoing Resolution and 'rdinance was reduced to writing and considdred Section by Section and adopted on the following vote:

YEA : All voted "Yea".

NAY: None

Upon motion duly m de and seconded it was ordered that this Board do now adjourn sine die.

W.T. Chandler, Clerk Mayor

L . OXFORD'MISSISSIPPI OCTOBER 4,1938

TUESDAY

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford,Mississippi, met in regular session at the Mayor's office at 7:30 P.M.,TVesday, October 4,1938, it being the time and place for the holding of said meeting, when and where were present the following members:

Mayor R.X.Williams, Presiding

Alderman,Branham Hume, Alderman-at-large

T.E.Avent, Alderman Ward 1

W.T.L;handler, Alderman ,Ward 2

W.L.Kennon,Alderman Ward 3

C.H.Roach,Alderman Ward 4 ********'************************ ******** **********

Lillian Jones,Secretary C.A. Bratton,Attorney V.C.Jones,Marshal

After the business had been opened according to law, the following business was transacted:

Upon motion duly made and seconded it was ordered that the following account be allowed and that warrant be issued accordingly. From the

CORPORATION FUND

167.R.X.Williams,Mayor Sept. salary 1:68000 ft /9 168.Branham Hume,Alderman 10.00 169. T.E.Avent,Alderman n " 10.00 9t 170.W.T.Chandler,Alderman " 10.00 ft I/ 171.W.L.Kennon,Alderman 10.00 172.C.H.Roach,Alderman " " 10.00 173.H. A. Moore " " 50.00 174.V.C.Jones,Marshal " " 125.00 tt It 175. Sam Keel,Night Marshal 100.00 176.R.N.Whitfield,Bandmaster n n 40.00 99 ft 177. C.A.Bratton,Attorney 40.00 170.C.A.Bratton, Fee in Buie Case 100.00 179.Mrs. O.E.Holcomb,Matron Sept. salary 20.00 100.Lillian Jones,Secretary " 40.00 181.0.H.Douglass,Cemetery Upkeep for Sept. 50.00 182.H.A.Moore,T.C. Postage,telephone,etc. 4 3.33 183. E.P.Lowe,Engineer for 25 days 125.00 184.S.E.Spears, 44 loads of sod 6.60 185.L.G.Lynch, Gas for WPA 49.30 186.A.H..Avent, Supplies for rest room 2.00 187.Porter Hardware, supplies 6.43 188. Blue Print Co., Supplies 3.75 189.Hall Blacksmith, Repairs 3.0 190.w.s. Darley and Co., Office files 26.05

(continued) 91

REGULAR MEETING OCTOBM 4,1938

CORPORATION FUND (continued)

191.F.W.Belk, Rep. to WPA truck $ 3.00 192.T.E.Avent Drug store, supplies 2.75 193.Commercial Print Shop, ballots 4.50 194.0xford Repair Works, Rep. to typewriter 1.00 195.Elliott Lumber Co., supplies 45.41 19 .Lawrence Printing Co. 2.01 197.Walter D. Pettis, Surveying for Sept. 95,00 190.I.A.Mart'n,Jr. Supplies 6.73 199. Oxford Eagle, Tax sale 11.60 200.Patton-Courtney Hdw. Co.,Supplies 15.56 201.J.L.Neilson,Supplies 1.53 202.Hughes Hardware Co, supplies 5.11 203.Hederman Brothers, Supplies 50.21 204.C.G. Bolin,Record of deed in Buie est. 2.05 205.Phil Carnathan, Holding election Sept. 30 Total $1663.62

ISD STREET FUND .... - C3 206.S.E.Spears,Foreman Sept. salary $ 100.00 207.H.A.Mbore,T.C., Labor tickets,etc. 373.82 Q 72.50 .

233.G.S.byers, Janitor for Sept. 60.00 234. 0.1).Smith, Pro rata share of Sept. salary 24.00 235.H.A.Moore,T. 0 .,Telephone,etc. 24.27 236.S.C.Toof,Supplies, 51.83 237.Hughes Hardware, supplies 9.99 23 .Porter Hardware, Supplies 10.07 239.Elliott Lumber Co., Supplies 50.24 240.J.B.!toach,Push switches 4.00 241.Patton-Courtney Hdw. 0o.,Supplies 7.73 242.0xford Repair Works, cutting stencil for sign 3.00 243.Fred Medart Manuf. Co.,Supplies 2.11 ?4ij.Beckley-Cardy Co.,Supplies 3.41 245.A.C.McC3Arg and Co.,Supplies 9.o8 24o.Pittsburg Plate Glass Co.,Supplies 32.29 REGULAR MEETING OCTOBER 4,1938 SCHOOL FUND (continued)

247.G.H.Thorne,Rep. to typewriter $ 6.50 248.Educational Supply Co.,Supplies 2 .43 249.American Badge Co.,Supplies 10.00 250.Avent Drug Store, Supplies 1.35 252.Southern Disinfectant Co., Supplies 6.15 253.R.H.Gillespie, Supplies 1.12 254. I.A.Martin,Jr. 2.90 255.Robert Torrey, Ins. on school bldg. and fixt. 210.00 25o.Silner Burdett Co.,Supplies 2 .6 Total $55 LIGHT AND WATER FUND

257.C.E.Harrison,Supt. Sept. salary $ 245.00 258.G.W.Johnson,Engr. " " 115.00 259.A.L.Mullins,Eng. " " 115.00 2b0.Louis Campbell,Eng. " " 105.00 261. R.H."inter,Lineman " " 105.00 262.H.A.Moore " " 50.00 It 263. Lillian Jones,Secretary " 40.00 264. T.A.Dunn, Rent for Sept. 50.00 265.Mrs. Lillie Yates, Rent for Sept. 10.00 26b.H.A.Moore,T.C. Labor tickets,freight 818.92 267. Tennessee Valley Elec. Co., Supplies 118.51 268.444 Service Station .25 269.Hall Blacksmith, Rep. to meter .25 270.Mueller Co.,Supplies , 40.07 271.Westinghouse (U26401-U26252-A61673),Supplies 20.67 272.W.S.Dickey Clay Manf.Co.,Supplies 115.81 273.F.W.Belk Garage,Rep. to truck 1.65 274.Porter Hardware Co.,Supplies 17.64 275.Texas Company, oil 281.21 276.Haney Chevrolet Co.,Supplies 4.35 277.Hughes Hardware Co.,Supplies 26.15 278.Cabell Electric Co.,Supplies 129.55 279.L..Lynch,Gas 7.43 280.Texaco Service Sta.,Labor and grease 1.25 281.Elliott Lumber Co.,Supplies 3.90 282.Blue Star Service, one ice book 3 .o6 283.J.E.Dilworth Co.,Supplies , 6.97 284.Arkansas Fuel Oil Co.,fuel oil 070.51 285.Patton-Courtney Co.,Supplies 16.26 286.Duncan Electric Manf. Co.,Supplies 200.86 287.General Electric Supply Co.,Supplies 41 .72 288.Gould Pump,Supplies 6.16 289.N.O.Nelson Co.,Supplies 7.28 290.Wood Preserving Corp.,poles 104.12 291.Lighting xixture and Electric Supply Co.,Supplies- 5.62 292.Graybor, supplies 1 1.11 $3 3 .2

CURB AND GUTTER FUND

293.0xford Eagle, Filmore ad and notice $ 52.99 REGULAR MEETING OCTOBER 4,1938

State of Mississippi County of Lafayette

For and in consideration of the sum of One Dollar (1.00), cash in hand paid, receipt of which is hereby acknowledged, the City of Oxford, in Lafayette County, Mississippi, by R.X.Williams, Mayor of said City, and W.T.Chandler, Clerk of said City, does hereby grant, bargain, sell and convey to Branham Hume the following described land, situated in the City of Oxford, Lafayette County, Mississippi, to-wit:

That part of Section 28, Township8, Range 3, West, described as beginning on the South line of Filmore Avenue at the Northeast corner of Lot No.47 and run thence South along the East line of said Lot No.47 a distance of 210 feet, thence East at a right angle a distance of 30 feet to the West line of Lot No,40, thence North along the West line of said Lot No.40 a distance of 210 feet to the Northwest corner of said Lot No.40, this point being on the South line of Filmore Avenue, thence West, along the South line of said Filmore Avenue, a distance of 30 feet to the point of beginning, the land herein conveyed being a part of an unused street separating Lot No.47 from Lot No.40, and being so known and designated on the official map of the City of Oxford, Mississippi, now on file in the office of the Mayor of said City, a copy of said map being also on file in the office of the Chancery Clerk of said County.

As a part of the consideration for this conveyance it is understood and agreed that the grantee herein, Branham Hume or his assigns, will assume and pay all taxes to be assessed on the said land herein conveyed.

It is further agreed and understood that this conveyance corrects any errors that may have been in that deed to a portion of the said lend described above dated November 2, 1932, authorized by the Mayor and Board of Aldermen of said City, at their regular meeting on November 1,,.1932, a copy of said deed being recorded in the office of the Chancery Clerk of said County in Deed Book 105, on Page 148.

* * * * * * * * * * * * * * * * * * * * * * * * *

STATE OF MISSISSIPPI COUNTY OF LAFAYETTE

For and in consideration of the sum of One Boller ($1,00), cash in hand paid, receipt of which is hereby acknowledged, the city of Oxford, in Lafayette County, Mississippi, by A . 4% Williams, Mayor of said City, and W.T. Chandler, Clerk of said City, does hereby grant, bargain, sell and convey to Mrs. Julia Logan the following described land situated in the City of Oxford, Lafayette County, "ississippi, to-wit:

That part of Section 28, Township 8, Range 3, described as beginning on the north line of Pierce Avenue at the southeast corner of Lot No. 4 and running north 105 feet along the east line of Lot No. 4 thence east 30 feet to the west line of Lot No. 18, thence south 105 feet along the west line of ieot No. 18, to the north line of fierce Avenue thence west along the north line of Pierce Avenue 30 feet to the southeast corner of Lot No. 4, to the point of beginning. The land herein conveyed being a part of an unused street separating Lot No. 4 from Lot No. 18.

As a part of the consideration for this conveyance it is understood and agreed that the grantee herein, Mrs. Tulia Logan or her assigns, will assume and pay all taxes to be assessed on the said land herein conveyed. * * * * * * *7* * * * * * * * * * * r 94 OCFORD, MISSISSIPPI OCTOBER 4, 1938

Upon motion duly made and seconded, it was ordered upon a plea from David W. 'mallwood, attorney for Lee Cook, to refund $2.00 amount paid on fine erroneous- ly, be not granted and that the amount would not be refunded.

* * * * * * * * * * * * *

Upon a motion made by Branham hume and seconded by by T.E. Avent, it was ordered that the city put on the rat campaign, de'cohdueted by the Mississippi State Plant Board and the U. °. '°ureau of Biological Survey. The clerk was ordered to notify .'obert B. Peen, IJistrict Agent, about same. All voted "yea" except Chandler who voted "Nay". *B** * * * * * * * * *

Upon motion made and seconded , :that the-Oxford:Athletic Association pay one half of all bills due up until October 1st, 1938, and that the rate for the said Association be 3q' per Kkh flat rate thereafter. Those voting "yea" were Branham 'lime, Avent, W.L. Kennon and C.H. "oach, Those voting "nay" were W.T. Chandler. * * * * * * * * * *

Upon motion made and seconded, it was ordered that the following notice be printed in the Oxford Eagle for one issue.

NOTICE TO TAX PAYERS OF CITY OF OXFORD

You will take notice the Board of 44tyor and Aldermen of the City of Oxford, Mississippi, will meetiat in special session Thursday, October 13th, 1938, at 7:30 o'clock P.M., to equlize the assessment of all property in the City of Oxford, Mississippi; also, for the purpose of granting homestead exemption as providdd under house Bill No. 2, Extraordinayr Session 1938, and will be in session from day to day for said purposes until all business has been disposed of. * * * * * * * * * * * * Oxford, Miss. October 4, 1938

STATE OF MISSISSIPPI LAFAYETTE COUNTY? .

For and in consideration of the sum of One Dollar, cash in hand paid, th3 receipt of which is hereby acknowledged. The city of Oxford, of Oxford '"ississippi, by its Mayor, R.X. conveys and quitclaims to Mr. and Mrs. O.H. Little (0.B4 Little and wife, Mrs. O.H. Little) that certain lot pr parcel of land, situated in the City of Oxford in Section 28, Township 8 south, range 3 west, in the County of Lafayette, in the State of Mississippi, and being particularly described as follows, to-wit:

That certain parcel of land that is shown to be a part of a platted Street on the map of slid City of Oxford, copies of which are on file in the office of the Mayor of said City of Otford and in the office of the clerk of the Chancery Court of said Cotirty of Lafayette, the parcel herein conveyed being further described as beginning at the Northwest corner of Lot No. 43 in said Section 28, and run thence south along the west line of said Lot a distance of 140 feet; thence west approximately 151 feet parallel with the North line of said Lot No. 43 to a certain line fence now located on said street; thence North 140 feet to the South line of Lincoln Avenue following said fence; thence East along the south line of Lincoln Avenue a distance of approximately 15 1 feet to the point Cq of beginning.

Igt This conveyance is made pursuant to an order of the Mayor and Board of Aldermen enterA on October 4, 1938, at their regular October meeting, said order being entered in Minute book No. 10 at :ese, 95 of the Minutes of said Board.

* * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board now reces until Thursday, October 13, 1938 at 7:30 P.M. o'clock.

L •••• Oxford, Mississsippi OCTOBER 13, 1938

RECESSED MEETING

The Mayor and Board of Aldermen of the City of Oxgord met pursuant to the foregoing Recess order of October 4th, 1938, at 7:30 o'clock P.M., when and where the following were present:

Mayor R.X. Williams Presiding

Branham Hume, Alderman-at-large

T.E. Avent, Aldermen Ward 1

W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H. roach, Alderman Ward 4 * * * * * * * * * * * * * * * *

Bratton, City Attorney V.C. Jones, City ti:rs.al Lillian Jones,

After the meeting had been opened according to law the following business was had to-wit:

(bon motion duly made by Branham Hume and seconded by C.H. Roach, it was ordered that a light be constructed to the residence of H.W. Alvis and W. 4. McLarty provided the mentioned parties make a deposit to the City of Oxford of the sum of $50.00 each before the line is constructed and this amount may be assumed b the mentioned parties in electricity. The above motion was adopted. * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess until 3 o'clock P.M. on Friday, October 14th, 19381 86 Oxford,Mississippi October 14,1938

RECESSED MEETING

The Mayor and Board of Aldermen of the City of Oxford met pursuant to the foregoing Recess order of October 13,1938, at 3:00 o'clock P.M., when Old where the following were present:

Mayor R.X.Williams Presiding

Branham Hume, Alderman-at-large

T.E.Avent, Alderman Ward 1 W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H.Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * *

C.A.Bratton,City Attorney V.C. Jones, City Marshal Lillian Jones, Secretary

After the meeting had been opened according to law the following business was had to-wit:

A RESOLUTION ORDERING THE FILING OF BIDS

WHEREAS, pursuant to advertisements, bids for the construction of a Negro Elementary and Grammar School Building, have been filed by the following bidders:

Currie and Corley, Reighly, Miss.

Walter L. Perry Construction Co., Philadelphia, Miss.

Tom B. Scott, Jackson, Miss.

Flint and Jordan Construction Co.,Jackson,Miss.

I.C. Garber & Son, Jackson, Miss.

Newton and Schmoll, Hattiesburg, Miss.

That said bids have been duly received, opened and publicly read;

NOW, THEREFORE, BE IT RESOLVED that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, Consulting Architect, and that the said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliest practicable moment, report to this Board of Mayor and Alderman, his findings as to the lowest and best bid.

The above resolution was this day passed and aopted.

* * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess until 7:30 o'clock P.M. on Friday, October 14th,1938. 10 0

Oxford,Mississippi October 14, 1938

RECESSED MEETING

The Mayor and Board of Aldermen of the City of Oxford met pursuant to the foregoing Recess order of October 14th, 1938, at 7:30 o'clock P.M., when and where the following were present:

Mayor R. h. Williams Presiding

Branham Hume, Alderman-at-large

Avent, Alderman Ward 1 W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H. Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * *

C.A. Bratton, City Attorney V.C. Jones, City Marshal

After the meeting had been opened according to law the following business was had to-wit:

A RESOLUTION DECLARING THE INTENTION OF THE BOARD OF MAYOR AND ALDERMEN OF THE CITY OF TIFORD,MIcSISSIPPI,TO BORROW ONE THOUSAND THREE HUNEREE AND THIRTY-FIVE ($1,335.00) DOLLARS WITH WHICH TO PAY THE STREET IMPROVEMENT ON FILMOPE AVENUE, AND ONE THOUSAND SEVEN HUNERET AND THIRTY-FIVE ($1,735.00) DOLLARS WITH WHICH TO PAY TEACHER's SALARIES FOR THE CITY OF OXFORD FOR THE MONTE OF SEPTEMBFR,1938.

WHEPEAS, it appears to the Board of Mayor and Aldermen of the City of Oxford, Mississippi, that certain street improvements has been done on Filmore Avenue in the City of Oxford, Mississippi; and,

WHT'FEAS, it further appears that the cwrk has been done in accordance with the plans and specifications now on file; and,

WHEREAS, if further appears that the contractors have not been paid for said work and that the funds are not available for the payment of same; and,

WHEREAS, it further appears that the City of Oiford, Mississippi, will be due the teachers in the public schools of said City the sum of One thousand seven hundred and thirty-five ($1,735.00) Dollars for services performed during the month of September, 1938, and that the funds for payment of same are not now available and that it will be necessary to borrow the sum of Three Thousand and Seventy ($3,070.00) Dollars to pay for the street improvements on Filmore Avenue and the salaries of teachers:

THEREFORE, BE IT ORDAINED BY THE BOARD OF MAYOR AND ALDERNEN:

Ser'tionl. That the Aayor and City Clerk be and are hereby authorized to borrow not exceeding *3,070.00 on short term notes and in anticipation of taxes pledging the face, credit and revenue of city for said sum. Section2. That the Mayor be and is hereby authorized to give notice in the Oxford Eagle, a newspaper published in said City and having a general circulation therein of the intention of said Board to borrow said funds at a rate of interest not to exceed six percent. Section 3. The public necessity requiring it that the ordinance take effect from and after its adoption.

The above resolution having been first read was adopted section by section, and then as a whole. Those voting yea ri.T. 0);Ad1er

C.H. Roach W.L. Kennon Branham Hume

T.E avant . Those voting nay None Oxford, Mississippi October 14, 1938

On motion of Alderman Branham Hume and seconded by Alderman W.L. Kennon, 4 .M. "inkier and J.K. Summerfield, Auditors of Tupelo, Mississippi, were employed to make a budget for the balance of the year of 1938, and install a system of accounts for the city.

to assist in putting the tag roll in shape for the State Tax Commission at and for the salary of $300.00.

The above motion was adopted and carried. * * * * * * * * * * * * * * * *

Whereas, it appears that the IJayor and Board of Aldermen fixed the salary of. V.O. Jones, City Marshal of $125.00 and the salary of Sam Keel, Night watchman of $100.00 as shown by the minutes of said board, Minute book 10, page and

WHEREAS, it appears to said Board from the authority cf Section 2538, (7.1 Code 1938, this said board acted in accordance to law;

It is therefore ordered by the Board that the clerk be, and is hereby directed #o i3ay said Marshal and Night watchman only the sum of $125.00 and $100.00 respect- gully, per month.

This above resolution having been first reduced to writing was read and approved in a regular recessed session. Those voting "nay" were W.L. Kennon, C.H. Roch, W.T. Chandler, Branham hume and T.B. Avent. ihose voting "nay". none.

* * * * * * * * * *

The foregoing ordinances were read and adOpted, Section by Section and then as a whole, all members boting "aye" and none voting "nay". Upon motion duly made and seconded, it was ordered that this Board do now recess until October 17th, at 7:30 P.M.

Oxford,Mississippi October 17,1938

RECESSED PEETING

The Mayor and Board of Aldermen of the City of Oxford met pursuant to the foregoing Recess order of October 14th,1938, at 7:30 o'clock P.M.,when and where the following were present:

Mayor R.X.Williams Presiding

Branham Hume, Alderman-at-large

T.E.Avent, Alderman Ward 1 W. T. Chandler, Alderman Ward 2 W.L.Kennon, Alderman Ward 3 C.H.Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * *

C.A.Bratton,City Attorney V.C. Jones, City Marshal

After the meting had been opened according to law the following business was had to-wit:

AN ORDINANCE PRESCRIBING THE FOP OF THE LAND ASSESSMENT ROLL OF THE CITY OF OXFORL,MISSISSIPPI

SECTION I

Be it ordained by the Board of Mayor and Aldermen of the City of Oxford, Mississippi, that the land assessment roll of said city shall consist of a sheet of paper approximately 22 inches by 18 inches, which shall contain in the first column to the left the Number of Tax Receipts for the Years 1938 and 1939. In the next column to the right, Name of the Owner. In the next column to the right, Division of Section or Lot Numbers. The next column. Block Numbers. The next column to the right, Survey, Sub-division or Addition. In the next column to the right Total assessed Value of Land, Building or Other Interests. The next column to the right Deduct Exemption Asse sed Value of Homes. The next column to the right, Value of Leases, Permits, Reserv a tions, or Other Interests Owned Separately from the Surface Ownership. The next column tc the right, Value of Land. The next column to the right, Value of Buildings and Improvements. The next column which contains the Homestead Exemption, which shall express the number of homes exempted, value of land exempted, value of buildings and improvements exempted. Which said form follows as near as'possible the form used by counties for the assessment of municipal and is in accordance with Section 6, House Bill No.3 of Extra-ordinary Legislative Session 1938.

SECTION II

The public necessity requiring it this ordinance shall become inforce and effective from and after its passage.

The above ordinance having been first read was adopted section by section and then adopted as a whole.

Those voting yea IF.(24....At Lib

Those voting nay 1

Upon motion duly made and seconded it was ordered that this Board do now recess until 7;30 o'clock P.M. on Wednesday, October 19,1938. 10 OXFORD, MISSISSIPPI OCTOBER 19, b938

RECESSED MEETING

The Mayor and Boatd of Aldermen of the City of Oxford met pursuant to the foregoing Recess order of October 17th, 1938, at 7:30 P.M., when and where were present the following:

Mayor R.X. "Miens, Presiding w1.T. Chandler, Alderman, Nerd 2 T.L. Avent, Alderman, Ward 1 W.L. Kennon, Alderman, Ward 4 1—L Bkanham Hume, Alderman at large. * * * * * * * * * * * * * * * * * * * * * * * * *

LilliamIonesegretary

After the meeting had been opened according to law the following business was transacted: WHEREAS, it appears to the Board of Mayor and Aldermen of the City of Oxford, Mississippi, that the City has oboigations due and payable on the 1st day of Uctober, 1938, in the sum of *2000.00; and eN3 WHEREAS, it further appears that said money can be repaid within three .c.r! months, from this date and not before and therefore, it will be necessary to bnprow said sum for said period of time.

NOW4,therefore, be it resolved by the Board of Mayor and Aldermen in recessed session assembled that the Mayor R.X. "illiams, and the city Clerk Chandler, be and are hereby authorized, empowered and directed to bvvvow said sum, pledging the full faith and credit of the city of Oxford for repayment Of same, according to the tenure and effect of the note executed therefor.

The said resolution having been first produced in writing was read and adopted, Those voting "yea" were W.T. Chandler, T.E. Avent, W.L. Kennon and Branham Hume. Those voting "nay" were: None/

ordered in recess session on this the 19th day of Ccrober, 1938. * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, it wad ordered that this Board do now adjourn until October 20, 1938, at 7:30 P.M. 104 OXFORD? MISSISSIPPI RECESSED MEETING

OCTOBER 20, 1938

The ''ilayor and Board of Aldermen of the City of Oxford, met pursuant to the foregoing recess order of October 19, 1938, when and where the following were present:

Mayor R.X. Williams, Presiding Avent, Alder:: an Ward 1 Branham Hume, Alderman at!large W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H. poach, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * *

C.A. Bratton, Attorney

After the meeting has been opened according to law the following business was had to-wit:

tteee-0,-- Upon motion duly made and seconded, it was ordered t4tt this Board do now - tagurn until October 21st, at 3 o'clock P.M., 1938.

OXFORD, MISSISSIPPI OCTOBER 21, 1938

RECESSED MEETING.

The Mayor and Board of Aldermen of the City of Oxford, met pursuant to the following recess order of October 20, 1938, when and where were present the

following . :

Mayor R.A. "illiams, Presiding Branham Hume, Alderman at large T.E. Avent, Alderman Ward 1 W. 1 . Chandler, "lderman Ward 2 W.L. Kennon, Alderman Ward 3 C.H. hoach, Alderman Ward 4 * * * * * * * * * * * ** * * * * * *

Lillian Jones, Secretary

After the meeting had been opened according to lhw the following business was transacted to-wit:

1..r) RESOLUTION AWARDING CONTRACT

Whereas, James T. Canizaro, Consulting Architect, pursuant to a Resolution heretofore adopted, has tabulated and considered all bids heretofore receibed for the construction of a Negro Llementary and high School Building and has duly made his recommendations to this Board of Mayor and Aldermen, and it appearing from said recommendations and report that Flint and ' J ordon is the lowest and best bidder for the construction of the Negro Elementary and 'sigh School Building, in the sum of $39,815.00; and that this Board of Mayor and Aldermen, after considering said report and recommendations and all bids heretofore, filed finds that the bid of Flint and Jordon is the lowest and best bid;

NOW, THEREFORE, BE IT RESOLVED BY THE BOARD OF MAYOR AND ALDERMEN AS FOLLOWS:

SECTION 1: that the bid of Flint and Jordon, for the construction of a Negro Elementary and 'sigh School Byilding, in the sum of 039,815.00 is hereby accepted, determined and deblared to be the lowest and best bide and that a contract for the construction of said work as heretofore prescribed by the plans, specifications an d contract documents, shall be forthwith executed for said construction.

* * * * * * * * * * * * * * * * *

There being no further business, it was ordered that this Board do now recess until Monday, October 24, 1938 at 7:30 P.M. 106

RECESSED MEETING OCTOBER 24, 1938

The 'layor end Board of Aldermen of the City of Oxford, met pursuant to the foregoing recess ordde of October 12, 1938, when and thwer the following were present;

Mayor R.X. Williams, 1-residing

T.E. Avent, Alderman Ward 1

W.T. Chandler, Alderman Ward 2

W.L. Kennon, Alderman Ward 3 t, .H. Roach, Alderman Ward 4 Branham Hume, Alderman at large * * * * * * * * * *

H.A. Moore, Deputy Clerk

After the meeting has been opened according to law the following business was had to-wit:

Upon motion duly made and seconded, it was ordered that this Board do now adjourn until 7:30 o'clock P.M. October 25, 1938. RECESSED MEETING OCTOBER 25, 1938

OXFORD, MISSISSIPPI

the Mayor and Board of Aldermen of the City of Oxford, met pursuant to the foregoing recess order of October 24, 1938, at 7:30 P.M. when and where were present the following:

Mayyor h.X. Presiding

T.E. Avent, Alderman, Ward 1

W.T. Chandler, Alderman Ward 2 W.L. Kennon, Alderman Ward 3 * * * * * * * * * * * *

H.A. Moore, Deputy Clerk C.A. Bratton, City Attorney

After the meeting had been opened according to law the following business was had to-wit:

,e11.

Upon motion duly made and seconded, it was orddred that this Board do now recess until 7:30 P. 14., October 26, 1938. 108 OCTOBER'26, 1938 RECESSED MEETING

The Mayor and Board of Alddrmen of the City of Oxford, met pursuant to the fotegoing recess order of October 26, 1938, when and where the following were present:

R.A. Williams, Mayor, Presiding

T.E. Avent, Alderman Ward 1

W.L. Aennon, Alderman, Ward 3

C.H. Roach, Alderman, Ward 4

Branham Eume, 1,-Iderman at large

H.t. Moore, Deputy Clerk

After the meeting had been opened. according to law the following business was had to-wit:

Al RESOLUTION APPROVING AND ADOPTING THE SPECIFICATIONS AND CONTRACT DOCUMENT AND THE ADVERTISEMENT OF BIDS FOR THE FURNITURE AND EZIPP- MENT CF THE ADDITION TO TEE GRA:1,1AR SCHOOL, DOCKET NO. MISS. 1219-DS

WHEREAS detail specifictions and contract documents of the furniture and equippment for the addition to the grammar school building PWA rroject Docket Mies. 1219-D', has been presented by James T. Canizaro; and,

WHEREAS . the Mayor and Board of Alddrmen of the City of Oxford has fully considered said specifications and contract documents and find that it is for the best interest for the city of Oxford, Mississippi, to furnish and equpp the said building as therein provided.

NOW • 'THEREFORE BE IT RESOLVED BY TEE BOARD CF MAYOR AND ALDERMEN OF TEE SIT OF OXFORD, MISSISSIPPI, AS FOLLOWS:

SECTION 1. That the specifications and contract documents referred to in the preamble hereof for the furnishing and equipping said building be and same are hereby, in all respects, approved and adopted as the official specifications and contract documents. to be used in connection with the presecution. of the work in such equppment. hat for the purpose of identifications, there shall be endorsed on one set of specifications and contract documents by W.T. Chandler, Clerk, the following:

Duly adopted by the resolution of Board of Mayor and Aldermen on the 26th day of "ctoher, 1938.

A RESOLUTION EXTENDING THE T14E ON THE ADDITION TO GEE GRA:L1AR SCHOOL DOCKET MISSISSIPPI 1219-DS

WEEREAS it appears that the City of Oxford made aeplication to the -Public Works Administration Authorities for a grant for the construction of the Addition to the Grammar Schbid and Equipping same for the City of Oxford, Lafayette County, Mississippi.

WHEREAS it appears that this project was aiiroved and a grant made and the building noun under construction and that the date of completion is December 1st, 1928, and

WHEREAS ti appears that on account of the plans and specificatithns on the furnitue and equippment for said project has just been approved b: the PWA authorities and that the law of 'flississippi requires three weeks for the adver- tisemtnt for bids (bids to be taken on "ovember 18th, 1938) and because the necessity of selecting sufficient amount of furniture by samples of vzrious coma genies and

THEREFORE, be it resolved by the Board of Mayor and Aldermen that an extension Of time to December 15th, for the completion fo all work is hereby requested by the Federal emergency Administration of Public VYorks. 109

RECESSED MEETING OCTOBER 26, 1938

The above rexolution was this day offered and adopted by the Board of Mayor and Aldermen in Recessed Session conved on this the 26th day of Oc- tober, 1938. * * * * * * * * * * *

Upon motion dulu made and seconded, it was ordered that this Board do now recess until 7:30 P.M. L'ctober 28, 1938. X10

RECESSED MEETING OCTOBER 28, 1938

OXFORD, LU SSISSPPI

t he 'ayor and Board of Aldermen of the City of Oxford, met pursuant to the foregoing recess order of October 26, 1938, at 7:30 Pm., when and where the following were present:

Mayor h.X. dilliams, Presiding

Branhhm 'fume, Alderman at large

T.E. Avent, Alderman Ward 1

W.T. handler, Alderman Ward 2

rY .L. pennon, Alderman Ward 3

* ** * * * * * * *

E.A . 140ore, Deptty Clerk

After the meeting had been opened according to law the following busindss was had to-wit:

Upon motion duly made and seconded, it was ordered that this hoard do now recess until 3'o'clock P. M. Monday, October 31, 193b. 1 1 1

RECESSED MEETING OCTOBER 31, 1938

OXFORD, MISSISSIPPI

The Aayor and Board cf Aldermen of the City of Oxford, met pursuant to the foregoing recess order of October 28, 1938, when and where the following were present:

Branham Hume, Aayor Pro Tem

T.E. Avent, Alderman, Ward 1

W.T. Chandler, Alderman, Ward 2

W.L. Kennon, Alderman Ward 3

C.H. Roach, Alderman Ward 4 • * * * * * * * * * * * * * * * * * * * * * * *

C.A. Bratton, City Attorney H. A. 'bore, Deputy Clerk

After the business had been opened according to law the following business was had to-wit:

WHEREAS, it appears to -the Board of i'layor and Aldermen of the City of Oxford, 'Mississippi, that the city has bonded obligations and interest due and payable on November 21, 1938, in the sum of $1000.00; and . WHEREAS it further appears that said money can be repaid within 10 dyers from this dare and not before and therefore, it will be necessary to borrow f said sam for said period of time.

Now, therefore, be it resolved by the Board of Mayor and Alderman in recessed session assembled that the Mayor Pro Tem Branham Hume, and the City Clerk, W. 1'. Chandler, be and are hereby authorized, empowered and directed to borrow said sum, A.edging the full faith and credit of the city of Oxford for repayment of same, according to the tenure and effect of the not executed therefor.

The said resolution having been first produced in writing was read and adiTted, Those voting yea being: W.T. Chandler, T.E. Avent, -0 .H. Roach and W.L. Kennon. Those voting Nay: None.

Ordered in recess session on this the 31st day of October, 1938 * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that this Board do ow lerk AA adjourn, sine die. Mayor_ 11° 112 REGULAR MEETING NOVEMBER L, 1938

TUESDAY

* *

Be it remembered that the Board of "ayor and Aldermen of the City of Oxford, Mississippi, met in regular session at the mayor's office at 7:30 P.M., Tuesday, "ovember 1, 1938, it being the time and place for the holding of said meeting, when and where were present the following members;

Branham Hume, "ayor Pro Tem 'residing

T.L. Avert Alderman Ward 1

W.T. Chandler, Alderman Ward 2

".L. pennon, Aldermen Ward 3

* * * * K *

H.A. Moore, Deputy Clerk C.A. Bretton, Pity Attorney V.C. Jones, Marshal

After the business had been opened according to law, the following business was transacted:

Upon motion duly made and seconded it was order d that the following accounts be allowed and that warrant be issued accordingly. From the

CORPOR A TION FUND

321. H.X. Williams, Mayor, October salary -$80.00 322. Branham Hume, Alderman, " $10.00 323. T.E. Avent, Alderman, October salary -- - $10.00 324. W. T. Chandler, " $10.00 325. W..". Kennon, tt $10.00 326. C.H. Roach $10.00 327. E.A. Moore, $50.00 32d. V.. Jones, Marshal-;-October salary $125.00 329.Sam Keel, might marshal, " tip $100.00 330.R.N. "hitfield, Band "aster, October salary $40.00 331. C.A. Bretton, Attorney, October salary $40 - 00 332. " f Fee in Euie case --$100.00 333. Mrs. Holcomb, "utron, October salary $20.00 334. Lillian Jones, secretary, October salary -$40.00 335. Postal Telegraph, telegram--- .90 33b6. Oxford Eagle, -)upplies, adv.- $9.95 337. Tom Ketchings, 'uppltes - $10.00 33. L.Li. Lynch, Gas for Wpi, $15.72 339. Hughes Hardware, Supplies $8.58 340. Hal] Blacksmith, Rep. to pick $1.40 341. E.P. Lower, purveying for OctQ--- -- $6o.00 342. Porter Hardware, ')upplies $8.04 343.Elliott Lumber Co., Supplies $15.41 344- Walter B. Pettis, Surveying for Oct. $113.00 345. C.E. Slough, Recording deeds .0 34b. L.'. Lynch, L'oa, for WPA. $4. 1 347. Jones rroduce Company, Coal, $10.22 ‘%oers Variety Store, 'upplies .30 349. Oxford insurance Ageny, "'remium on Moore Bondiappppp-$65.00 350. Belk, Aep. to'11-2A Truck- -75 $974.48 REGULAR MEETING NOVEMER 1, 1938

STREET FUND

351. S.B. Spears, -cOreman, October Salary $100.00 352. V.C. Jones, Special police for Oct, $14.00 353. 0.JJ. Livingston, 2 days work $8.00 354. Earl Freeman, 2 days work $7.00 355. Porter Hardware Oo., Supplies 41, 356. Oxford Eagle, Warrants, Adv. $20.76. 357. ,o.'. Jones, Keeping city prisoners for Oct. $41 .X 358. Waller mercantile Company, Supplies 359. L.G. Lynch, gas $51.39 360. blliott Lumber Company, Supplies $13.28 361. C. 4. Huggins, Rep. to truck $6.68 362. Rak Garage, Fire trucV, service, rep. to truck 60.10 363. J.L. Carpenter, Rep. to tire $1.80 041 SCHOOL FUND

r-.:) 364. G.S. Byers, Janitor for Oct. $60.00 ..._, , 365. 0. 1). bmith,, °ctober salary;) $24.00 366. hughes ,,ardware, bupplies L.L. 36 . commercial 1"rint bhop, Supplies $!g9.00(0) e!!! 368. R.H. Gillespie, Magazines, tirp to Jackson, etc---$23.9 369. Porter hardware Company, Supplies $1. 58 370. century Electric Company, Supplies- $1.23 371. Silver Burdett Company, Supplies $1.94 372. Houghton Nifflin Company, bapplies $1.86 373. 'ixie chemical r'roducts Company, bupplies $13.625 374. Lobdell Scenic Studio $102.40 375. 'ureau of -vublication, buppties $9.43 - 3766. A.D. Wiley, bupplies, 2 keys made $1.50 377. Itmerican Education rress, bupplies $1.20 37d. G.H. Thorn, Repair to typewriter $6.50 379. Jack Lee, Labor on sewer line $4.00 380. Scott, .'oresman & Oompany4 bupplies $5.27 381. ter. Cromwell, Labor on old building--- $20.40 382. "inn & Company, Supplies $2.22 383. boss Coleman, Rep. to ceiling $22.00 384.C.A. Gregory Companyli bupplies $3.90 385. J.A. Martin, s r., bupplies - $2.40 386. Crane Company, Supplies $39. 66 'lot al $371.79 114

NOVEMBER 1, 1938 REGULAR MEETING

LIGHT AND WATER FUND

387. C.'. harrison, Supt. October salary--------$245.00

70 7^1, 11so, , i npp . • Johns on -wr Oct ober selary--- ---$125 . 00 389.A.L. Mullin, '6ngineer, October salary-- $115.00 390. Louis Campbell, October salary 391. Howard Winter, Lineman October salary 392. H. A. 'more, October salary- --- - $50.00 393. Lillian jones, uctober staary $105.00 394. T.". Lunn, Rent cn building 450.00 395.Mrs. Lillie Yates, Rent for Octobe•-- $10.00 396. Hughes -ardware Company, 'supplies - .82 397.Porter Hardware Company, 'upplieL.------$3.21

- 39. . L. u. Lynch, Gas------ 399. 444 Service Station, '-as- 171.9. 7 400.N.O. `nelson, $26.62 401. `'.. 14 . Milden, Light meter- --$8.00 402. J.L. Dilworth Company, -)upplies- $29.59 403. Cabell Electric Company, ' )upplies- $32 .47 404."Lississippi Foundry & Machine Company, supplies $24.0 405. Badger 4.ter Company, 'upplies- 406. Theulauber Brass "'anfacturing Co., 6upplies 20.76 40 .General Electric Supply L;ompany, Supplies- $10.88 408. Well Machinery & Supply Corp., Supplies $11.51 409. Arkansas Fuel Oil Corporation, Fuel Oil $579. 40 410. Texas Company, ursa oil- $79.18 411. Tennessee Valley Equipment, Supplies --- $144.31 412. Graybar, Supplies $300.57 413. Gathright-Reed, -upplieo .15 414. Riechman Crosby , supplies-- -- - $9.51 415. F.W. Belk, Labor on truck $1.75 $2187.21

ELECTRIC LIGHT IMPROVE:ENT FUND

416. Chase "ational Bank, Fee on paying coupons -$5.00

* * * * * * * * * * * * * * * * *

WHEREAS it appears tc the Hoard of Mayor and Aldermen of the City of Oxford, "ississi ni, that the city has bonded obligations and interest due and payable on lovember 1, 1938, in the sum of 01400.00; and

WEIREAS, it further appears that said money can be repaid within three months, from this date and not before and therefore, it will be necessary to borrow said sum or said period of time.

NOW therefore, be it resolved by the Board of Mayor and Aldermen at . a re, ses6ion assembled that the Mayor 1"ro Tern Branham nurse, and the City Clerk W.T. Chandler, be and are hereby authorized, empowered and directed to borrow said sum, pledging the full faith and credit of the City of Oxford for payment of same, according to the tenure and effect of the not executed therefore.

TiE said resolution havihg been first produced in writing was rend, adopted. Those voting yea being W. 1 . "handler, and W.L. "ennon and those voting "nay ; none.

Ordered in regular meeting cn this the 1st day of November, 1938.

* * ** * * * * * * M * * November 1, 1938 REgULAR MEETING

'upon motion duly made and seconded it was ordered that M.M. Winkler, xluditor, 1Upelo, Mississippi, be and he is hereby employed tx to audit the City'e Book for the year 1938.

* * * ›.< * * * * * * *

Upon motion duly made and seconded, it was ordered that this Board do now recess until V±iday, November 4, 1938. 116 NaVE2BER 4, 1938 RECESSED MEETING

OXFCED, MISSISSIPPI

The Mayor and Board of Alderman of the City of Oxford, met pursuant to the foregoing recess order of November 1st, 1938, at 7:30 P.M. when and where the following were present:

Mayor R.X. Williams, Presiding

Branham flume, kdderman at large

Avent , Aldermen Ward 1

W.a. Chandler, Alderman Ward 2

Kennon, .'lderman Ward 3

C.H. poach, Alderman, Ward 4

H.A. Moore, Deputy Clerk C.A. Fratton, Attorney V.L. Jones, City Marshal

After the meeting had been opened according to law the following business; was had to-wit:

Upon motion duly made and seconded and passed, Alderman Chandler, Marshal V.. Jones, E.. aneed and Sykes Kennon were authorized to go to Senatobia Thursday, November 10, 1934 to receive instructions relative to Public Safety, motor vehicle license and the issuing of Driver's License. This action is at the request of Major Birdsong, L;ommissioner of Public '.--afety. * * * * * * * * * T « * * *

Upon motion duly made and seconded it was ordered that the Mayor be and he is hereby authorized to employ some one to check up on negro houses not on the tax roll, and that he pay the sum of $10.00 for this work when completed. * 4 * * * * * 4 4 * 4 *

Came on for consideration the matter of the salary of R.N. vhitfield, instructor of Oxford high School Band, for the year 1939. Upon motion duly made and seconded it was ordered that the salary of Mr. ,;hitfield for 1939 be and the same is hereby fixed at $200.00 , at the rate of $16.67 -per month. * >4 * * * * * * * * *

By a unanimous vote of the Board of Aldermen, Mayor was authorized to employ two men as special police as traffic officera at $2.50 per day for not less than two nor more than four days per wee-1. 'Ihe mayor to have control of the hours and days when said ppecial police shall work * * * 4 * * * * * * 4 * *

Mayor illiams, ''ldermen "ume and city Attorney C.A. Bretton were authorized to draft a new ordinance relative to traffic laws, and to present same to the next meeting of this Board for adoption. * * * * * * * * Uppn motion made and duly seconded and carried it was ordered that :;vinfred Koel be allowed the sum of $22.50 for 9 days special police .1, $2.50 per day and that Sykes Kennon be allowed. $22.50 for 9 days special police 1 $2.50 per day and $9.00 for the use of his car for 9 days. * * * 4 * * * * * * * * * * * I 17

RECESSED NEETING NOVE,TER 4, 1938

Upon motion duly made and seconded, it was ordered that the following notice be published in the Oxford Eagle:

NOTICE TO TAX PAYERS, CITY OF OXFORD

17 • You will take notice that the assessment roll of the city of Oxford, both real and personal, is now on file in the Mayor's office and unless you appear and protest same, the same will be approved at a regular adjourned meeting on Monday November 21, 1938, at 7:30 P.M.,

ditness my signature, this the 9th day of November, 1 07..,..., 8 •

R.X. Williams, Mayor W.T. Chandler, Clerk

15pon motion duly made, seconded and carried, it was ordered that this Board do now recess until Ski-6 P.M., id7,4 November 18., 1938 . Ils

RECESSED MEETING NOVEMBER 18, 1938

OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen of the City of Oxford, met purusant to the foregoing recess order of November 1st, 1938, at 3:00 P.M., when and where the following were present:

Mayor R. L. Williams, Presiding

Branham Hume, Alderman at large

W.T. Chandler, Alderman Ward Two

Kennon, Alderman Ward Three

C.H. Roach, '-qderman Ward Four * * * * * * * * * * * * * * * * *

H. A. Moore, Deputy Clerk

After the meting had been opened according to law the following business was had to-wit:

RESOLUTION ORDERING TEE FILING OF BIDS.

WHEREAS, pursuant to advertisement, bids for the equipment of the addition to the Grammar School, Oxford, Mississippi, have been filed by the following bidders:

lqssissippi School Company, Jackson, Mississippi Fred thrasher, Jackson, Mississippi Herschel bmith Company, Jackson, Mississippi

that the said bids have been duly received, opened and publicly read:

NOW, THEREFORE, BE IT RESOLVED that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, consulting architect, and that the said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliest practicable moment, report to this Board of Mayor and Aldermen his findings as to the lowest and best bid.

The above resolution was read and adopted by a unanimous vote on this the 18th day of November, 1938. * * * * * * * * * * * *

RESOLUTION AWARDING CONTRACT

WHEREAS, ') ames T. Canizaro, 'onsulting Architect, pursuant to a Resolution heretofore adopted, has tabulated and considered all bids heretofore received for the furniture and equipment for the Addition to the present Grammar School building, City of Oxford, Mississippi, and has duly made his recoom- endation to this Board of Mayor and Aldermen and ft appearing from said recommendations and report that tied Thrasher, Jackson, Mississippi, is the lowest and best bidder for the furniture and equiptment of the addition to the grammar school building, City of Oxford, Mississippi, in the sum of $1587.75 and that the Board of Mayor and Aldermen after considering said report end recommendation and all bids heretofore filed, finds that the bid of Fred Thrasher is the lowest and best bid:

NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AND BOARD OF ALDERMEN OF TEE CITT CF OXFORD, MISSISSIPPI,

AS FOLLOWS:

SECTION 1: w hat the bid of Fred Thrasher, Jackson, Mississippi, for the furniture and equippment of the addition to the present grammar school building in the sum of $1578.75 is hereby accepted, determined and declared to be the lowest and best bid; however, this award shall not be effective 121

RECESSED MEETING NOVEMBER 22,.1938

OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen of the City of Oxford, met pursuant to the foregoing recess order of November 21, 1938, at 7:30 P.M. when and where the following were present:

Mayor R.X. Williams Presiding

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

d.T. Chandler, Alderman Ward 2

W.L. Kennoh, Alderman Ward 3 L.H. poach, Alderman uVard 4 * * * * * * * * * * * * ";*

H.A. Moore, Deputy Clerk =- C.A. Bretton, Attorney • Be it remembered that the Board of Mayor and Aldermen met in regular adbourned session for the transaction of business whereupon, a motion made and seconded the Audget as submitted by M.M. v 4inkler, Certified Public Accountant of Tupelo, Mississippi, was adopted, as follows: .

BUDGET •

CITY CF OXFORD - MISSISSIPPI

For the year ending December 31, 1939 ANTICIPATED REVENUES

AD VALOREM (22 mills) $ 31,970.95 STY-1T TAX 900.00 PRIVILEGE LICENSE 1500.00 FINES 2500.00 FROM STATE AND COUNTY School Per Capita 3251.58 Smith-Hughes Fund 634.50 Chickasaw Fund 530.40 Poll Tax 571.82 Tuition 6552.00 Road Tax (i) 2000.00 SUNDRY 365.00 LIGHTS & WATER REVENUES 667000.00 Total $116,776.25

PLANNED DISBURSEMENTS

CORPORATION FUND

Salaries: Mayor and Board $1560.00 Tax Collector 600.00 Marshall 1500.00 Night Watchman 1200.00 Bandctitractor 200.00 diWkeforney 480.00 Secretary 480.00 City Engineer 1200.00 Cemetery Upkeep 200.00 Use of Trucks and Repairs 250.00 Legal Printing 225.00 Fuel 180.00 Telephone and Telegraph 425.00 mPostage 130.00 (Continued)

122

RECESSED MEETING NOVvD3LR 22, 1938

OXFORD, MISSISSIPPI

Janitor 120.00 Legal Exppnse 50.00 Fees - Legal (Special) 200.00 Insurance 100.00 Upkeep of Fire Truck 100.00 Audit 150.00 Travel - Mayor 50.00 Coircunity House l'Und -Note and Inst. 224.00 Banquet - Firemen 35.00 Fire Department 400.00 Haul Gravel and Sand 100.00 Advertising and 2rograms 130.00 "undry and Emergency 300.00 Lumber and Building Materials 250.00 Stationery for Office 400.00 Other Supplies 290.00 $11,939.00

STREET FUND

Salary - Foreman $900.00 Labor 3000.00 Care of -erispners 425.00 Gas and Oil 550.00 Repairs to Truck 250.00 General Supplies 500.00 Hospital Fees 25.00 Sundry 50.00 Office Supplies 25.00 $5725.00

SCHOOL FUND

County Supt's salary $288.00 City Supt Salary 2500.00 Sup't Office Expense 200.00 Other Administrative Expenses 100.00 Teachers Salaries 15,939.00 University High 10,100.00 Materials for Instruction 550.00 Music and Athletics Insurance 5?2 .000 Janitors 810.00 Janitors Supplies 300.00 Lights, Water and Fuel 700.00 Repairs and Replacements 650.00 Improvements to Grounds 25.00 Auditorium Improvements 300.00 $33,094. 00

LIGHT AND WATER FUND

Salaries: gpperintendent 2940.00 Crew (4) 5400.00- Office (2) 1050.00 Fuel Oil 8760.00 Rent 840.00 Freight and Express 4500.00 Pole Rentals 206.00 Wages ?500.00- Gas and Oil 625.00 Sundry 200.00 Electrical Supplies 5000.00 Water Supplies 500.00 Clay Pipe and Culvert 500.00 Meters and Repairs 650.00 Repairs and Welding 900.00 Waste 100.00 Stationery and Printing 350.00 Small Supplies and Hardware 100.00 36,051.00

BONDS AND INTEREST Principal Maturities $18,700.00 Interest 11,267.25 $29,67.25 Total Disbursements - $116,776.25 RECESSED MEETING NOVEMBER 22, 1938

OXFORD; MISSL:SIPPI

The above and foregoing budget was this day read and adopted. Those voting "Yea" were Alderman Roach, itlderman Avent, Alderman Kennon and Alderman Chandler. Those voting "Nay" were Branham Hume. * * * * * * * X *

Upon motion duly made and seconded, it was ordered that this Board do now recess until Friday, November 25, 1938, at 7:30 P.M.

124

RECESSED METING NOVEMBER 25, 1938

OXFORD, MISSISSIPPI

The Mayor and hoard of Aldermen of the City of Oxford, Met pursuant to the foregoing recess order of lovember 2?, 1938, at 7:30 P.M. when end where the following were present:

14eyor R.A. Williams :eresiding

Branham Hume, Alderman at large

T. . Avent, Alderman Wal . d 1

W.T. Chandler, Alderman Ward 2

v4 .L. K.ennon, Alderman Ward 3

O.H. Roach, l',1derman aard 4 * * *

'400re, Deput Clerk

After the meeting had been opened according to law, the following business was had to-wit:

Be it remembered that the Board of Mayor and Aldermen met pursuant to recess order where upon motion duly made and seconded the levy for municipal 'tales for the fiscal year 1938, to be collected according to law and distributed to the funds named in the proportion designated, to-wit:

SCHOOL FUND 15 mills BOND FUND 5 mills FORPORI:TION FUND- 2 mills 22 mills

The above tax levy was this day adopted, those voting "Yea" were Alderman Avent, Alderman Roach, Alderman Chandler and Alderman Kennon. Those voting "Nay" were Alderman Branham Hume.

Oxford,Miss.Nov.25,1938 To the Honorable Mayor and Board of Aldermen City of Oxford,Mississippi

With your kind permission I am making the following statement for record on the Minutes of this Board,these statements being my opinion arrived at after careful and deliberate consideration of the financial situation confronting the City of Oxford for the years 1938 and 1939. 1. That deficite figures for the year 1938 and expense figures for the year 1939 are too conservatively estimated 2. That revenue figures for the years 1938 and 1939 are too liberally estimated. 3. That on the basis of the Budget tentatively approved and the tax levy finally set it will be impossible to secure sufficient revenue to cover the actual 1938 deficit and the actual 1939 expense. Therefore, my Inte on the budget as tentatively approved by a majority of this Board, and my vote on the tax levy as finally set by a majority of this Baord is in the,negative. Respectfully submitted Branham Hume, Alderman; City-atTLarge - - *

Upon motion duly made and seconded it was ordered that thtt Board do now adjourn sine die.

Clerk Mayor 127 SPECIAL MEETING NOVEMBER 30th, 1938

OXFORD, MISSISSIPPI

NOTICE OF SPECIAL MEETING

TO THE MEMBERS OF TEE BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI

Notice'is hereby given that a special meeting of the . Board of Mayor and Alder- men of the City of Oxford, Aissis-ippi, will be held in the City of Oxford, at the City Hall at 3:00 o'clock P. M. on the 30th day of November, 1938, for the purpose of passing a resolution Extending the Time of Competion of the .;:present Grammar School Building, Docket Missisippi 1219-DS, from December 15th, 1938 to January 1st, 1939.

Dated this the 30th day of November, 1938.

R.'- Vvilliams, Mayor

CONSENT Te MEETING

C\/ t=-■ We, the undersigned members of the Board of Aldermen of the City of Oxford, Mississippi, do hereby accept service of the above and foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and glace therein named, and for the purpose therein stated.

"itness our signatures this the 30th day of November, 1938.

giL. Kennon Branham Hume C.H. Roach R.E. Avent Those present were R.X. Williams, C.H. Roach, Branham Hume and T.E. Avent. * * * * * 1` * * * *

A RESOLUTION EXTENDING THE TIME ON ME ADIOTTION TO TE: GRAMMAR SCHOOL DOCKET MISSISSIPPI 1219-DS.

WHE7,EAS , it appears that the City of Oxford made application to the Ocblic Works Administration Authorities for a grant for the construction of the addition to the Grammar School and Equipping same for the city of Oxford, Lafayette County, Aississinpi.

WHEREAS, it appears that this project was approved titnd a grant made and the building now under construction and that the completion is December 15th, 1938.

WHEREAS, it appears that on account of the delay of Public Vvorks Authorities in notifying the City of Oxford, Mississippi, to sign contract for the furnishing and equipping of the addition of the City of Oxford, mississippi.

THEREFORE, be it resolved by the Board of Mayor and Aldermen that an extension of time to January 1st, 1939, for the completion of all work is hereby requested by the Federal emergency Administration of Public Vvorks, /4 5!!ci The above resolution was this day offered and adopted by the Board of Mayor and Aldermen in a Special Meeting monvened on this thl 30th day of November, 1938. * * * * * ?r, *

A RESOLUTION A PPR OC ING AND ADOPTING THE SPECIFICATIONS CONTRACT DOCUMENT AND THE ADVMTISEHENT OF BIDS FOR TEE FURNITURE AND EZJIPPMENT OF THE CITY NRALL, DOCKET NO. MISS. 1220-F. WHEREAS, detail specifications and contract documents of the furniture mnd equippment for the City Ball, PWA i'roject Locket Miss. 1220-F, has been presented by James T. Canizaro, and 128

SPECIAL MEETING NCNITa.ER 30, 1932

OXFORD, MISSISSIPPI

WEEhEAS this Mayor and Board of Aldermen of the City of °find has full considered said specifications and contract documents and find that it • for the best interest for the City of Oxford, AiSSiSiDIA, to furnish and equipp said building as therein providdd.

NOW, TVPRRYORE '13E IT RESOLVE) by the tBoard of Mayor and. Ald Of the City of Oxford Miesissippi, as follows:

SECTION: 1. That the specifications and contract documents referred to in the preamble hereof for the furnishing and equipping astx said building ta and tame are hereby, in all respects, approved and adopted as the official_ Specificationsand contract documents to be used in connection with the prosecttions of the work in such equippment. That for the purpose of iddntifications, there shall be endoresed on one set of specifications and contract documents by W.T. Chandler, Clerk, the following:

Iduly adppted by the resolution of Board of Mayor and Aldermen on the 30th day of November, 1938.

Dui W.T. Chandler, City Clerk By H.A. Moore, Deputy

Such set of specifications and contract documents with the endorse- ment thereon shall remain on file in this office.

SECTION 2. het legal notice be given by the publication in a newspaper published in Oxford and in Lafayette County, and that sealed bids for the equippment and furniture of the City Hall, Docket Miss. 1220-F in accordance with said specifications and ccntract documents, will be received by this Board at Oxford, Mississippi, until one o'clock P.M. on the 23rd day of December, 1938. Such notice shall be in the form of an advertisement for bids, filed in the office of the City Clerk, as a part of the approved specifications and contract documents. The above resolutiom was this day adopted by the Board of Mayor and Aldermen at a Special Meet- ing convened on this the 30th day of November, 1938.

* * * * * * * * * * * * * * * * *

Upon motion duly made and seconded, it w.s ordered that this Board do now ad • rn sin=sin •ie.

. Chandler, Clerk k williams, Mayor REGULAR MEETING DECEMBER 6, 1938

TUESDAY * * * * * * * * * * * * * * * * * * * * *

Be it reemmbered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session at the Mayor's office at 7:30 P.M. Tuesday, December 6, 1938, it being the time and place for the holding of said meeting, when and where were present the following members: R.X. Williams, Mayor Presiding Branham Hume, AidermknoatAarge

T.E. Avant, Alderman, Ward 1 W.T. Chandler, Alderman, Ward 2 W.L.:Kannon, Alderman, Ward 3

C.B. 'Roach, Alderman Ward 4 * * * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk V.C. Tones, City Marshal C.A. Bratton, City Attorney

After the meeting had been opened according to law, the following business was transacted:

Upon motion duly made and seconded it was ordered that the following acebunts be allowed and that 'a warrant be issued accordingly. Fran the

457. R;X. Williams, Mayor, November salary 1180.00 456. Branham Hume, Alderman at large, November salary $10.00 429. T.E. Avant, Alderman, November salary 10.00 460.W.T. Chandler, Alderman, " fl 10.00 461. W.L. Kennon,' " " " 10.00 ff Ft 462. C.B. Roach, ' " 10.00 463.B.A. Moore, Noiember salary-- 464.V.C. TonesJones, Marshal, November salary $125.00 65. Sam Keel, watchman, November salary $100.00 66. R.N. Whitfield, Band master," " 40.00 467.4 C.A. Bretton, Fee in buie case $100.00 468. C.A. Bretton, City 4ttorneti November salary 40.00 469. Mrs. 0.E. Holcomb, Matron for November 20.00 470. Lillian Jones, Secretary, November salary 40.0Q 471. L.G. Lynch, Gas for WPA, coal 19.16 472. ball Blacksmith, Rep. to pick 1.5o 473. Porter Hardware, Supplies 9.b4 474. Belk Garage, Rep. to WPA Truck 1.00 475. Patton-Courtney, upplies 1.22 47b. Hughes Hardware; Supplies 477. Illiott Lumter Company, Supplies 114t 476. J.E. Neilson, Supplies 1.00 479. Coers Variety Store, snvlies for WPA .55 460. Oeorge M. Lundie, Getting up assessment 10.00 481. The Mississippian, Advertising ---11.70 482.Walter D. Pettis, Surveying for 1)4ovemher 81.20 483.Tom L. Ketchings, Supplies 8.20 484. Standard Drug Company, liEyt* poison 2.70 (Continued) 1 '2 6

REGULAR MEETING DECEMBER 6, 1938

CORPORATION FUND /Continued)

488. J.A. iiertin, Jr., Supplies 2.91 48b. neddrman Brothers, Supplies 31.86 487. Lawrence Printing Company, Supplies 1.27 486. M.M. Iiinkler, budget and work on tax roll 300.00 489. Jones Produce, Fuel 11.04 490.Dr. B.S. Guyton, Rent for November 20.00 491.Eureka Fire Hose Division, `'upplies for fire truck-17.26 492.American La France Foamite, Fire Dept. supplies 1.05 Total $1191.60

STREET FUND 493. S.E. Separs, Foreman for November 100.00 494. Ozburn-Abston & Company, Supplies 2.50 495.Belk Garage, Repairs to truck, fire truck service 83.42 496. L.G. Lynch, Gas 42.28 497.hall Blacksmith, sharpening ax .25 496. Porter hardware Company, Supplies 4.49 499.Elliott Lumber Company, Supplies -4.07 500.Huggins Garage, Rep. to truck 2.65 501.shapliegh Hardware Company, Street brooms 9.00 502.Commercial print Shop, Fine notices 4.00 503.V.O. Jones, Spedial police for 5 days-- 10.00 504.T.E. Avent, Drug Store, Supplies .65 505.D.S. Ross, 2 days work 6.67 506.Riechman-Crosby, Supplies 2.63 507.W.T. Jones, Keeping city prisoners 22.50 SCHOOL FUND

508.G.S. Byers, Janitor for November 60.00 509.O.D. Smith, Pro rate share of Nov. salary 24.00 510.Crane Company, iieplacements 4.62 511.Porter hardware Company, supplies 6.07 512. Patton-Courtney, Supplies 9.21 513.Tennessee Book Company, Books la 514.Coers Variety Store, Materials for instruction ft 515.MacMillan Company, Materials for , 2.05 516.Bureau of Publication, books0O4:099- ,n1;GGIg 6.83 517.Material Geographis Sooiety, Magazines 3.00 516. Illinosi Central Railroad Company, Freight 2.44 519.Gaylord Brothers, Supplies 3.10 520.L. Appleton Century Company, Books 3.92 521.E.T. Shultz, Repairs 3.00 522.A.L. Kraemer Company, Material for Instruction 11.70 523.R.L. Tomlinson, @lobk for school 4.02 524.Elliott Lumber Company, Supplies 11.41 525.National Education Association, supplies 2.48 526. Oxford Insurance Company, Insurance 52.50 Total 232.80 REGULAR MEETING DECEMBER 6, 1938

LIGHT AND WATER FUND

527/C.". Harrison, Superintendent, November salary $245.00 528.G.V. Johnson, Iligineer, " 1. $125.00 ft 529.A.L. Mullins, " " $115.00 530. Louis Campbell, " I. " $105.00 531.Howard Winter, Lineman “ .. $105.00 “ 11 532.H.A. Mbor - - 50.00 433. Lillian Jones, Secretary r. " 40.00 534, T.A. Dunn, Rent for November 50.00 -__ 535. Mrs. Lillie Yates, Rent for November 10.00 536.Belk Garage, 1.1pplies 3.25 537.Davis-Mize Company, Supplies 7.25 536. Elliott Lumber Company, Supplies 2.78 539. Quick Repair Shoe Shop, Supplies .25 540. Haney Chevrolet Company, Inner Tube 2.00 541.Hughes Hardware Company, Supplies .27 542. Ozburn-Abston &Vompany, Supplies 1.50 26.23 1. 543. American Locomotive Company, Repair to engine 544.L.G. Lynch, Gasoline 39.05 545.Westinghouse, °upplies Arkansas Fgel Oil Company, Fuel Oil t9 .■ 546. 5 3. -3 ....,1 547. Pittsburgh Equitable Meter Company, Water meters 194.71 .e. 546. Texas Company, Ursa Oil 26.68 549, Fischer Lime and Cement Company, (-%lay pipe 12.40 55N.J.E. Dilworth Company Plant Supplies 7 .88 551. Tennessee Valley Electric Supply Company, Supplies 1.88 55k. American Cast Iron Pipe Company, Supplies 1 .3o 553.Mueller Company, Supplies 39.92 554.H. Blackman & Company, wiping cloths 11.00 555.Crane Company, Water Supplies 30.52 55b. William a. Nugent & Company, Rep. to engine 6.35 557. Llectromaster, Inc., Electric Supplies 7.22 5588. W.A. Fuller Company, Engineer service-I 150.00 559. N.O. Nelson Company, Supplies 46/56 5b0.Graybar, Supplies 294.74 561.hiechmanCrosby, Supplies 09.35 562.porter Hardware Company, Supplies 2.14 563.Patton-Courtney Hardware Company, Supplies 12.4:3 Total $2440.01

AUTOMOBILE LICENSE FUND

565. V.C. Jones, Trip to Senatobia $7.00

* * * * * * * * * * * * * * * * * * * *

Upon motion dyly made and seconded it was ordered that duplicate warrant be issued in favor of Haney Chavrolet Company in lieu of warrant No. 849, dated July 6, 1938, said warrant is said to have been lost and has not been presented for payment. * * * * * * * * * * * * * * * *

superintendent C.E. Harrison, was instructed to buy the necessary poles to keep the transmission of the light department in good condition and for making all necessary extensions. * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess until Friday, December 9th, 1938, at 7:30 o'clock P.M.

130

RECESSED MEETING

FRIDAY, 7:30 P.M. DECEMBER 9, 1938

The Board met according to the foregoing recess order when and where were present :

R. X. WILLIAMS, Mayor, Presiding /atm. W.T.CHANDLER,Alderman,Ward One, Clerk C. H. ROACH, Alderman Ward Four

BRANHAM HUME, Alderman City-at-Large

Upon motion duly made and seconded it was ordered that this Board do now adjourn sine die.

1 / t Or SPECIAL METING DECEMBER 23, 1538

NOTICE OF SPECIAL MEETING

TO THE MEMBERS OF THE BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI

Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, at the City Hall at 1:00 o'clock P.M. on the 23rd day of December, 1938, for the purpose of receiving bids on the equippment for the City Hall, Oxford, Mississippi, Locket No. Miss' 1220-F.

Witness my signature this the 23rd day of December, 1938.

R.X. Williams, Mayor

CONSENT TO MEETING

We, the undersigned members of the Board of Aldermen of the City : of Oxford, Mississippi, do hereby accept service of the above and foregoing notice, waiving any.. and all irregularitties in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and place therein named, tad for the purpose therein stated.

Witness our signatures this the 23rd day of December, 1938.

Avent, Branham Hume, Chandler C.H. Roach W.L. Kennon.

The Board met according the foregoing call, when and where the following were present:

R.'. Williams, Mayor

Branham Hume, Alderman at large

d.T. Chandler, Alderman Ward 2

W.L. Kennon, Alderman Ward 3 * * * * * * * * * * * *

Moore, Deputy Clerk

After the meeting had been opened according to law, the following business was had to-wit:

RESOLUTION ORDERING THE FILING OF BIDS.

WHEREAS, pprsuant to advertisement, bids for the equippment of the City Hall, Oxford, Mississippi, have been filed by the following bidders:

F.A. Hulett and Son, Meridian, Mississippi Mississippi School oupply, Jackson, Mississippi Fred Thrasher, Jackson, Mississippi Herschell omit h, Jackson, Mississippi that the said bids have been duly received, opened and publicily read:

NOW4,TBEREFORE, BE IT RESOLv/a) that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, consulting architect, and that the said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliest practicable moment, report to this ward of Mayor and Aldermen his findings as to the lowest and best bid.

The above resolution was read and adopted by a unanimous vote on this the 23rd day of December, 1938. * * * * * * * * * * * * * * * * * 132 SPECIAL MEETING DECEMBER 23, 1938

RESOLUTION AWARDING CONTRACT

WHEREAS, James T. Canizaro, Consulting Architect, pursuant to a Resolution heretofore adopted, has tabulated and considered all bids heretofore received for the furniture and equippment for the City Ealloof the City of Oxford Mississippi, and has buly made his recommendations and report that F.A. Hullett and Lion, Meridian, Mississippi, is the lowest and best bidder for the furniture and equippment of the City Hall Building, Oxford, Mississippi, in the sum of $1559.05 and th t the Board of Mayor and Aldermen after considering said report and recommendation and all bids heretofore filed, finds that the bid of F.A. Hullett and won, Meridian, Mississippi is the lowest and best bid:

NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AID BOARD AF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI

AS FOLLOWS:

SECTION 1. That the bid of F.A. Hullett and con, Meridian, Mississippi, for the furniture and equippment of the City Hall building in the sum of $1559.05 is hereby accepted, determined and declared to be the lowest and best bid; however, this award shall not be effective until the awardee shall have been notified in writing by the Mayor R.x. "illiams, of 'such award. That upon the awardee being sc notified in writing a contract for the construction of said work, as heretofore prescribed by the plans, specifications and contract documents, shall be forthwith executed for said construction.

SECTION 2. That ItX..WWIlliams, Mayor, is hereby authorized and directed to execute said contract in the name of end for and on behalf of the Mayor and Board of Aldermen of the City of Oxford, Mississippi.

The above resolution was this day adopted by the Mayor end Board of Aldermen of the City of Oxford in a Sepcial Meeting. * *N* * * * * * * * * * * * * * * *

A RESOLUTION EXTENDING THE TIME ON THE ADLITION TO THE GRADEAR SCHOOL DOCKET MISSISSIPPI 1219-Ds.

WHEREAS it appears that the City of Oxford made application to the Public Works Administration Authorities for a grant for the construction of the Addition to the grammar School and Equipping same for the City of Oxford, Lafayette County, Mississippi.

WHEREAS, it appears that this project was approved and a grant made and the building now under construction and that the completion ds December 31, 1938.

WHEREAS, it appears that on account of the delay of approval of Mr. Fred Thrasher as a contractor until December 19, 1938, and therefore his order for equippment was held up until this said date, also, due to the facr that the stell wardrobe could not be made especially for the job in time BO which the manufacturers gave us a finishing date and date of said steel lockers will be shipped on the 8th day of January, 1939, this is the earliest possible date that the manufacturers can complete the making of this material.

THEREFORE, be it resolved by the Board of Mayor and Aldermen that an extension of time to January 15th, 1939. for the completion of all work is hereby requested by the Federal Lmergency Administration of Public Works.

The above resolution was day offered and adopted by the Board of Mayor and Aldermen in a Special "eeting convendd on this the 23rd day of December, 1938. * * * * * * * * * * * *

There being not further business, this does now adjourn sine die.

Mayo City of Oxford, Miss. Clerk, City of Oxford',Miss. 133

UNITED STATES OF AMERICA

STATE OF MISSISSIPPI

COUNTY OF LAFAYETTE

CITY OF OXFORD

1 ANUARY

1 9 3 9

REGULAR MEETING, JANUARY 3, A. D. 1939. 1,„

Be it remembered that the Board of Mayor anitiigtiattsid Aldermen of the City of Oxford, Mississippi, met in Regular Sec ion at the Mayor's Office at 7:30 o'clock P. M., Tuesday, January 3, 1939, it being the time and place fixed by law for the holding of said meeting, when and where were present the following members :

Mayor : R. X. Iddliams, Presiding.

Aldermen : Branham Hume, City-at-Large

T. E. Avent, Ward One

V. T. Chandler, Ward Two

B. O. Elliott, Ward Three

C. S. Haney, Ward Four.

* *

E. A. Moore, Deputy Clerk

Sam Keel, Marshal.

After the meeting had been opened according to law, the followigg business was transacted . :

Upon motion of Alderman Chandler and seconded by Alderman Avent it was ordered that all elected and appointed employees of the City of Oxford,Mississippi, are hereby employed upon a monthly basis, and can be for good and sufficient cause, removed from office upon the 7 payment of the current month's salary * * * * * * * * Upon motion of Alderman Hume and Seconded by Alderman Chandler, Miss Lillian Tones was unanimously elected City Secretary, ata salary of $80.00 per month.

134

Regular Meeting, Tuesday, January 4, 1939

Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants issue accordingly. From the

CORPORATION FUND.

594. R. X. Williams, Mayor, Dec.Sal.$ 80.00 595.Branham Htme, Alderman, # " 10.00 59b. T. E. Avent, tt " 10.00 597. W. T. Chandler, " " 10.00 59d. W. L. Kennon, 9 10.00

11 599. C. H. Roach, " " 10.00 600. H. A. Moore, Deputy Clerk, " 50.00 601. Miss Lillian Jones, Secretary, 9 40.00 602. V. C. Jones, Marshal,- 9 125.00 603.Sam Keel, Night Watchman, 9 100.00 604. R. N. Whitfield, Band Master, " 40.00 605. C. A. Bretton, Buie Estate, 100.00

606. C. A. Bretton, City Attorney, " 40.00 607. Mrs.E.O.Holcomb, Matron, "b 20.00 608. Earnest Teague, Rate Sheet,22mills, 4.70 609. Barnard Sta.Company, Stationery for office, 6.96 ft ft 610. Hederman Brothers, .' 69.08 611. Lawrence Printing Company" " " 59.87 612. J. A. Martin, ft ft ft 2.04 613. Jones Produce Company, Fuel for office,- 10.94 614. Texas Zervice Company, upkeep fire truck, 5.23 615. W. H. Monger, advertising,etc., 20.00 616. Oxford Insurance Agency, bonds Mayor and Marshal,- - - - 10.00 617. Davis Mize Company, floor sweep, 1.50 618. F.W.Ielk,Truck repairs, 12.30 619.E. G. Lynch, sundries,- 27.60 620. J. D. Herndon, broom for W.P.A. 1.27 621. Elliott Lumber Company, lumber, 1.78 622. Hughes Hardware Company, sundries, 45.70 623. Phil Carnathan, holding election, 15.00 624. C.E.He.rrison,27 firemen, 66.00 625. Oxford Eagle, supplies, 1.25 626. Porter Hardware Company, sundreis, 1.84 627. T.E.Avent, drug Store, sundries, 5.90 628. Patton-Courtney HerdwarerA sundries, .45 629. W.D.Pettis, sundreis, 49.19 630. A. H. Avent, sundries, 1.00 $ 1064:7

STREET FUND

631. S. E. Spears, street foreman, Dec.Sal.$ 100.00 632. Reichman Crosby Company, lamps, 20.80 633. L. G. Lynch,gas, 39.20 634. W.T.Jones, jailor, keeping prisoners for Dec.1948, - - - 30.25 635. J. R. Sims, Services W.Phillips. 6.00 636. Bob Davis, special police, 2.00 637. F.W.Belk, repair to truck, 5.00 638. F.W.BElk, service fire truck, 40.00 639. Hall Blacksmith Shop repair to truck, .85 640. C. G. Huggins, gas and sundries, 1.75 641. E.L.Stephens, general street work, 22.50 646.C. D. Malonem, general street work, 22.50 642. J.K.Hartley, care prisoners, 2.60 643. Pittsburgh Plate Glass Company, sundries, 45. 00 644. Oxford Eagle, advertising, 2.10 645. Porter Hardware Company, supplies, 2.30 V 342. S5

BOND FUND. 647. Chase National Bank, paying coupons,p $ 5.00 135

Regular Meeting, Tuesday, January 4, 1939

SCHOOL FUND. 648. E. S. Byars, janitor, December salary, $ 60.00 649.0. D. Smith, Pro rata share December salary, 24.00 650. S. C. Toof # Company, supplies, 3.00 651. Silver Bennett Compeny,music, 1.00 652. Taylor Paper Company, janitor supplies, 20.50 653. I. I. Holcomb Mfg Company, janitors supplies, 1.14 654.R.H.Gillespie, repairs, etc., 4.00 655.Elliott Lumber Company, lumber etc, 4507 656.Lughes Hardware Company, supplies,- 2.10 . Patton Courtney, supplies,- 3.30 . Gathright Reed Drug Company, supplies, 1.02 . J. B. Shults, repairs, etv., 9.50 660.Jack Kilgore, repairs, etc., 2.00 661.Elliott Lumber Company, lumber, etc., 14.69 662.Porter Hardware Company, supplies, 1.94 663.Pittsburgh Plate Glass Company, supplies, 30.06 664.R. V. Black, supplies, 47.50 665.Wells Trunk Company, freight, 1.10 666.Elliott Lumber Company, supplies, ----5L21'. $ 2bd.19 LIGHT AND WATER FUND

667. C.E.Harrison, superintendent, Dec.Sal.$ 245.00 663. G. W. Johnson, engineer, " 125.00 669.A. L. Mullins, engineer, I. 115.00 670. Louis Campbell,engineer, ft 105.00 71. Howard Winter, engineer, " 105.00 t72. H. A. Moore, Deputy Clerk, ft 50.00 673.Miss Lillisn Jones, Secretary, " 40.00 674.T. A. Dunn, December rent, 50.00 675.Mrs Lillie Yates, rent for December, 10.00 676. Southern Bell Tel. Compant, pole rentals, 207.00 677. The Texas Company, gas and oil, 2618 678.Arkansas Fuel Oil Company, Fuel Oil, 593. 1 679.Westinghouse CoMPany, electrical supplies, 11.88 680.American Locomotive Company, repairs, etc, 23.16 6 1. Gfaybar Electric Company, electrical supplies, 94.80 6 2. Reichman Crosby Company, 4ectrical supplies, 42.47 6 3. Wood Preserving Corporation, poles, 102.15 6 4. J.E.Dilworth Company, supplies, 5.44 6g5. De Lavergne Eng. Company, repairs,- 100.50 6 6. N. O. Nelson Company, supplies, 25.06 687. Pittsburgh Equitable Meter &Company, supplies, 67.38 68. L. G. Lynch, gas &add oil, 40.38 689.Haney Chevrolet company, sundries, .41 690.Halls Blacksmith Shop, supplies,- .75 691. C. G. Huggins, supplies, 2.04 692.Elliott Lumber Company, sundries, 1.33 693.Western Auto Stores, supplies, .19 694. F. W. Belk, supplies, .00 695.Hughes Hardware Company, supplies, 1.23 696.Patton-Courtney Hardware, supplies, 1.2 $ 2192.18 * (--

Upon motion duly made end seconded it was ordered that W.T.Chondler deputy highway commissioner for LaFayette County, be allowed the sum of $76.75 for services rendered as such commissioner, to be paid out of the License Fund. The clerk is hereby authorized to issue warrant accordingly. Those voting Yea : Alderman Avent. Alderman Chandler Alderman Elliott, Alderman Haney Those voting Nay : Alderman Hume. 136`

Regular Meeting, Tuesday, January 3, 1939.

Came on for consideration the proposition of the National Youth Administration to establish a work shop in the new Community Building for the youth of this county. Unpon motion duly made and seconded the proposition was unanimously approved by the Baord.

Superintendent C.E.Harrison nf -ethelighteplant, was instructed to place an- outside light at the place designated and asked for by Superintendent Gillespie of the Grammar School.

It appearing to the Beard that a gtess error has been made in assessing the automobile belbnging to F.M.Martin, it was ordered that the assessment be, and the same was ordered to be reduced from $900.00 to $410.00, and the tax collector was directed to correct his books accordingly.

The term of office of E.S.Bramlett, trustee of the Oxford School System excited January 1, 1939. //Went Aldermen Hof Ward One nominated R. S. Myers to fill the vacancy. No other name being presented and the nomination being duly seconded it was ordered that the said R. S. Myers be and he is hereby declared elected Trustee of the Oxford City School System for a term of five years from January 1, 1939.

The following are the names and term of office of the Trustee of the Oxford City Schools : I. R. Wilson, term expires, Jan.', 1940 R. V. Black, • Jan.1, 1941 Will Lewis, Jan.1, 1942 H. D. Webster, " 11 Jan.l, 1943 R. S. Myers, " J-tan.i, 1944

Came onfor Consideration the eledtion of an attorney for -the City of Oxford. Alderman BUme''nOminated,Mr: C. Andrews and We' seconded by AidermanAvent. Therebetngitoother nominations, upon motion duly made and .seconded Mr.;-)L. C. Andrert was declared tobeeduly elected' City Attorney, at el. salary'of440:00 per month, the:same as now:being

Upon motion duly made by Alderman Avent end seconded by Alderman Hume it was - ordered that all of the employees of the City Light and :'dater Plant, be and they are, hereby re-elected to their present positions, with 'the same salary as now received, to-wit C. E. Harrsion, superintendent, •#245.00 per month. G. W. Johneon, engineer, - - - $125.00 per month A. E. Mullins- , engineer, - - - $115.00 per month Louis Campbell, engineer,- - - $105.00 per month Howard Winter, lineman,- - - $105.00 per month

Came on for consideration the fixing of the salery and employing a matron for the Ladies Rest Room. Upon motion dity made and seconded it was ordered that Mrs.E.O.Holcomb be elected Matron, and- that the sum of $20.00 be end the same is hereby fixed as the monthly salary to'be paid the matron of said Rest Room. 137

Regular Meeting, Tuesday, January 3, 1939.

Whereas, Section 6417 of the Code of 1930 Mississippi, provides to refund to municipalities one-half of all advelorem taxes collected by and for a County or separate or a special road districe on property within a municipality for road purposes of such county or distirct rk shall be paid over to the treasurer of such munisipality for such municipality ; and Whereas, Section 6418 of the Code of 1930 of Mississippi provides that on application of the municipality to the Board of Supervi- sors of the County, such municipality is entitled to receive payment of one-half of such advelorem taxes ; It is therfore ordered by the Mayor and Board of Aldermen of the City cf Oxford,Mississippi, in compliance with the law aforestid hereby make and enters this order making application for one-half of all ad velorem taxes levied and collected by and for the County of LaFayette, for the separtte or special road district within the corporate limits of the City of Oxford for road purposes, fen the year 1939, and each year thereafter. It is Ourtbat ordered that a copy of said order be delivered to the Board of Supervisors of LaFayette County, Mississippi. 11 Adopted and ordered this January 3, 1939 mesting of the Mayor and Cat Board of Aldermen of the City of Oxford,Mississippi. L;-■ A true copy of the above order was delivered to the Clerk of the ct Board of Supervisors, January 7, 1939. H. A. Moore, Deputy Clerk.

An Ordinance to compel every male person residing within the Corporate Wilts of the City of Oxford, Nissis ippi, over the age of Twenty one and under the age of Fiftyyears to pay annually a Special Street Tax, or in lieu thereof to perform four days labor on the Public Streets of said City, and to prescribe the punishment for violation of this ordinance. Be it ordained by the Board of Mayor and Aldermen of the City of Oxford,Mississippi,the in accordance with House Bill Number 56 of the Laws of 1935, extraordinary Session of the Legislature of the State of Mississippi, that each male person residilng within the corporate limits of the City of Oxford,Mississippi, unless exempt under the above named House Bill, over the age of twenty-one and under the age of fifty years, be and he is hereby required to pay annually to said City a special street tax in the sum of three dollars ; provided in person in lieu of paying the said tax shall have the right to perform Four Days labor of eight hours each, prior to January 1st following the levying of said tax, under the Street Commissioner and/or/other proper street authority of said City. Be it further'ordained that any person being required but who fails to pay the above tax or perform said labor shall be guilty of a misdemeanor, and upon conviction thereof shakk be fined five dollars Be it further ordained that for good and sufficient cause appearing unto the Board of Mayor and Aldermen of said City th , t this ordinance take effect anf be in full force from and after date of its passage. This ordinate having been previously reduced to writing was read and considered by sections, and then as a whole, at a public meeting of the Mayor and Board of Aldermen 0 the City of Oxford,Mississippi, om January 3, 1939, and the vote on the inal passage thereof was as follows : Those voting Yea: Br Hume, T.E.Avent, W.T.Chandler, B.O.Elliott, C. S. Haney Those voting Nay :None. Approved R.X.Williams, Mayor B.O.Elliott Clerk * * *

STREET FOREMAN. There were two applicants for Street Foreman and After a ballot had been taken S. E. Spears was found to have received a majority of the teteseast. Whereupon the said . S.I.Spears was declared x to be duly elected street foreman for the City of Oxford,Mississippi, at a salary of $75.00 per month 138 Regular Meeting, Tuesday, January 3, 1939

NIGHT 111,TCHMAN. There were five applications filed for the position of night watchman and after the same had been presented and read the Board went into an election. After the ballot had been taken it was found that R. D. Davis had received a mejority of the votes cast. Whereupon the said R. D. Davis was declared to have been duly elected night watchman for the City of Oxford,Mississippi, at a salary of $100.00 per month, provided the said night watchman owns and operates qn automobile.

MAYOR PRE TEM.PORE. The names of Alderman Hume and Alderman Chandler were placed in nomination for Mayor Pre Tempore. After a ballot had been taken it wes found that Alderman Chandler had received a majority of the votes cast. Whereupon it was declared that Alderman Chandler was duly elected Mayor Pro Tempore of the City of Oxford, Mississippi.

CITY CLERK. Upon motion duly made by Alderman Hume and sceonded by Aldermen Avent, Alderman B. O. Elliott was unanimously elected City Clerk of the City of Oxford, Mississippi.

Upon motion 0,k. Alderman Hume and seconded by Alderman Elliott it was ordered that .6/he salary of the Deputy Clerk, be, and the same is hereby fixed at $75.00 per month.

* *

LIGHT ANL COladISSIONaii. Upon motion of Alderman Chandler Alderman Hume was elected by acclimation as Light and Water Commissioner for the City of Oxford, Mississippi.

STREET EOMMISSIONER. Came on for consideration the election of a Street Commissioner. After the ballots had been counted it was found that Alderman Avent had received e majority of the votes cast, whereupon Alderman Avent was declared to be duly elected Streec Commissioner for the City of Oxford, Mississippi.

Upon motion of Alderman Haneyand seconded by Alderman Hume it was ordered that the statement of the Auditors be published in the Oxford Eagle provided it does not cost over $20.00

Upon motion duly made and seconded it was ordered that beginning January 1, 1939, the City of Oxford, pay Dr. B. S. Guytonthe sum of $35.00 per month for the rooms now occupied by the Tallahatchie Water Shed Surveying Unit.

Upon motion duly made and seconded it was ordered that proper advertisement be made for City Depository. Regular Meeting, Tuesday, January 3, 1939 * * *

Came on for consideration the matter of credentials and qualifications of officers and members of this Board, and the meeting having been resloved into a committee on such, it was found and adjudged that each of the following had been duly elected and commissioned by the Governor, and had qualified according to law, to-wi :

R. X. Williams, Mayor. Branham Hume, Alderman-at-Large T. E. went, Alderman, Ward One W. T. Chandler, Aldermen, Ward Two. B. O. Elliott, Alderman, Ward Three C. S. Haney, Alderman „Ward Four. Tally sheet of an election held at Oxford in and for the City of Oxford, election Precinct of LaFayette County, Mississippi, on the 13th day of December, 1938 : R. X. Williams, Mayor, 35 votes. Sam Keel, Marshal, 35 votes. Branham Hume, Alderman-at-Large, 35 votes T. E. Avent, Alderman Ward One, votes W. T. Chandler, Aldermen, Ward TWo,4 votes Baxter Elliott, Ward Three, 11 votes C. S. Haney,Ward Four, 7 votes We, the undersigned managers and clerks of election, hereby certify that the foregoing is a true and complete tally list and statement of the result of an election held on the 13th day of Decambet, 1938, for the City Oxford, Mississippi, LaFayette aCounty,and that the foregoing correctly shows the votes cast for each person for the office set opposite the respedtive names at said election. Witness our signatures this 13th day of December, 1938. Phil Carnathan, ) J. B. Wooten, ) Managers Mrs. G. B. Taylor,) Winfred Keel, Harry Bretton, ) Clerks.

Upon motion made by Alderman Hume and seconded by Alderman Haney, it was ordered that the $200.00 set aside in the Corporation fund in the City Budget, to be paid to the Birector of the Oxford Brass Band, be and the same is hereby stricken from said Budget. Those voting Yea : Alderman Hume Alderman Haney Alderman Elliott. Those voting Nay :Alderman Avent Alderman Chandler.

Upon motion of Alderman Hume and seconded by Alderman Avent it was ordered that the Marshal V.C.Jones, and Night Witchman Sam Keel be paid fees accumulated during November and December,1938, which were held up by order of the Board. Further ordered that the Marshal and Night Watch. man,when fines are paid in cash, they are to receive the regular fees, but when fines are worked out all fines revert to the City. * * * * * * * * * * * Regular Meeting, Tuesday, January 3, 1939 *

Urille on for futther consideration the salary of W.T.Chandler, Deputy Highway Commissioner for LaFayette County, On motion duly made and seconded it was ordered that mmximmt after January", 1939, after all expenses have been paid, the said commissioner is to receive fifty (50%) per centum of all fees collected. Further ordered that after February 1, 1939 the said W.T.Chandler is to give his entire time to the issuing drivers license. Those voting Yea : Alderman event Alderman Chandler Alderman Elliott Alderman Haney Those voting Nay : Alderman Hume.

Upon motion duly made and seconded it was ordered that all firemen belonging to the fire department, who pay street tax, be given a bonus of $3';00 for the year 1939.

* * *

Upon motion duly made end seconded it WRS ordered that this Board do now adjourn until 4 o'clock P.M., Monday, January 9, 1939 141

Recess Meeting, January 9, 1939.

Oxford, Mississippi

- The Mayor and Board of Aldermen of the City of Oxford,mississippi, met persuant tothe foregoing recessarder of January3, 1939, at 4 o'clock P.M., when and where were present the following mefabers :

R. X. Williams, Mayor, Presiding Branham Hume, Alderman at large

T. E. Avwnt, Alderman Ward Cne

W. T. Chandler, Alderman Ward Two

B. 0. Elliott, Alderman Ward Three

ISJ C. S. Haney, Alderman Ward Fcur

On motion made by Alderman Hune and seconded by Alderman Haney this Board requests that the School Board consider the matter of the Band, looking toward the development of a program whereby the whole matter of the Band, including that a supplement to the Band Direetors salary, can be worked out under the control and supervision of the School Administration, as it is reported to be in most municipalities in the State of Mississippi.

Those voting Yea : Alderman Hume Alderman Elliott Alderman Haney Those voting Nay : Alderman Chandler Alderman Avent.

On motion made by Alderman H me and seconded by Alderman Elliott this Board obligates itself to the extent of one month's salary for the Band Director to the 1938 rate of 480.00 per year instead of the $200.00 rate set up in the 1939 budget as approved by the Board of Aldermen who served the 1937-1938 term, this money to be paid out of the Corpora- tion fund as provided by law, the amount to be taken out of the savings made due to the reduction in the deputy clerk's salary, same being payable out of the Corporation fund.

Those voting Yea : Alderman Hume Alderman Elliott Alderman Haney Those voting Nay : Alderman Avant Alderman Chandler.

Upon motion dialy made and seconded it was ordered that this Board' ou'n sine die. Clerk oVilialf":44.r 1'42

JANUARY 14, 1938 SPECIAL MEETING NOTICE OF SPECIAL MEETING

TO THE MEMBERS OF THE BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI. Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of tht City of Oxford, Mississsippi, will be held in the City of Oxford, in the City Hall, at 9:00 o 'clock A.M. on January 14th, 1939, for the purpose of extending the time on the City Hall, Docket 1220-F, Oxford, Mississippi, from January 16th, 1939, until April lst, 1939. Dated this the 13th day of January, 1939. R.X. Williams, Mayor CONSENT TO MEETING

We the undersigned members of the Board of Aldermen of the City of Oxford, Mississippi, do hereby accept service of the above and foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Alddrmen shall meet at the time and place therein named, and for the purpose stated therein. Witness our signatures this the 13th day of January, 1939. C.S. Haney T.E. Avent W.T. Chandler Branham Hume B.O. 'lliott * * * * * * * * * * * * * *

The Board met puranant to the , abote‘notice with the following present:

E.X. W illiams, Mayor Presiding Branham Hume, Alderman at large T.E. Avant, Alderman Ward 1 W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman W and 3 C.S. Haney Alderman Ward 4 * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk

After the meeting had opened according to law the following business was had to-wit:

A RESOLUTION EXTENDING THE TIME ON THE CITY HALL, DOCKET 1220-F OXFORD, MISSISSIPPI.

WHEREAS? it appears that the City of Oxford made applic tion to the Public Works Administration Authorities for a grant for the construction of a City Hall and equipping same for the City of Oxford, Lafayette County, Mississippi. WHEREAS, it appears that this project was approved and a grant made and the building now understruction and that the completion is January 16th, 1939. WHEREAS, it appears thtt on account of the weather conditions, it will be impossible to complete this building by this date.

THEREFORE, be it resolved by the Board of Mayor and Aldermen that an extension of time to April 1st, 1939, for the completion of all work is hereby requested by the Federal Emergency Administration of Public Works.

The above resolution was this day offered and adopted by the Board of Mayor and Aldermen in a Special Meeting convected on this the 14th day of January, 1939. * * * * * * * * * * * * * * * * * * * * * * Upon motion made and ublpedeoonded, it was ordered that this Board do now adjourn sine die 143

NOTICE OF SPECIAL MEETING CDCFCRD,MISSISSIPPI JANUARY 23, 1939. To the members of the Board of Aldermen of the City of Oxford, Mississippi. Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford,Mississippi, will be held in the City of Oxford, in the City Hall, at 9:00 o'clock A.M., on Eanuary 23, 1939, for the purpose of extending the time on s the Grammar School, Docket No.1219-DS from January 15th 1939 until February 28th,1939, and rot the purpose of extending the time on the Negro Sohoo Docket No.1245-F, Oxford, Mississippi, from February 26th, 1939, until April 26th, 1939. Also for the purpose of considering the buying of chimes for the clock on the City Hall Docket 1220-F and for the buying of shrubery for the New City Hall, Docket 1220-F oxford, Mississippi. Dated this the 21st day of January, 1939 R.X.Williams,Mayor CONSENT TO MEETING We the members of the Board of Aldermen of the City of Oxford, Mississippi,do hereby accept service of the above and foregoing notice, waving any and all irregularities in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and place therein named, and rot the purpose therein stated. Witness our signatures this the 21st day of January, 1939 W.T.Chandler, T.E.Avent. C.S.Haney. B.0.21liott Branham Mime. * * * * * * * *

The Board met persuant to the above norice with the following present : R. X. Williams, Mayor, Presiding Branham Hume, Alderman-at-Large T. E. Avent, Alderman, Ward 1 W. T. Chandler, Alderman, Ward 2. B. O. Elliott, Alderman Ward 3 C. S. Haney, Alderman lard 4.

H. A. Moore, Deputy Clerk * * * * * * * *

After the meeting had been opendd according to law the following business was transacted:

A Resolution Extending the time on the Grammar School, Docket 1219-DS Oxford, Mississippi.

Whereas, it appears that the City of Oxford made application to the Public Works Administration Authorities for a grant for the constuation of and addition-to the present ("rammer School Building and equippAng same for the City of Oxford, LaFayette County, Mississippi. • Whereas, it appears that this project was approved and grant made and the building nom under construction and that the completion date is January 15th, 1939 Whereas, it appears since the contract document give the contractor 30 days to install his equipment and his work order was not given until December 20,1938,and became most of the furniture had to be built especially and becanae we expect all furniture installed in a week and the FWA wants a month ammo to clear its final business and because the architect has not finally accepted the building pending the arrival of the bondsmen's release of the owner's of any etc. Therefore be it resolved b the Board of Mayor and Aldermen that an extension of time to February 26th,1939 for the completion of all work is Ms hereby requested by the Federal EMergency Administration of Public Works. 144 Special Meeting. January '23, 1939. Monday

* 4‘

A resolutpan extending the time on the negro school Building Docket 1211d-F, Oxford, Mississippi.

Whereas, it appears that the City of Oxford made application to the Public Works Administratibkn for a grant for the construction of a Negro School) Building and equipping same for the City of Oxford, Lafayette County, Mississippi. 4 WHEREAS it appears that this project was approved and grant made and the bbtlding now under construction and that the completion date is February 26th, 1939.

WHEREAS, it appears that on account of the weather conditions being so bad and the PWA requires one month afterwards to complete all business it will be impossible to complete this building by this date.

'rwEEFORE, be it resolved by the Board of Mayor and Aldermen that an extension of time to April 26, 1939, for the completion of all work is hereby requested by the Federal Emergency Administration of Public Works.

The above reeolution was this day offered and adopted by the Board of Mayor and Aldermen in a Special meeting convened on this the 23rd day of January, 1939.

& * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that the matter of the Buying of the Chimes for the City Ball and Shrubbery for same be passed for further consideration.

Ikon motion duly made and seconded it was ordered that this Board do now reessuntil Thursday, February 2, 1939, at 2 o'clock P.M.

B. C. Elliott, Clerk R. X. Williams, Mayor 145

RECESba) MEETING, FEBRUARY 2, 1939 OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen of the City of Oxford, Mississippi, met pursuant to the foregoing refess order of January 23, 1939, at 1 o'clock P.M., when the where were present the following members:

R.X. Williams, Mayor Presiding Branham Hume, Alderman-at-large W.T. Chandler, Alderman Ward 2 Sykes Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * H.A. Moore, Deputy Clerk

After the meeting had been opened according to law C";) the following business was had to-wit: L7-4 A RESOLUTION ORDERING THE FILING OF BIDS. WHEREAS, pursuant to advertisement, bids for the equippment of the Negro School Building, Oxford, Mississippi, have been filed by the following bidders: F.A..Bilett and Son, Meridian, *.ssissippi Herschell Smith, Jackson, Mississippi Fred Thrasher, Jakkson, Mississippi Mississippi School Supply, Jackson, Mississippi . that the said bids have been duly received, opened and publicily read:

NOW, THEREFORE, BII IT RESOLVED that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, consulting architect, and hat the said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliebt practicable moment, report to this Board of Mayor end Aldermen his findsings as to the lowest and best bid. The above resolution was read and adopted by a unanimous vote on this the 2nd day of February, 1939. * * * * * * * * * * * * * * * *

RESOLUTION AWARDING. CONTRACT

WHEREAS ' d ames T.-Canizaro, Consulting Architect pursuant to a Resolution heretofore adopted, has tabulated and considered all bids heretofore received for the furniture and equoppment for the Negro School Building, City of Oxford, Mississippi, and has duly made his recommendation to this Board of Mayor and Aldermen and it appearing from said recommendations and r eport Herschell Smith, Jackson, Mississippi is the lowest and best bidder for the furniture and equippment of the Negro School Building City of Oxford, Mississippi in the sum of $1837.04 and that the Board of Mayor and Aldermen after considering said report

NO BE IT RESOLVED BY THE MAYOR AND BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI AS FOLLOWS: SECTION 1: That-the bids of Berschell Smith, Jackson, Mississippi for the furniture and equippment of the Negro School Building, in the sum of 4037.04 is hereby accepted, determined and declared to be the lowest and best bid; however, this award shall not be effective until the awardee shall have been notified by Mayor R.X. Williams, in writing of such award. That upon hhe awardee being so notified in writing a contract for the construction of said work, as heretofore prescribed by the plans and specifications and contract documents, shall be forthwith exevuted for said construction. 146 RECESSED MEETING, FEBRUARY 2, 1939

SECTION 2: That R.X. Williams, Mayor, is hereby authorized and direct- 4d to execute said contract it the name of and for sad on behalf of the Mayor and Board of Alderten of the City of Oxford, Akssissippi.

The above resolution was this day adopted by the Mayor and Board of Aldermen of the City of Oxford, Mississippi, in a recessed meeting.

* * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now recess until fiA. o •clock on February 44,1939• 147 FEBRUARY 6, 1939 RECESSED MEETING

The Mayor and Board of Aldermen of the City of Oxford, Mississippi, met pursuant to the foregoing recess order of lebruayy22, 1939, at 4 o'clock P.M. when ind where were present the following members:

R. Williams,Mayor Presiding

W.T. Chandler, Alderman Ward 2

Branham Hume, Alderman at large

Baxter Elliott, Alderman Ward 3

C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * *

H.A. Moore, Deputy Clerk

LE'D After the meeting had been opened according to law the following business was had to-wit: C.2 V=-• A RESOLUTION EXTENDING THE DOCKET TIME ON THE CITY HALL DOCKET NO. 1220-F OXFORD MISSISSIPPI.

WHEREAS it appears that the City of Oxford made application to the Public Works Administration Authorities for a grant for the construction of a City Hall and equipping same for the City of Oxford, Lafayette County, Mississ- ippi.

WHEREAS, it appears that this project was approved and grant made and the building now under construction and that the completion date is January 6th, 1939.

WHEREAS, it appears that on account of after starting work September 20, 1928, the Contractor was delayed fora days b the Owners moving trees, shrubs, etc vrom the site. Also, after signing the contract it was necessary to place order for reinforcing steel, have details made approved by the Architect, send these to the steel company, have them facricate steel and ship same to Contractor. It was necessary that the contractor have reinforcing steel before he could do work of any material value towards completion of the building. Tie steel for the footing was delivered 18 days after the contractor started work. It was seven more days before the wall steel arrived. This item totals a delay of 25 days. Also, the design of this building requires black terrazzo columns which support a portion of the second floor. vders for this terrazzo was placed the day after the contract was signed but these terrazzo columns were not delivered until January 23rd. The factor supplying these terrazzo columns advised that it was necessary to submit a number of samples to the architect to get the exact tupe and color of terrazzo that was desired. It took quite a time to make up each sample properly cure and finish same and the time required for getting sample approved delayed them from actual work of building columns until after January 1st. After sample was finally prepared to meet Architect's approval, they manufactured and shipped columns as soon as possible. After delivery of these terrazzo columns it was necessary to set same to build a -concrete core on the inside. and then to build false beam above, etc. This item delayed the contractor 45 days by slowing down construction. Also, rains and freezing weather delayed pouring of concrete for a total of 7 days. Also, the heating sub-contractor placed shipping instructions iliovember 28th for boiler, but the factory has not been able to make shipment for possible two months from the date shipping instructions were given. This had delayed the heating sub- contractor a. total of 15 days in the completion of this portion of the Contract- or's contract.

THEREFORE, be it resolved by the Board of Mayor and Aid ermen that an extension of time to March 25th, 1939, for the completion of all work on the Docket including general construction, installing of all furniture and equippment and closing out all records and reports for a final completion of entire Docket is hereby requested by the Federal Emergency Administration of Public Works. 148 REOESSED MEETING FEBRUARY 6, 1939

The above resolution was this day offered and adopted by the Board of Mayor and Aldermen in a Recessed meeting on February (4 1939. * * *.* * * * * * * * * * * *

A RESOLUTION EXTENDING THE DOCKET TIME ON THE NEGRO SCHOOL BUILDING DOCKET 1245-F OXFORD, MISSISSIPPI.

WHEREAS it appears that the City of Oxford made application to the Public Works Administration Authorities for a grant for thecconstruction of a Negto School Building and equipping same for the City of Oxford, Lafayette County, '41ississippi. j WHEREAS, it appears that this project was approved and grant made and the building now under construction and that the completion date is February 16th, 1939.

WHEREAS, it appears that on account of the Change Order No. 2 dated January 21, 1939, including 6 items of work to be done. and called for an extension of time of 15 days to take care of this work. Also, on account of the Plastering contractor has encountered cold, wet weather since he started his plastering, and this weather condition will slow up his work and also slow up the drying out of the plaster it willbe impossible to complete this building at this time.

THEREFORE, be it resolved by the Board of Mayor and Aldermen that an extension of time to April 26, 1939, for the completion of all work on the Docket including general construction installing of all furniture and equippment and closing out all records and reports for a final completion of the entire docket is hereby requested by the Federal Emergency Administration of Public Works.

The aboce resolution was this du offered and adopted by the Board of Mayor and Aldermen in a recessed meeting sonveded on this the 6th day of February, 1939. * * * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded it was ordered that this Board do now ad0ourn e •

1./(46e4,1¢tiH1-4 . O. lliott, Clerk R.X. Williams, Mayor FEBRUARY 74 1939 REGULAR NEETIM

UNITED STATES OF AMERICA

STATE OF MISSISSIPPI

COUNTY OF LAFAYETTE

CITY0FOXFORD FEBRUARY 1939 * * * * * * * * *

RE-GIAR MEETING', FEBRUARY

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in Begular . Session at the Mayor's office at 7:30 o'clock P.M. * on Tuesday, February 7, 1939, it being the time and place fixed by law for the holding of said meeting, when and where were present the following members: Mayor R.A.'Williams, Presiding

Aldermen Branhan'Hume, City-at-large T.E. Anent, Ward One W.T. Chandler, Ward Two

B.O. Elliott, Ward Three O.H. Haney, Ward Four * * * * * * * * * * * * * *

14.3k. Moore, Deputy Clerk Sam Keel, Marshal.

After the meeting had been opened according to law, the following business was transacted:

Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants issue accordingly. From the

CORPORATION FUND 748. R.A. Williams, Mayor, January salary $80.00 749. Branham Hume, 4iderman ." « $10.00 750.77. Avent," " « -$10.00 751.W.T. Chandler, " " " $10.00 752. B.O. 31liott, " « " $10.00 753.C. 6. Haney, " " « $10.00 754.H.A. Moore, Deputy Clark" " $50.00 755.Lillian Jones, " " 7§0. Sam Keel, Marshal " n $$125.00 779. R.N. Whitfield, Band master " 7 016 700. Mrs. 0.E. Holcomb, Matron, January salary------t $20.00

. (continued)

150 REGULAR MEETING FEBRUARY 7, 1939

CORPORATION FUND (Continued)

756.C.A. Bretton, Fee din Buie Estate $100.00 757.L.L. Andrews, Attorney , January salary $40.00 756., Duff Davis, Night watchman " » $100.00 759. F.W. Belk's Garage, Fire truck service $40.00 761.W.E. Mallett Company, Sundry $2.31 762.N.O. Nelson Company, Sundry #164.45 763.HUrblarey Auto Supply, upkeep of truck $2.40 764.George D. Barnard, OffiCe supplies $9.01 765. Oxford Eagle, Station and legal printing $7. Elliott Lumber Coppany, Lumber and bld material 4(withheld) 766.A.R. Taylor Company, Stationery and office supplies $ .00 767.Belk Garage, Sundry $6.10 Porter Hardware, Supplies .41(withheld) 768.L.G. Lynch, Fuel--- $25.75 769.Coers Variety Store, Office Supplies- $2.45, 770.Jones Produce Company, Fuel- $21.1b 771.Hughes Hardware . Lumber $1.58 772.Mississbppian, Advertising $4.50 773.Hall Blacksmith, Sundry $2.05 M.M. Winler, Auditing $150.00(withheld) 774.Tom L. Ketchings, Office supplies 421.29 7T Walter D. Pettis, City Engineer $53.62 77 . Patton Courtney Hardware, Supplies .91 777• C • E• Harrison, Chief Fire Dept. $92.50 Patton Courtney, Sundry- .5Z $1264.42 STREET FUND

781. 8.E. Spears, January salary $75.00 782.Bramlett Hospital, Hospital Fee $5.00 783.Pittsburgh Plate Glass Co., General street $2.20 784.Rieshman Crosby, Light bulbs 106.64 785.bob Davis, 4- days work $9.00 786.W.T. Jones, Upkeep of prisoner's 6.00 787. Tom Q. Ellis, Ege in Posey Case $60.85 788. Oxford Eagle, Sundry $3.50 789.Belk Garage, Rep. to truck $4.35 790. Sam Keel, Cost in case $40.20 791.Earl Freeman, Labor for 1 day $3.50 If 3 792.D.S. Ross, " " 410.00 793. 0.D. Livingston, labor for 3 days $12.00 794.L.G. Lynch, Gas--- $33.35 42; Primrose Petroleum Co., Paint 44g .00 Porter hardware Co., Supplies $-6.58(withheld) 796.Standard Service Station, Rep. to truck .50 797.C.G. Huggins, Rep. to truck $1.25 798.444 Service Station, Gas $1.07 799.Hall Blacksmith, Rep. to truck $1.40 Haney Chevrolet Co., Rep. to truck $3.12(wit'aheld) 800.V.C. Zones, Cost in cases for Nov. and Dec. X7.70 2A.21 SCHOOL FEND

840.O.D. Smith, January salary $24. 00 841.Will Isom, January salary $50.00 t51

REGULAR MEETINGA FEBRUARY 7, 1939

LIGHT AND WATER FUND.

801. C.E. Harrison, Supt., January salary $245.00 802. G.*. Johnson, Engineer $125.00 803. A.L. Mullins, " $115.00 804. Louis Campbell, " 805. Howard Winter, Lineman 11 112.-gg 806. H.A. Moore, Deputy Clerk $50.00 807. Lillian Jones, Secretary $40.00 808. T.A. Dunn, Rent , $50.00 809. Mrs. Lillie Yates, Rent $10.00 810. a.s. Ouyton, Rent $35.00 811. N.O. Nelson Company, supplies $74.99 812. Murphrey Auto oupply, supplies , , 813. Riechian Ceosby, Electric Supplies $16.4 814. General EleCtric Supply, Supplies $14.08 815. Westinghouse, Supplies $7.74 816.444 Service Station, Sundry .93 817. Hughes Hardware, Supplies $3.72 Porter Hardware, Supplies $4.b9(withheld) ti"J 818. Hall Blacksmith, Sundry $3.00 f':.: 819. Blockman and Company, Sundry $12.00 Cq 820. Cabell Electric Company, Electric Supplies $21.68 821. DeLa Vergne Engine Company, Rep. and Welding $185.00 822. American Cast Iron Company, Water supplies 46.81 <11 823. Duncan Electric Company, Meters and Repairs-- n7.37 824. American Locomotive Company, Rep. and welding 822. Sparta Sewer machine Co., Sundry $48.00 $33.008 . Miss. Foundry and Machine Co., Meters and repairs 82 .American Sand Barnum Co., Sundry. $60.95 828, Standard Oil Company, Gas and oil--- $1.93 829. Texas Company, Gas and oil. $26.88 830. Tennessee Valley Electric:Co., Electric Supplies $63.94 831. Graybar,'S upplies $25.93 832. Dilworth Company, Sundry ., $10.83 833. LG. Lynch, Gas T $11.83 Elliott Lumber Company, Sundry $15.3(withheld) 834. F.W. Belk Garage, Sundry $1.60 835. Patton Courtney Adw. Water supplies • . 56 031a. Oxford Eagle,. Printing . $7-50 , 837. Arkansas Fuel Oil Company, Fuel oil $1039.4b 838. Ark. Fuel Oil Company, Fuel oil , 449A? $2674.78 * * * * * * * * * * * * * * * *

TO THE MAYOR AND BOARD OF ALDERMEN OXFORD, MISSISSIPPI

Gentlemen:

We, the Band Mothers and Citizens, wish to petition your honorable Board to con- intue the operation of our Band at the same salary for Mr. Whitfield. It has been called to our attention tht at your Board Meeting on the First Viuesday, that this was discontinued entirely, We have spent considerable money on our childrens band instructments and music lessons as well as trousers, shoes and all things necessary for their betng in the Oxford Band. All of this will be a total loss to us as their music will be of no value to them if discontinued at this time end there is no inducements for the children to continue to take private lessons if they will not be permitted to have the general meeting of from 3 to 4 times each week of all of them as a band. Their hearts desire is to be permitted to wear a Band Unigorm, march; play and make trips as a unit band. We further wish to call your attention to the small towns much smaller than oxford and in a class below oxford in our opinion who have bands, for instance, Oakland, Itta Bena, Water Valley, Milan, Grenada and numerous others of this size or smaller. We earnestly request that you re-consider your action of Tuesday night and know the Band AJirector his regular salary of $40.00 per month and if necessary reduce in some other department in place of discontinuing ours. Think of the sixty som odd young people to say nothing of their parents who are directly interested as well as th majority of the good citizens of Oxford. Respectfu ily: Lee Bagget, Shaw Robindson, S. Friedman, L.G. Lynch, Jr., L.S. Shafer, J.B. Gath.- right, R.L. Tomlinson, Lake mcIarty, W.T. Chandler, Mrs. J.B. Anderson, Z.S. 152 REGULAR MEETING FEBRUARY 7, 1939

Anderson, F.M. Beard, B.J. Wiley, L.F. Patton, Willial Faulkner, F.M. Posey, "TS. F.M. nosey, Mrs. T.E. Avent, T.E. Avent, W.C. Cox, T.D. McNeely, Eernice Cole, J.B. Wooten E.C. Cobb, Boyce Collins, M.I. Bailey, William C. Collins, Billingsley, F.F. Heard, N.Y. Murphrey, Z.L. Knight, C.H. Roach,E.T. beney, D.S. Hughes, R.R. bughes, W.F. New, John E. Beck, James Bartley Coleman, McKeelly, I.T. Davis, R.Y. Garrett, T. Freidman, J. Wilson, Mr. C.A. McLarty, Mrs. Tom Mistilis, Spiro Vallatos, Mrs. T.w. Tinsley, Mrs. M.R. Wilson, Mrs. O.D. 6-'mith, B.A. Smith, Mrs. B.A. Smith, Mrs. J.A. Caldwell, J.H. Cald- well, Mrs. -B.G. Coleman, V.C. Jones, Mrs. V.C. Jones, Tom %stills, Mildred Galloway, W.C. Galloway, Mrs. L.F. Patton, Mrs. Virginia Pace, Mrs. Maude Knight, mt. and mrs. Shine Morgan, Bob hobinson, E.L. ttnkins, Lydia Pennington, Dezzie Harris,Mrs. A.H. Avent, Mrs. E.W. Hale, Mrs. T.M. Stone, Mrs. Jeff Hamm, Mrs. Jeff Hamm, Mrs, Longest, T.K. Hamm, Mrs. L.A. Wilber, Lean A. Wilber, Mrs. Lee Baggett, Sr., Whitman Davis, Ws. Whitman Davis, Mrs. W.N. Leaven, Mrs. H.B. Howerton, Mrs. Grady Gutyon, Mrs. T.A. Bockerstaff, Mrs. Edd Stone, Carl Coors, Charles Jaskwiich, H.L. suarles, C.M. Smith, Mrs. J.O. Ramey, Mrs. P.W. Rowland, Sr., Mary V. Rowland, Mrs. N.H. Fox, Mrs. Ross Brown, Mrs. W.L. Rinnon, W.L. Kinnon,Durley Jones, Mrs. Durley Jones, Mrs. Earnest Todd, Earnest Todd, Mrs. X.J. Vance, Mrs. A.J. Wilds, Marion Leaven., J. Brantlett, C.G. Huggins, W.H. Kimnons, Mrs. Ruth Wells, E.E. Malone, Mrs. E.E. Malone, G.T. Hemphill Ivadell n4ze, Dulon Mize, R.O. Waller, E.L. Moss, V.J. Penn- ington, W.L. beard, B.E. Dickey, E.E. array, L. Starnes, P.C. Whitehead, Mrs. J.B. Cofield, J.R. Cofield, J.C. utrell, K.L1 Robinson, Mrs. T.P. Pulliam, T.P. Pulliam, Mrs. J.C. r utretl, E.A. Jones, Mrs. E.A. Jones,Mrs. Christine Truett, A.Y. Howell, Mrs. A.Y. Howell, Mrs. J.H. Mo ris, J.H. Morris, W.K. Somerville, Mrs. M. Bennett, M. Bennett, Mrs. D.N. Tankersley, ""rs. Boma C. Puke, Mrs. Ira Purvis,, Mrs. W.R. Perkins, Mrs. J.E. Bounds, Earl Fudge„Mrs. D.S. Black, Mrs. L.G. Lynch, Mrs. L. Beanland, Mr. and msg. M.L. Perkins, rs. Earl Fudge, W.M. Miller, J.E. Belk, Mrs. C.A. Ligon, W.G. Roberds, Mrs. Katie Bell Take 'ors. Nona Woodward, Mrs. W.W. Eat, Sr., Van East, Mrs. Arent, Mrs. Oswalt,,4s. W.W. Inmon,Mrs. O.D. Courtney, Mrs. V.B. Harrison, Mrs. Lottie White, "ors. W.F. Potter, Mrs. B.I. Wiley, Y.C. Huggins, C.J. Huggins, Mrs. G.E. Ellis, bunny Cole, Louise Hale, hubert Conlee, B.R. Cole, Mrs. F. Martin, Mrs. C.B. Teat, Mrs. Slade, Mrs. Porter, Linder Fudge, R.E. Bhellaharger, S.D. Roans, Joe Moore, Mrs. Joe Moore, Mrs. Leslie Malone, Mrs. H.E. Moore,Mrs. W.N. Lowrance, 4dge Peden,J1. Jensen, Sanford C. Gladden, C.D. Hodge, W.A. Temple, Mrs. W.A. Temple, Mrs. R.L. Holley, Mrs. D.E. Rreeman, Mrs. J.B. Cullen, Mrs. J.C. Hume, Mrs. Amy Johnson, Miss Grave "ustace, Mrs. R.L. Kirkwood, R. I.. Kirkwood, Mrs. K. Owen, Bill Tucker, C.V. DeShazo, Mrs. H.F. Wilkins, Mrs. W illiams, Jr., Mrs. bill Tucker, Mrs. Oscar hall, 0.0. Hell, Mrs. A.M. Hall, Ticer Young, C.R. Ligon, Eva Head, Ruby Bayles, Ile Mae Taylor, ltlla Woolverton, M.I. Bailey, H.L. Moore, J.W. Woodward, S.L. `"'ay, R.L. Polley, "inford Keel, R.I. Calloway, Miller, I.O. Ramey. J.I.s Vance, T.L. Collins, Mary Kinney. mrs. G. Owens, Mkas Nona Beanlend, Mrs. Lillian Dodd, Mrs. L. 4% Stowers, Mrs. Guyton, H.M. Reeves, Mrs. W.M. Reed, Mrs. J.E. Pegues, Mrs. H.D. Webster, W.H. McNeely, Mrs. E.T. Erickson, Mrs. D.G. Hughes, Mrs. W.C. Cox, Mrs. C.. Morgan, Mrs. R.L. Sackett, Mrs. Slough, Mrs. C.A. Bretton, Mrs. A.L. tuafaloe, Mrs. A.L. Bondurant, Mrs. P.C. Whitehead, P.C.Whitehead, Mrs. E.O. Davidson, Mrs. H.S. ~Isk, W.E. Stone, Mrs. C.E. Downing Mrs. P.B. purr, Mrs. Louise Falkner, Mrs. Maud Falkner, Mrs. John Falkner, Mrs. John Falkner, H.S. 'isk,w .A. Scarbrough, S.B. Foust, G.N. 'urnbow, Guy Cook, Mary Starnes, E.M. Knight, Cl. L. Bartsfield, J.C. Baetsfield, Olivia Tankersley, Phil Carnathan, I.... Wade, T.R. Holley, Lucille Collins, L.M. Mayfield, Mrs. G.H. Meedor, Mrs. Bill Crow, Rebecca. Blasengame,Mrs. G.T. Hemphill, Mrs. Friedman, Mrs. Lee Baggett, Mrs. W.M. Reed, Mrs. A.B. Little, Mrs. J.C. Bartsfield, Mrs. Titer Young, "rs. Forrest McCall, Mrs. J.E. Avent, Mrs. A.L. Woods, Mrs. C.G. Huggins, Mrs. Shaw Robinson, Mrs. H.D. Webster, Mrs. Albert Fenger, Mrs. Ralph White, Mrs. bpiro Vallatos, Mrs. T.W. Denton, A.B. Cullen, Mrs. A.B. Cullen, Mrs. W. 'i ensen,L.W. Harmon, J.L. "ook, Mrs. O.H. Little, * SEE PAGE 156 Came ont for consideration of a petition presented in person by some 20 Band Mothers for the employment of the Band Director whieh is referred to aboe and upon motion made by Alderman Elliott and seconded by T.E. Avent, is was passed that 040.00 per month up to July 1, 1939, be paid to W.N. Whitfield. and--was unanimously carried. * *

Upon'motiOn made, seconded and unanimousely adopted, it was voted that due to error, the assessment of Pat Haley, be reduced from $1500 to 0900.00. * * * * * * * * * * 153 REGULAR MEETING FEBRUARY 7, 1939

Upon request by The Irby to rent part of the City Parking lot for coal, the Board rejected same. * * * * * * * * * * * * *

Upon a request from L.L. hoebuck and R.F. Campbell for a street up to their houses, same was referred to T.E. Avent, Street Commissioner, for investigation. * * * * * * * * * * * * * *

The request for a reduction of assessment on the negro houses by E.W. Russell r— for the McMahon Estate was rejected. * * * * * * * * *

The request of Miss Sallie Bell Iduncan for four feet of thiustreet in deed, was referred to Branham Hume and City 'ngineer. * * * * * * * * * *

Upon motion ma pted,it-40 was ordered that an advertisement be agl , advertisi g for sale the Present City Hall Propert * * * * * -* * * * **

Upon motion made and seconded, and unanimously adopted it was ordered that the assessment of Mrs. M. Dennison be reduced from $1500 to $900 due to error. * * * * * * * * * * * * * *

Came for the consideration a petition of J.W.T. Falkner for a reduction on the Byrd Young Property, which was referred to T.E. Avent aid C.S. Raney and Name to be reported on at the next meeting of the Board. * * * * * * * * * * * 4c *

Upon motion duly made and seconded, it was ordered that the property of Tom .Mistilis on North 7th street be reduced from $2100 to $1800, due to error. • * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that the property of Dr. Bramlett on Lot/55 be reduced from $3000 to $2500, due to error. * * * * * * * * * * * * *

Came on for consideration an error in the assessment of two negro houses on North 11th street, the property of Dr. E.S. Bramlett, and same was referred to Alderman B.O. 41liott and W.T1 Chandler, to report on at next meeting of the Board. * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that Superintendent C.E. Barrison,purdhaspistonS for the present Worthington engine. * * * * * * * * * * * *

Upon motion duly made and-seconded, it was order that Sam Keel, Marshal remove all cars that double park in the parking secions of the city, and especially in front of the picture show, and on the square, and to insert notice in the paper accordingly after which all violations are to be a fine of $3.00 and increased for each additional offense. Same was unanimously adopted. * * * * * * * * * * * * * *

Upon motion duly made and seconded, and unanimously,carried, it was adopted that the city purchase a police uniform for the night marshal, Duff Davis, also, one cap for the night marshal and one cap for the day marshal., and one badge foi Otjt Marshal. * * * * * * * * * * * 154

REGULAR MEETING FEBRUARY 7, 1939

Came for the consideration the employment of a city pound keeper. There being no others applying for this position, it was ordered that Neely Lovelady be appointed city pound keeper and that the City of Oxford pay one half of the residence telephone and installation, and remainder to be paid "Or Neely Lovelady. * * * * * * * * * * * * * * * *

Upon motion duly made and seconde, it was ordered that B.O. Elliott, Attorney L.C. '-'ndrews and plaperintendent C. 1'. Harrison, prepare a buileine ordinance for the City of Oxford. * * * * * * * * * * * *

Came on for consideration the appointment of a Deputy City Clerk and Tax Collector to replace B.A. Moore, made vacant by his resignation, and upon motion made by B.O. Elliott and seconded and unanimously carried, it was adopted that B.C. Bell be appointed City Tax Collector and Deputy Oity Clerk and Assessor. Same to take affect at once. * * * * * * * * * *

Ordered by the Mayor and Board of Aldermen of Oxford, Lafayette County, Mississippu, that publication be made as is required by Chapter 105 of the Mississippi Code of 1930, and amendments thereto, for bids for the privilege of keeping the funds of the City of Oxford, County and State aforesaid, for the year 1939. Said bids to be filed in the office of the Mayor thereof up and until 12 o'clock M, on the 13th day of March, A.D., 1939. The Mayor and Board of Aldermen reserve the right to reject any and all bids. * * * %.It * * * * * * * * * * Ale to error in assessment of Haney Chevrolet Company, it was ordered that the assessment be reduced from $8750 to $4250.00, making a total refund of *99.00. It is also ordered that warrants be issued accordingly. * * * * * * * * * * * * * *

Upon motion duly made and seconded, it was ordered that this Board do now recess until Thursday, February 9th, at 4 o'clock, P.M. 155

RECESSED MEETING FEBRUARY 9th, 1939

The Mayor and Board of Aldermen met pursuant to a recess of February 7th, at 4 o'clock P.M., when and where were present the following members: Mayor R.I.. W illiams, Presiding I Alderman Branham Hume, City-at-large

W.T. Chandler, Ward Two

C.S. Haney, Ward Four * * * * * * * * * * * * * * * * * * *

H.G. Bell, Deputy Clerk

After the meeting had been opened according to lay, the following business was had to-wit:

Upon motion made and seconded, it was ordered that this Board do now recess until 5 o'clock P.M., Friday, February 10, 1939. * CONTIN= FROM PAGE 152

Motion made by T.E. Avent and seconded by W.T. Chandler that the Band Master be paid at the rate of $40.00 per month for five months as set up in budget and the balance of the year to be taken out of Light and Aster Fund as $40.00 per month. Those voting "yea" were T.E. Avent and W.T. Chandler. Those voting "nay" were B.O. Elliott, C.S. Haney and Branham Hume.

Motion made by C.S. Haney that Band Master be paid $40.00 for the month of February, seconded by B.O. Elliott. Those voting "yea" were C.S. Haney, B.O. Elliott, and Branham Hume. Those voting "nay" were none.

Superintendent R.H. Gillespie of Grammar School presented the following statement to the Mayor and Board of Aldermen as follows: The Board of Trustees the Oxford Elementary School acknowledges the request from the Bokxd of Aldermen of Oxford to consider the matter of the school taking over the band. During January a survey was made of the manner bands are being handled in other towns in the state in size comparable to Oxford. Out of 20 questionnaires sent out, 18 replies were received. In all cases the bands were under the control and jurisdiction of the School Boards, being considered parts of the respective school programs. Financing was varied. In most cases some part of the cost was in the school budget. Usually funds were furnished by combinations of the school, the town, the county end individual tuition. Most of the towns with the strongest band programs charged no individual tuition.

It is the opinion of the Local school board that the ideal set-up for any band whose membership is limited to school pupils is that it function as a pert of the school program under the control of the school authorities and that the opportunity for band instruction be given equally to all the school children without tuition. The development of such a program in Oxford must naturally be en a collaborative basis with the University high School. It is highly impracticable to undertake a change in the bend in the middle of the school year, even if the budgets of the High School and the Grammar School would permit, which in the case of the Grammar School, at least, does not permit. Should the Board of Aldermen request it, the local school boadd will confer with all interested parties and discuss with the University High School a feasible and co-operative band program in time for the next school year. Signed: J.R. wilson, H.D. Webster, R.S. Myere,Will Lewis, SW R.V. Black was absent.

REFERRED TO PAGE 152. * * * * * * * * * * * * * 157

RECESSED MEETING FEBRUARY 10, 1939

The Mayor and Board of Aldermen met pursuant to a recess of February 9th, 1939, at 5 o'clock P.M., when and where were present the following members:

Mayor R.X. Williams, Presiding

Branham Hume, Alderman at-large W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney LC. Bell, Deputy Clerk

,("J After the business had been opened according to law, the following business C\2 was had to-wit: LL-4 On motion. madeyby E.O. Elliott and seconded by W.T. Chandler, it was ordered that tames T. Canizaro, Architect, be instructed to secure prices to include sidewalks, landscape and drives for the city hall. If same meets approval c of Board same to be included as a "Change Order" dna the City Hall Project 1220-F also, to secure price to paint floors not covered by linoleum, paint pipes and radiators and get price on lead covered cable for underground feeder from main line to switch. * ** * ** * *K* * * * * **

Upon motion made by C.S. Haney and seconded by B.O. Elliott, Mr. C.E. Harrison, was ordered to secure price On -Aires for flusher and submit same to the Board. * * * * * * * * * * * * * * * * *

It is ordered by the Adayor and Board of Aldermen of the municipality of Oxford, missisrippi, that the Mayor, R.X. wiliiams, of said municipality execute for and on behalf of said mu nicipelity a quit claim deed conveying to §allie Bell Duncan a portion of sa street lying in said Oxford described as follows, to- wit: All of that part of a certain street shown on city maps lying between Lots 206 on the west, and 149 on the east, that may be lying west of a line running parallel with, and 272 floeatIn east of tie east line of North Lamar Street, this line is now evidenced by hedgerowASuneeinn the north and south ends with extensions eastward of the north and south lines, respectively, of city Lot 206, in Section 21, Township 8, Range 3. And the residue of said street said Mayor is direCted to convey by quit claim deed and execute same to J.R. Rothchild and 1314. Roberts, said residue of said street being described as follows, to-wit: All_of the remaining part of said street lying between 206 on the west and 149 on the eastit5eitionR21, Township 8, Range 3, provided the grantees pay all expenses incident thereto. * * * * * * * * * * * * * *

Whereas, the M4yor and Beard of Aldermen of the municipality of Oxford, Lafayette County, Misaissippi, desire to offer for sale, and sell to the highest bidder for cash, the following described real estate belonging to said municipality situated, lying and being in Oxford, county and state aforesaid, to wit:

Parcel 1.

Beginning at a point on VanBuren avenue(L.apty-trine-forett-and—titree---laehere) east of the Northwest corner of the East half of Lot No. 3, Block E, as same is laid down and designated on the official Map of said municipality; thence south parallel with east line of said Block E 132 feet to the North line of Harrison Avenue; thence Oast along the North line of Harrison Avenue a distance of 5.6 feat;, thence. North parallel with the west line of this parcel of land being described a distance of 132 feet to the south line of Vianiruren Avenue; thence west along south'boundary or line of Vanburen Avenue a distance of a l3 feet to the point- of beginning, con.;

• :14 ;141;j1 i' ibiiikaWi,L) 158 RECESSED MYETING FFITRUARY 10, 1939

taining in this narce126/6squere feet more or less. This percel hie the present Mayor': criee :fleeted on it and is bounded as fellows: On the North by Van Buren Avenue; on the east b, the east line of the east wall of said Mayor's office building, exie3 77Yall the way across from Van Bureun Avenue to Harrison Avenue; on the south by Harrison Avenue; and on the west by the east line of the building now occupied by Golden Itule Store extenddd all the way cross from Van Buren Avenue to Harrison Avenue.

Parcel No. 2.

Beginning at the Northeast corner of city lot 16; thence soutp along the east line of said Lot 16 a distance ofkSS- feet; thence westizAefeet is=ratXgT 7 to 4tErliouthlliiro of Let 'i6: thence Nort 17). parallel to thdleast line of this parcel of land being described a distance ofP,3feet to the north line of said Lot 16; thence East along the "orth line of said Lot 16 a distance of4A/ feet to the point of beginning, containing in said parceln7osayare- feet mere or less; This parcel of land is bounded as follows: On the North by Van Buren Avenue; on the east by a closed street; on the south by T.B. Brown's mule barn lift; and on the west by the rest line of J.B. Brown's Mule barn-40 08, extended to Van Buren Avenue. The city is reserving land for a street between these two parcels. Both parcels of land are in Lot 16, Section 21, Township 8, Range three rest, as shown on Map of said municipality of Oxford, said county and State.

It is therefore, ordered by scid Mayor and Board of Aldermen, that notice be given to all persons interested in purchasing said lands, the notice to be given as required by law, that said Mayor and Board of Aldermen will receive sealed bids for the purchase of said property, same to be filed in the office of the Mayor of said Municipality, up and until 12 o'clock Noon the 20th day of March, A.D. 1939, the bidder to bid on the two parcels of land separately and on the sake as a whole.

The Mayor and Board of Aldermen reserve the right to reject any and all bids;'and if they accept a bid they will accept the highest bid offered for said property, but at the same time reserve the right to accept the highest bid for eith parcel or the highest bid for both parcels of said land. All bids must be for cash.

* * * * * 4: * *. * * * * * * * * * *

Upon Motion duly made and seconded; it was ordered that this Board do now recess until Thursday, February 16th, at 5 o'clock P.m. REWESSED1MITING FEBRUARY 16, 1939

The Mayor and Board of Aldermen met pursuant to a recess of February 10, 1939 at 5 o'clock P.M., when and where were present the foebowing members:

R.x. Williams, Mayor Presiding Branham Hume, Alderman at large Arent, Alderman Ward one W.T. Chandler, Alderman Ward TWo B.O. Elliott, Alderman Ward Three

C.S. Raney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk L.C. Andrews, City Attorney S.M. Keel, marshal.

After the meeting had been opened according to law, the following busies*s was had to-wit: Vibe minutes of the Recessed meeting of February 10, 1939, were read and upon motion made by T.E. Arent and seconded by B.O. Elliott, they were adopted. * * * * * * * * * * * ** * * *

A RESOLITIONEXTEMIN3 TB! TIME CM TEE GRAMMAR SCHOOL, DOCKET 1219.PDS OXFORD, MISSISSIPPI.

WESEJAA4 it appears that the City of Oxford made application to the Public Works Administration Authorities for a grant for the coestOuction of and addition to the present grammar school Building and equipping same for the City of Oxford, Lafayette County, Mississippi. WHEREAS, it appears this project was approved and great made and the building non 44er construction and that the completion date is December 31, 1939. IBEREASt'it appears since the contract document give the contractor thirty days to install his equippmeat and his work order was not given until December 20, 1938, ead,beenuee,mset of the-furniture had to be built special to meet the re.- quirements,of then contrast and due to the fact that some of the furniture did net meet requirements antspecifications ,and-mnst be replaced after it had been installed and,the resident enginner inspector has reported the Docket substantial complete is of 1-Tomuary 30, 1939. TEERZWORE be it resolved that February 28th, 1939, for the completion of roplsooment 6f certain items of furniture and clearing all records with the final report, audit, grant requisition ' etc be granted as the completion date, is hereby.- requested by the Federal Emergeacy Administration of Public Works. * * * * * * * * * * * * * * * * * *

Upon motion made by B.O. Elliott and seconded by Branham Rums, it was ordered and agreed that the Cibtractor, Walter L. Perry Construction Company, on the'City Hall, Docket 1220-F, paint all floors in main building, both un- stairs, Asia floor and stairways not covered by linoleumw -f6t the sus of *0.00. Also, to paint all pipes and radiators at the cost of $69.50. Above was unanimously carried. * * * * ** * * * * * * * * * * * * * *

-Wee motion made and seconded it was ordered that this Beard de recess until Friday, ItWusry 17, 1939, at,10 o'clock A.M. 1 6 0

RECESSED MEETING raIRUARY 17...193;9. ;

The Mayor and Beard of Aldermen not pursuant to a recess of February 16th, 1939, at 10 o'clock A.M. when and where were present the following members: R.X. Williams, Mayor Presiding Branham Hume, Alderman at large W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman:Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * *.,* * * * * *

H.C. Bell . Deputy 'Clerk

After the business had been opened aceerdin to law, the following business was had teswit:

Upon motion made 1):. C.S. Haney and seconded by W.T. Chandler, that Head be allowed $50.00 on expenses en trip to Band Contest in Jackson out of Advertising, from the 40o-ratite Fund. That Mayer R.X. Williams and C.S. Haney be appointed as CcomMittee-to - confer With Band Mothers with reference to operating a Sunday picture shows or other means to take care of purchase of additional band uniforms. TheTOity agreeing to underwrite the amount in order that uniforms lag be purchaied for State Bandacatest. The above metimawas made and unanimously adopted.

* * * * * * * * * * * * * * * * *

Motion mode by Alderman Branham Hume and seconded by Alderman B.O. Elliott that thee/A, fungi& convict labor to-help in: making and installing screens en mesquiteweampain is cooperation of State Malaria Cpatrol and County Health Unit, The above motionwas made and unanimously carried. * * * * * * * * * * * * * *

Upon motion made by Alderman Hume and seconded by ilderman Ellie*t, if unable to get WPA to repair University Avenue and other streets that the City *sr for salariesjitichicVthe-State Highway Department to do lab work.- :4- * * * * * * * * * * * * * *

The Mayor and Board of Aldermen de hereby instruct J.T. 1Z:salaam Architect, on City Hall PIA Docket 1220-F, to file change order with the PWA Authroities for the enastructien of sidewalks and drive-way as outlined on blue prints submitted to the Bead& for Approval and for painting concrete floors, radiators, pipes and installing lead cable and conduit for service line provided it can be done within the money sot-up in the original project. The above motion made and unanimously carried. * * * * * * ** * * * * *** * 161 .e4 amain) murnmo FEBRUARY 17, 1939 .

SCHOOL FUND

850.Beckley-Cardy, Repairs and replacements- $13.22 851. Kirkpatrick Coal Co., Fuel $71.62 852.Jones Produce Company, Fuel $22.25 853.W.W. BPummett, Fuel $21.20 854.Bhapliegh Hardware, Lights, water, etc $2.50 .RieahmanoCrosby, Iaght e .water, etc $5.00 85b. A.C.' MOGlurg Co., Janitors supplies $11.57 857. W.Y. McIntosh, Materials for Inst. .. $29.74 558. Frederick Disinfectant Co., Janitor supplies 1::5g 2g. J.A. Martin, Jr., Materials for Inst. 5 8 44 A.D. "iley, • • * $1.00 861.B.C. Toof Company, Supt office expenses ---$13.86 862.Coors Variety Store, • 0 _ • $2.76 849. Claudia Thomas, Maid for Jan. $15.00 3. Gaylord Borthers, Library 864. Webster Publishing Co., Library "TO . Bureau of Publication, Library $10.60 822. R.B. Gillespie, Repairs and replacements $13.37 867.Z.M. Pegues, • • • $3900 868.Stratton Warren hardware Co., Repairs- • $21.00 869.Backer-Taylor Co., Library $6.47 $377.74 Upon motion made and seconded, the,abombills were allowed.

Ups* motion made and secended„ it was ordered that this Beard de *w adjeura sine die.

/44 u/.4:<&42-r-t_e-t-t, _Clerk

1 R2

MARCH 7th, 1939 REGULAR MEETING

UNITEDSTATES OF AMERICA * STATE OF MISSISSIPPI COUENTY OF LAFAYETTE

CITY OF OXFORD 4 939

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford Mississippi, met in Regular Session at the Meyor's office at 7:30 P.M. o'clock Tuesday, March 7th, 1939, it being the time and place fixed by law for the holding of said meeting, when and where were present the following members: Mayor, R.X. Williams, Presiding

Branham Hume, Aldermen at large T.E. Avent, Alderman Ward One W.T. Chandler, Alderman Ward Teo

B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Ward Four

* * * * * * ** * * * * * * * * * * * * *

L.G. Andrews, City Attorney, H.O. Bell, Deputy Clerk Sam Keel, Marshal After the meeting had been opened according to lmw, the following business was transacted:- Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants issue accordingly. From the

CORPORATION FUND

4, R.K.Williams, Mayor, February salary 180.00 89 .Branham Hume, Alderman, " 10.00 899. T.E. Avant, • • 10.00 900.W.T. Chandler, " • • $10.00 901.B.O. Elliott, " • • $10.00 902.0.2. Haney, 0 • • $10.00 903. H.0. nell, Dpputy Clerk, February salary $37.50 904.Lillian Jones, Secretary, " 0 $40.00 905•Sam Keel, Marshal, February salary $125.00 906.Duff Davis, Night watchman, February salary $100.00 907. L.C. Andrews, Attorney,February salary *40.00 906. R.N. Whitfield, Band master, February salary 440.00 909.Mrs. O.E. Holcomb, Aostron, February salary $20.00 910.G.E. Thorn, Rep. to typewriter- $6.50 911. Patton-iourtnye Hardware Oomppnu, supplies .20 912.Davis-Mize Oompanyv Supplies $8.50 913.Coors Variety Store, office supplies $4.75

REUULAR MEETING,.... MARCH 7th, h939,

COW:RATION FUND ( Continued)

914.. Jones Produce Company, Fuel 410.05 915.L.G. Lynch, Fuel $37.92 916.Hughes Hardware Company, Supplies $4.32 917.F.W. Belk, Fire truck service, etc $43.15 916. C.B. Harrison, Chief and 20 firemen $31.50 919.Walter D. "vitt., Engineer for Feb. $48.25 920.T.D. Herndon, Supplies 921.U.S, Sept. of Agriculture, Rat poison 41: 922.Wapital City Welding & Machine Works, Supplies-416.32 923.Tom Li Hatchings, Office supplies- $13.35 '924. Hlue'Print & Supply Co., Office supplies $4.10 925. Hederman Brothers, Office supplies $3.88 926, George D. Barnard, office supplies $10.72 27. American Is France Foamite Inds.,supplies ------$ . 928.College Inn, Fireman's banquet $18. 929.Kirkpatrick Coal Company, Fuel $5.92 930• Illinois Central Railroad Co., Freight 410.20 931.N.O. Nelson Company, Sundry $2. 932.Lighting Fixture & Electric Supply, supplies--433.31 933.B.A.•Mbore 7 days work - 411.67 934.Bohn•Murp14.0y. Fire department supplies 935.Oxford Insurance Company, Premium on bond Z..)((55) `942.32

STREET FUND

936.S.Z. Spears, Foreman, February salary 937.John Hurphrey, Rep. to truck 936.Buffaloe-Harmon, Uniform a:caps $62.47*52.; 939. Patton-Courtney, Sundry #1.34 940. Oxford Repair Works, Cutting stencil

941. F.W. balk, Bapl to *ruck " 10. 0 942. Hughes Hardware Company, Supplies .63 943. Cl. Slough, Expense in Posey case .40 944. Bob Davis, Special police .00 945. LA. Lynch, - Gas and oil- $28.40 9 . Porter WArdware - Caspany, Supplies $4.09 947. W.T. Jones, Eloping city prisoners $56.50 946. Pittsburgh Plat4 Glass Company, Supplies $14.79 949.C.G. Huggins, Bop. to truck 950.International Harvester Company, Rep. to truck 1.260 5I.Ricehman Crosby Company, sundry • 347. REGULAR MEETING, MARCH 7th, 1939

SCHOOL FUND

952. O.D. Smith, Pro rate share 61, Feb. salary $24.00 953.Will Isom, Feb. salary for janitor $50.00 954. Claudia Thompson, Janitor for February $1 .00 955. W.P. palsy, Hauling coal 956. Kirkpatrick coal company, Fuel 7 . 2 957. Illinois Central Railroad Company, freight on foul $116.38 958.B.F. Shultz, Repair and replacements $2.50 9 9. R•H• Gillespie, Laundry, envelopes, postage $27.36 960. Hughes Hardware Company, Repairs 464.26 961.Patton-Courtney, Repairs $12.87 962. Davis-Mize Compan*, Supplies $2.50 963.Hughes Hardware Company, Supplies $16.91 964.Kirsch Company, Audtitorium improvements $35.3 965.Na Knight and McKnight, Library .90 966.Pittsburgh date Glass Company, Repairs and replacemtns $31.95 967.Public Schoo. Publishing Company, office expense $13.05 96C. Vestal Chemical Isaboratories, Janitor supplies $28.05 969. Farrell Calhoum, Repairs'and replacements 49.00 970. National Gepgraphic Society, Library expense $3.00 971. Z.A. MartinV Jr., Material for Inst. $5.30 972. C.A. Gregory, Administrative expense $11.52 973. National Disinfectant Company, Janitor supplies 44.11 974. Hughes Hardware Company, Material for Inst. $2.72 975. George Mason, Repairs and replacements 976. M. Collier and son, Library :2TC715 LIGHT AND WATER FUND

977.C.E. Harrison, Supt., February salary $245.00 978. G.W. Johnson, Engineer for February $125.00 9 • A.L. Mullins, 0 - * * 980.Louis Campbell, * ° " * :10;10) 981.Howard Win'er, Lineman, for February $105.00 982.H.C. Bell, Deputy Clerk for Fabruaryp $37.50 983.H.A. Moore, 7 days - work $11.66 984.Lillian Jones, Secretary for February $40.00 912. T.A. Dunn, Rent for February $50 00_ 9, *S. Lillie Yates , Rent for Bebruary $ 0 00 987. B.S. Guyton, Rent for February $5.00 966. Hughes Hardware Company, small supplies and hardware $4.5 989.Patton Courtney Hardware, Small supplies and hardware $5.26 990.Arkansas Aull Oil Company, Fuel Oil $507.06 991.444 service station,,sundry $2.50 992.7. . Belk's Garage, Sundry---- 993. Tennessee Valley Electric Company, Electric supplies $31.21 994.Worthington Pump & Machinery Corporation, Repairs 995.General ElectricEl Supply Corp., Electric supplies- ilaili 996, Graybar, Electrical supplies $ 2,44g 997. Texas Company, Gas and oil Vb. 998• De La Vargas Engine Company, Repairs $94.50 999. Pidgeon Thomas Iron Company, Water supplies $13.10 1000. Westinghouse, Electrical supplies $37.24

1. :.E. Dilworth Company, Water supplies - V10.0 3 2. Lewis Supply Corp.m Water supplies 429.41 3. Standard Oil Company, Electrical supplies $1.93 4. L.G. Lynch, Gas and oil $5.62 5. American Sand-Barnum, Sundry $30.58 6. Crane Company, Water supplies $23.5L 7. Westinghouse, Electrical supplies $3.00 16,11eohnon Crosby, Sundry $12.48 9. Oxford Insurance Company, Premium on bond yr -airj4..55 2298.05 165 REGULAR MEETING, MARCH 7th, 1939

On motion of Alderman Hums and seconded by Alderman Elliott that the Deputy Clerk be instructed to write Mr. M.M. Winkler, that he or he to have his assistsviaset with the Board at its Recess meeting Monday Night, March 13th, at ?.3D _a[., to go over his last audit; explaining some in detail. * * * * * * * * * * * * * * * * * * * * * * *

MnAAtmahafitephenspnelireninSintgalroailtryyraisdarrmaisfito.Ortftistaulta4614 Linda Fase eppenrodabbdomi ltbeeleadd and petitioned the city to deed to D.I. Sultan tW49# part of a dead street running north and south between lots Nogi. 138 and 150. Linda laser On motion duly made by Alderman W.T. Chandler, and seconded by Alderman Avant, it was ordered that the Mayor, of said municipality execute for and on behalf of siad municipality a quit claim deed to said street. * * * * * * * * * * * * * * * * * * *

Mr. Smith with the Arkansas Fuel Oil Company jresented to the Board W. Bowman representing said ampnay, who brought before the Board the matter of securing righlfrom the city to build a filling station'on lot purchased by them on South Lamar Street. He stated to the Board the amo •r money they in-

tended *pending on said building, grounds, land scaping,etc., ' what action they would have to take secure permission to btild'said Statiok. The Board advised "tr. Bowman they would take the matter under discussion and advise their finding. The Board failed to take any action. * * * * * * * * * * * * * * * * *

Ida Greenlee appeared before the Board in the matter of over assessment or error in assessment of her property. On motion-by Alderman Arent and seconded by Alderman Chandler that the Mayor appoint a committee to examine and re-assess said property and report at next meeting. Thefelbwe-motionwas carried. The Mayor appointed Alderman Elliott, Hume and Chandler on said Committee. * * * * * * * * * * * * * * * * *- * * * * * * * * *

Mr. L.O. Lynch, appeared before the Board with an appeal that the East fraction of Lot 473,.21-8-3, assessed at $300.00 separately from' his homestead lots, Fr. 486, 04, 485, 214-3, assessed at $3000.011.- On motion of Aldermen Avant and seconded b Aldermah Chandler that these two assessments br assessed on the books as one unit at valuation of $3500100.ealhe above motion was carried. * * * * * * * * * * * * * * * *--* *,20 * * * **

In the matter of deed to said L.G. Lynch on lot sold to him on North Lamar by the City of Oxford. Deputy Clerk ordered to check the minutes and see if the Board had not already ordered that deed to said property be executed. If not that the Mayor R.X. Williams, and Deputy Clerk R.C. Bell - be-emposered to execute quit claim deed El siad L.G. Lynch to said Lot. Motion to this effect made br Alders .and was passed.> * * * * * * * * * * - * * * * * * * * * * * * *

Came on for consideration in assessment of store and fixtures of Joe Frieda man (The Leader). Upon motion duly made by Alderman Hume and seconded by Alderman Chandler, it was ordered that same be reduced from $5500.00 to #4000.00 due to error. ihe above motion was passed. * * * * * * * * * * * * * * * *

Upon motion dyly made by Alderman Hume and seconded-by Alderman Elliott that the Assessment against R.L. Sullivan house . and'lot beinf fr. Lot 24, be reduced from $3400.00 to.$3000.00 on account of error. The above sctioa was passed. * * * * * * * * * * * * * * * * * * * * * * *

, Upon motion made by Alderman Hume and seconded b Alderman Chandler, it was Ordered that the assessment of W.B. linter stock Ormerchandiee be reduced from $600.00 to $300.00 on account of error in assesmnent. Above motion was unanimously passed. 166 REGULAR. MEETING, MARCH 7th, 1939

On Application of Mr. W.N. Lowrance, asking that the Board make an assessment at this time on his house and lot, N.E. Fr. Lot 43for the year 1939. On motion of Alderman Avant and Seconded b. Alderman Elliott the assessed valuation for year 1939 wqs set at $1800.00. The above motion was passed. * * * * * * * * * * * * * * * * *

In the matter of giving the Mayor and Deputy Clrk authority to pay off notes, bonds and interest when due or maouey available tof rsaid purposes without awaiting the order of the Board. On motion duty made by Alderman Avent and seconded by Alder- man Chandler, authorizing the Mayor and Deputy Clerk , to make said payments in this manner, providing that all notes and interest and bonds and interest be reported at the next regular Board meeting by the Deputy Clerk. The above motion was passed. * * * * * * * * * * * * * * * * * * * * *

In the matter of some eight acres of land adjoining and being a part of the airport site, usable for farm purposes. On motion duly made by Alderman Avent and second-e ed by Alderman Hume, that the Mayoraappoint Alderman Haney, Elliott and Chandler as a Committee to examine, and rent said land to best advantage, entering into contract for the rental of said land, but said rental not to include any land inside of fence around said airport and to report to the Board agreamentthey entered into. The . above motion was this day pabsed. * * * * * * * * * * * * * * * *

The bonds of the Deputy Clerk and Tax Collector, B.C. Bell were presented with Bill of costs to the Board for Approval. Said bonds being written by the United States Fidelity and Guaranty Company of Baltimore v taritland/ On motion dyly made by Alderman Avant and Seconded by Alderman Elliott that the bonds be accepted and account paid. * * * * * * * * * * * * * *

In the matter of petition of W.S. Harkins, through his Attorney, J .W.T. Falkner for allowance of Homestead Exemption on his home on University Avenue being Center of Fr. Lot 73. Said petition having been referred to the Homestead Exemption Di- vision, Jackson, Mississippi, In letter dated March 6th, written. by G.C.. Scutt, Chief Homestead Exemption Division, stated that if the circumstances justified the Board allowing the petition he felt sure that if presented to the °omission for re- imbursement it would be favorably considered. On motion duly made by Alderman Avant and seconded-by Alderman it was ordered that the Homestead Exemption be allowed subject to allotanciteinbursement by the- State Tax Conmission. Above motion was unanimously adopted. * * * * * * * * * * * * * * * * *

Alderman Elliott and Alderman Chandler, as a committee, reported that they had inspected the propertty of E.S. Bramlett, being lots 102,505 and Fr. Lots 54, 554 and that they found only one house and barn on said lots. On motion duly made 21.6.3 by Alderman Elliott and seconded by Alderman Avent, it was ordered that the assessment on said property be reduced from $750.00 to $350.00 on account of error in original assessement. The above motion was passed. * * * * * * * * * * * * * * *

In the matter of taxes and street on VA, S.C. Wall property being Fr. Lots 87.91, 21-8-3. This lot having been advertised for unpaid taxes and street for the year 1931, sold and purchased by the City of Oxford under date of December 5th, 1932. Mr, J.H. Purvis now claims to hold a State Patent for said property and offered to pay the taxes for the year 1938 only to the City Tax Collector, H.C. Bell, on or about the 20th day of February, 1939, stating that he had offered to pay the taxes forth* year 1937 to form City tax Collector, Mr. B.A. Moore, and that said City Tax Collector refused to accept the money in payment of said taxes. Mr. Purvis stated to the Tee Collector, H.C. Bell that the City of °Ilford did not legally advertise said lot and street taxes for the year 1931, therefore, he was not stow liable for same. H.C. Bell, present City Tax Collector asked Mr. Purvis to allow him to hwing this matter to the attention of the Board Wore refusing to accept taxes only for 1938. Be having called at the office severl times prior to our regular March Meeting. On motion duly made by Alderman Avant and seconded by Alderman Hume that the City Tax Collector); be instructed not to accept any taxes oa saitpropert7 unless all back taxes and Street paving assessments were paid in full. The above motion was passed. REGULAR MEETING, MARCH 7th, 1939.

In the mattbr of the Farm Security Administration request that the Mayor and Boarding* imvitatioOt kid and acceptance on the rental of the present Mayor's office building: to the said Fars Security Administration, Sabimet to the property being sold. On motion of Aldermen Elliott and seconded by AldermanAvent that the Board take no action in renting_of_said.office until-after the 20th of March, on which ware asked on the sale of said property. The above motion. was passed. . * * * * * * * * * * * * * * * * * *

In the matter of retiring the Water Flusher. On bids asked the only bid received was from Z.B. Carpenter and Son, Pontotoc, Mississippi, dated 2/27/39, Their bid on non-skid type Firestone tire, 32 x 5, $51.28 mounted in Memphis. On other type tire 32 x 5 suitable'where pulled by trailer $44493 mounted in lieRags. (*motion duly made'by Alderman Avent and seconded by Alderman 4 ElZtOtt that the City have lie tire mounted at the price of $44.93 mounted in Memphis. The above motion was carried. * * * * * * * * * * * * * * *

On application of John C. Hull, as Janitor for New:oity-hall, and Lorene R. Brown as City fireman driver of fire truck/ On motion duly made by Alderman Chandler and seconded by Alderman Bums that base be passed to the next regular meeting of the Board. The above motion was passed. C./ * * * * * * * * * * * * * * In the matter of renting the office space on the second floor of the New City. Hall. The deputy Clerk read an offer from the'Missispippl'Higbwey Depart - ment offering rental of $40.00 per month for seven of the offices. The application of the WPA•for use of the office space on the second floor:being presented by Mayor Williams. After this matter had been discussed,-At was mowed by Alder- man Hume and seconded by Alderman Chandler that the entire epee* on the second floor of the Mew City Mall be allotted to the WPA. The above-motion was carried. * * * * * * * * * * * * * *

The matter of re-zoning the City streets was brought to the attention of the Board by mayor Williams, and letters were read from the Commissioner of Public Safety, Iacktow, Mississippi, and National Safety Council, Chicago, Illinois. The Board failed to take any action. * * * • * * * * * * * * * * * *

In the matter of accepting the Asphalt Tile Floors in the New City Hell as laid, On a motion duly made by Alderman E lliott and Weconded by Alderman Haney, that the floors be accepted on approval of the Architect and.the) 14.0-42+04, Board. The above motion was carried. * * * * * * * * * * * * * *

Alderman Raney, on behalf of Mrs. J.W. Shelton, presented to the Board a proposition from the Board of Supervisor* of Lafayette County, that they would agree to assume and pay one half of the present debt on the Community House, if the City of Oxford would assume and pay one half of same. The total debt being $853.27. On motion duly made by Alderman Chandler and seconded by Alderman Bums that the City of Oxford would agree to pay one half of the amount of 4826.63. One half to be paid by the City amounting to $826.62, if the Board of Supervisors would pay iheir half; this with the under standing that the Community House would repay to the City of Oxford the expense that the City of Oxford bad incurred in the plumbing and lighting fixture said building from time to time as they were able to secure the funds. This account amounting to same $233.00. The aboveqmotion was carried. * * * * * * * * * * * * * * * * *

4 petition being presented by the Congregation Of St. Peter's Episcopal Church of Oxford, asking that a side walk be built by the City on the North side of Tan Buren Street from the property of the Ritz Theatre to 9th Street signed by Miss Kate Skipwith and some nineteen others. On motion duly made by Alderman Name and seconded by Aldermakpandler that if the city were unable to get this lirede walk included in a grant now being worked up, within a reasonable length of time that the City would build said sidewalk and that the Deputy Clerk be instructed to write a letter'to Miss Ka Skipwith to this effect. The above motion was passed.

L 168 REGULM MEETING? MARCH 7th, 1939

It was brought to the attention of the Board the matter of re-marking all streets on the side of the curlier. On motion duly made? by Alderman Hune and seconded by Alderman Chandler that the City use WPA labor and that the city furnish the necessary materials and stencils and that the streets namee be remarked on the turbo. The above motion was passed. * * * * * * * * * * * * * * * * * *

Mr. Keel brought to the Boarde attention the question as to what to do about stray dom. Same was referred to Sitytattorney, L.C. Andrews. In the matter

of parking horses and wagons on the rites parking lot, this . matter was deferred until the lot adjoining Mayor's office had been cleaned off. * * * * * * * * * * * * * * * * *

It was reported that the Pound Keeper, Mr. Neely Lovelady, did not feel that the income would warrant his paying one half the expense of the telephone account. The same was passed until the Recessed meeting of this Board of March 13th, 1939 * * * * * * * * * * * * * * *

It was brought to the Board's attention by Mr. Keel the advisability of having a man in charge of the Yates Parking lot on Saturdays, to handle the parking. On motion duly made by Alderman Thum and seconded by Alderman Haney that Bob Davis be transferred from duty o* the square and put on duty on the Yates Parking lot Saturdaey, reporting for duty at 8 A.M. and remaining until 6 P.M. at same wages being paid at present, being $2.00 per day, for the next thirty days and that the night watchman, Duff Davis, report for duty on the square at one o'clock PleM. Saturdays instead of 6 P.M., The above motion was this day passed. * * * * * * * * * * * * * * *

In the matter of new trucks for the Street Department and Light and Water Department. On motion duly math by Alderman Baum and seconded by Alderman Haney that the ayor appoint a committee to draw up specifications on one truck for the Street Departmentwit0 the present dump body installed on new truck and one truck for the Light and:Water Department and a general Utility Body for the lint and Wgter Department truck and that they submit same to Attorney Andrews, City Attorney, to draw up proper advertisement for publication and ewe be published asking for dike. Specifications to be filed at the Mayor's office and each bid to be accompanied by a certified check for 5% of the amount of said bid. The Mayor in turn appointed on the committee Mr. C.E. Harrison, Mrs.C.S. Haney and Mr. S.E. Spears. The above motion was passed. * * * * * * * * * * * * * *

On motion duly made matxanxxialat by Alderman Hume and seconded by Alderman Elliott and carried that the Board tic) not rent the one acre of abeonatbon ground back of Mrs. Siveley's place. * * * * * * * * * * * * * * *

Upon motion duly made and carried, it was ordered that this Board do now recess until Monday, March 13th, 1939, at 7:30 P.M. o'clock 169 RECESSED MEETING MONDAY, MARCH 13th, 1939

The Mayor and Hoard of Aldermen met pursuant to a recess order of March 7th, 1939, at 7:30 o'clock P.M., when and where were present the following members:

Mayor R.X. Williams,- Presiding Branham Hums, Alderman at large W.T. Chandler, Alderman Ward MI B.O. Elliott, Alderman Ward Three C.S. Haney, Alderman Ward Four * * * * * * * * * * * * * * * * * * * * * * * * * * * LC, Ball, Deputy Clerk L.C. Andrews, Attorney

127) After the meeting had been opened according to law, the following business was had to-wit: c\l Mr. Summerfield, representing Mr. M.M. Winkler, CPA, of TUpillo, explained to the Mayor and Board of,Aldermen their audit of December 31, 1938. The Federal • Power Commission report on the operatton of the tight Plant for the year 1938 was taken up by Mr. Summerfield to consult with Mr. Winkler as to approntmate 4ost of making up this report and to maks proper change on books in order that said report could be taken off of thelbi‘y records in the future by the City

azlimAlsetow- and Mr. C.E. Harrison, Superintendent of thee Light and Water Plant, 2bAsammisktlhocamoended that the Mayor have this report made by Mr. MAL Winkler at cost not to exceed the sum of $50.00. •

* * * * * * * * * * * * * * * * * *

Upon motion made by Alderman Bums and seconded by Alderman Chandler, it was ordered that M.M. Winkler's bill of $150.00 for audit of books to December 31st, 1938, be paid. Ahoy* motion was passed. * * * * * * * * * * * * * * * * *

The application of the Arkansas Fuel Oil Company for permit to erect or construct a service station on Fr. N. * of Lot 3, 28-8-3, located on South Lamar Street in the City of Oxford, owned by said Corporation, it is ordered that application of said permit be and the same is hereby denied. The above motion was passed. * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hums and Seconded by Alderman Chandler Asa* the Mayor write Major T.B. Birdson, Jr., Commissioner of Polio Safety inquiring how soon after the return of the officer attending the Northwestern University Traffic Officer's Training School, could he send this officer to the City of Oxford to assist in re-zoning said streets. The above motion was passed. * * * * * * * * * * * * * * * * * * *

The Board instructed the Mayor to contact Mr. Caldwell to meet with the Board Monday, March 20th, 1939, at 7:30 P.M. with reference to have an areal map made of the City. The above motion was passed. * * * * * * * * * * * * * * * * * On motion duly made by Alderman Elliot and seconded by Alderman Bums that a refund of $4.40 on taxes paid by Reid-MOGee Company of :ackson, Mississippi for Mrs. 1.14 Shelton be made to Reed McGee and Company on account of error, also, that a refund be made to got, Friedman (The Leader), W.B. Winters, B.S. Braalett and W.S. Harkins (Homestead Exemption allowed) equivalent to their reductions as orderded by said Mayor and Board of Aldermen at their regular meet*. ing of March 7th, 1939. Above motion passed. * * * * * * * * * * * * * * 170 RECESSED MEETING, MARCH 13th, 1939

On motion duly made by Alderman Elliott and seconded b Alderman Chandler et was ordered that the bill of Malone and. Son for the sum of $24.00 for meat for rat poision be paid tibeetitie. Above motion passed. . * * * * * * * * * * * * * * * * * Bids for the Depository for City of Oxford were received and read from the First National Bank and Bank of Oxford. On motion duly made by Alderman Chandler and seconded b Alderman Elliott that the Bank of Word bid be accepted as Depository for all funds of the City of Oxford for the year 1939 end that they be so notified. Above motion passed. * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott it was ordered that the Mayor R.X. Williams, attend the meeting to be held in Jackson, Mississippi, March 14th and 15th on a Master Airport Plan for Mississippi, with any other aldermen desiring to attend said meeting, toward -havinggthe airport of Oxford included in proposed plan. The expense of said grip to be charged to the Mayor's Traveling fund. Above motion passed. * * * * * * * * * * * * * * * * *

Upon motion made by Alderman Hume and seconded by Alderman Chandler that the City of oxford purchase from the U.S. Public Bealth service, Washington, D.C., 500 folders on syphilis at cost of $1.00 per hundred, same to be destrib- used through Mayor's office and colored schbol. The above motion was passed. * * * * * * * * * * * * * * * * * * *

Alderman Elliott, Chandler and Hume committee appointed to re-appraise the property of Ida Greenlee, reported and recommended that the two houses on Fr. Lot 55(not homestead) assessed at $900.00 each, be reduced to $600 each, making total assessment read $3000 instead of ;3600.00. * * * * * * * * f * * * * * * * * * * *

On, motion duly made Alderman Chandler and Elliott and seconded by Alderman Hume_that *he above reduction in assessment be made on account of error made in the firdrassesement. Above motion was passed, * * * * * * * * * * * * * * *

The committee on renting of some eight acres of land at airport were not ready to report. * * * * * * * * * * * * * * On motion duly made by Alderman Elliott and seconded. by Alderman Eaney, it was ordered that the attorney, LWZ.Andrems drwe up an agreement with Mr. C.J. Leehorn, owner of aturrAWItel, preteettngreheagttylfmewtdenagem from VlbankrfidelefritheosekeraigerpoieeetiolefOr the new addition to the Henry Hotel and if Mr. Lawhorn would sign said agreement that Mr. Harrison be instructed to make said sewerage with the sewerage on Van Buren Street. Above motion was passed.

Upon motion duly made and passed, it was ordered that this Board do now recess until Monday, March 20th, at 7:30 o'clock P.M. MARCH IN), 1939 RECESSED MEETEN3r OXFORD, MISSISSIPPI The Mayor and Board of Aldermen of City of Oxford met puneuant to the foregoing recess order of a Recess Meeting of March 13th, 1939, at 7:30 P.M., 1939, when end where the following were present:

Mayor R.X. Williams ;residing Branham Hums, Alderman At Large T.E. Amsnt, Alderman Ward One ' W.T. Chandler, Alderman Ward Two B.O. Elliott, Alderman Ward Three C.B. Haney, Alderman Ward Four * * * * * * * * * * * * * * * * * * * * * * * * * * *

L. O. Andrews, Attorney H.C. Bell, Deputy Clerk

C4 After the meeting had been opened according to law, the following business was transacted: Appeared before said Board one, June Lovelady, representing his father, Neely Lovelady, city Pound Keeper, petitioning the city to assume all expense of installing and monthly rental of Telephone. On Option made by Alderman Elliott and seconded by Aldermen Haney that the city assume all expense of allophone, at residence of Neely Lovelady and that all stray dogs be included in animals to be taken up by pound Keeper, under rules and regulations of State Law. The above motion was passed. * * * * * * * * * * * * * * * * *

Mr. Charles W. Burke appeared before the Board presenting a plan to uncover local thievery, also, to tear gas gun•to be used by officers in apprehinding in Criminals. On motion of Alderman Avent and seconded by Alderman Haney the Deputy Clerk was instructed to Wareham 1000 of the circular letters , atAwst of $17.00 same to be distributed by the said Mt. Burke throughout the city. .The, above motion was passed. * * * '21t * * * * * * * * * * * * * * * *

W.L. ilda 1 at the re uest of the Boa • appears b hte ma maki off cal ma • of he city of explained in d ail sa SU tted rd Comer of motion duly made that the May anti Sr ffi- oi map y 0• Oxfo wiPP ; • 17 signed to 0 ke * in ffice) consisting , f three p k pa • and ra c >pica. , bond pa er, at the rice of .00(Three hundred my Dollar The *Woe •tion w s passed. * * * * * * * * * * * * ** * * * *

Owens and gibbons request for electric light line to old Ice-Plant deferred to next regular meeting. * * * * * * * * * * * * * *

4Pplication of Bennie Crocket far driver of fire truck deferred` to next regular meeting. * * * * * * * * * * * * * * * Gams on for consideration the Ws snbmitted ',ratite sale of real Estate(being present Mayor office and vacant lot adjacent thereto) the following bids were opened by the Deputy clerk and read to the Msyar and Boerd. D.A. Higdon, Parcel No. 1 $128040 W.W. Phillips, Parcel Mb. 1 .co Parcel NO. 1 and .03 Parcel No. .00 Z.B. Brown, Parcel No. 1 $1529.15 Parcel No. 2 $3035.25 Parcel Nos. 1 md 446oci.90

4 72 MARCH 20, 193g. RECESSED MEETIN3A

Lynch, Parcel No. 1- $1750.00

On motion duly made by Alderman Avent and seconded by Alderman Elliott it was ordered that the Board reject all bids and re-advertise the property for sale. The above motion was passed- * * * * * * * * * * * * * * * * * * *

On petition of Fred Wallace for re-assessment of his home, being the S.E. fr. Lot 32, 28-8-3, assessed at $1250.00 and application of Homestead Exemption being dis- allowed on account of his not occupying said premises on the first day of January, 1938, said petition stating that he was occupying same on.January 1st, 1938, and for several months thereafter and same being supported by affidavit that he was occupying said pramise6-J as his home It was ordered by the Board that said lred Wallace be slimed the home Stead Exemption on assessed valuation of home of #1250.00 amouut of refund to be $13.75 provided that on presentation of said petition the State Tax Commission same was allowed and city reimbursed. The above motion was unanimously passed. * * * * * * * * * * * * * * * * * * * * * *

The Mayon reported that on account of pressing business engagements he was unable to attend the meeting in Jackson on "luster Airport Plan for Mississippi" and had called Mr. E.L. Sullivan to represent Oxford at this meeting on March 15th. Mr. Sullivan attenddd the meeting and reported to the Mayor, stating that there would be another meeting in Jackeon on April 12th and Mr. Sullivan suggested the importance of attendance at this meeting. On motion duly made by Alderman Chandler and seconded by Alderman Hume that the Mayor attend*thia tooting and invite Chancellor Butts to attend said meeting as well as any others that could arrange to. attend. * * * * * * * * * * * * * * * * * *

Alderman Avent left the meeting at this time. * * * * * * * * * * * * * * * * *

Came on before the Board the matter of office space rented by Lafayette County in building of B.S. Guyton over H.D. Webster do Co. store for the use of the farm Security at monthly rental of $40.00 per month. On motion duly made by Alderman Mime it was ordered that the city pay one half or $20.00 per month of this rent until further ordered by the Board. Same being put to vote, the vote was as follows: Those voting in favor of said motion were Aldermen Chandler and Alderman Bone; Those voting against said motion were Aldermen Elliott, Haney. The vote being a tiem the Mayor cast the deciding vote by voting in favor of said Motion. * * * * * * * * * * * * * * * * *

Alderman Chandler left the meeting at this time. * * * * * * * * * * * * * * * * *

Came on for consideration the dismantling of the old Public School building. On motion duly made by Alderman Hume and seconded by Alderman Ailliott that the Mayor 4044 Board endeavor to secure a EPA project, to dismantle said building in connection *oh the erection of a new building on another site, or, if necessary to use any CVtion or all of the material usable in said building, in the erection of the sium on the University High School grounds, said gymnasium being a WPA ject. The above motion was passed. * * * * * * * * * * * * * * * * *

173 MESSED MEETING - MARCH 20, 1939 (This should appear on page 171, before any Aldermen left.) Be it ordained by the Mayor and Board of Aldermen that W.L. Caldwell be ordered and is hereby employed to maksan offici I nap o the City of Oxford in accordvtellwathe gy.oziAtiCttry.ct :

CITY OF OXFORD, MISSISSIPPI With W.I. CALDWELL This contract and agreement, made and entered into on the 4th day of April, 193$ by and between the City of Oxford, Mississippi by R.I. Williams, Mayor and Boo, 21liott, City Clerk thereunto duly empowered as party of the first part and w.L. Caldwell, as party of the second part; witnesseth: That party of the first part has contracted' and employed the party of the second part to construct and ma's as OFFICIAL MAP OF said CITY OF OXFORD, MISSISSIPPI according its present boundaries and measurements, and to be of the following kind, description and contents: (i) That said maeshall be constructed on Linen Backed Paper in plain legible printing, writing, figures and markings. Le'Z C. (2) That said sof shall contain and show each and every official lot, addition 1:•1 and subdivision with lots and blocks of each subdivision and measurements of all lets sheimint:theil. proper place. (3) That said me shall also contain all streets, avenues and alleys (together xt, with their widths plata, shown in feet) where they exist in within City limits of said Oxford, Mississippi. (4) That said map shall be constructed to a uniform scale of 100' on the ground equal one inch of said map and map to be of such height and width as to embrace all of said city contained in its legally Incorporated limits. (5) That upon completion of said map by party of the second part the said map shall be tendered to the Meyer and Bored of Aldermen of said City for a period of one week for acceptance or rejection. During said one week party of the second part agrees to make any ages or alterations party of the first part may deem proper or necessary. (6) when all the above has been complied with party of the second part can then tender said map to said City for final acceptance. (7a) Is consideration of the premise., said party of ,the fiist part con- 'recto and agrees to pay to party of second part the sum of three hundred an‘Seventy Dollar ($ 370.00) in full and final satisfaction foot said map and same is thereupon to become the property of said City of Oxford, Mississippi. (8) Party of second part also agrees to furnish said city two extra copies of said map on linen Back paper, also two extra copies of said map made on Bond paper, one to be put on record in the Chancery Clerk's-office and one for use of City Attorney -of said Oxford, Mississippi. (9) Party of first part also agrees party of second part may have the privilege of selling any copies of the said map he may be able to fin buyers for., Ia witness whOreof, said parties have hereunto set their names and emu. 004,0471 this contract on day andstheeffirst named above. THE CITY OF1IMPORD, MISSISSIPPI

BY lank BY =TT CZ= 4CCIPTED BY DBATIMINAL * * * * * * * * * * * * * * * * * * * * * * *

There being no fnither businesp,:tiabealiaat*eadOtrzsadftestfreadod and OW this Beard does now adjourn sine die.

Mayor 174 REGULAR MEETING

APRIL 4th, 1939 Oxford, MISS. united STATES OF AMERICA STATE OF MISSISSIPPI COUNTY OF LAFAYETTE

CITY OF OXFORD 1939 * * * * * * * * * * * * * * * * * * *

Be it remembered that the Board of "eyor and Aldermen of the City of Oxford, Mississippi, met in regular session in the City Bell at 8:15 P.M., Tuesday, April 4th, 1939, it being the time and place for holding of said meeting, when and where the following were presenti

Mayor R.X. Williams, Presiding Branham Hume, Alderman at large T.E. Avent, Alderman Ward One

W.T. Chandler, Alderman Ward Two B.O. Elliott, Alderman Ward Mr!? c.a. Haney, Alderman Ward Four ** * * * * * * * * * * *

LG. Andrews, Attorney C.E. Barrison,'Supt. Light and Water Plait H.C. Bell, Deputy Clerk

After the meeting had been opened according to law the following business was transacted:

Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants be issued accordingly. From the CORPORATION FUND 53.R.X. Williams, 'ayor, March Salary $80.00 54. Branham Bums, Alderman, March salary $10.00 55. T.E. Avent, " " $10.00 56. W.T. Chandler, Alderman " 4114;111.0.0 0000 . 57. B.O. Elliott, Alderman " . C.S. Aeney, Alderman n 59.B.C. Bell, Deputy Cler, of $50.00 60. Lillian Jones, Secee*tary " $40.00 61. Sam Keel, Marshal “ $125.00 62. Duff Davis, Bight watchman, March salary $100.00 63. L.C. Andrews, Attorney, “ $40.00 64. R.N. Whitfield, Bandmaster, 9, $40.00 65. Mrs. O. E. Bolcomb, -Matron " $20.00 . Hughes Hardware Company, Other supplies $3.36 67. Walter D. Pettis, Engineer, March -, $72.50

-- 66. F.W. Belk, Upkeep of fire truck $40.00 69. N.O. Nelson Company, Community House supplies 70. J.A. Martin, Supplies $'4 24.7i 71. Tones Produce Company, Fuel $1841 J72. Oxford Eagle, Advertising and programs $75.005. 73. George D. Barnard Company, Office supplies $45.92 175 REGULAR MEETING.. APRIL 4. 1939

CORPORATION FUND (Coatd.)

74. Tattoo Service Station, Gas for fire Dept. $5.00 75.Harrison Company, Code $25.00 76.Pet Haley, Gas for truck, fuel P5.75 77.Hughes Hardware Company, Sundry '6.12 78.F.W. Belk, Rep. to WPA truck $10.85 n. Hall Blacksmith, Sundry .65 60. Porter Hardware Company, Other supplies #2.55 81. Lawrence Printing Company, Office supplies $1.28 Total $900,4b-; STREET FUND §g. S.B.-Spears, March salary $100.00 83.W.P.• Haley, Gas $3,9•9 84. C.C. Butler, 4.I days work . f1.4.00 85 . H.L. Vaughn, 4 days work-- #9.90 86.G.W. Alderson, 4i days work $9.90 87. State Highway Department, Rerosaae and gas $3•42 88, Tropical Paint and Oil Company, General street $41 •20 89.George D. Barnard Company, Mayor's Docket $46.18 90.Panther Oil and Greaselianf. Co., General Str #26.50 91. Tennessee Valley Electric Col, Wire for home $19.92. 92.F.W. Belk's Garage, Rep. to truck-- $1.50 - 93.W.T. Jones, Upkeep of prisoners for March 94• Bob Davis, 4 days work as special police V.00.25 95.Porter Hardware Company, Sundry ...... $1.99 96. Hughes Hardware Company, Sundry _:31 97. Oxford Eagle, Advatilf truck fb.35 98.Huggins Garage, Rep. to truck $15.92 • Total $391.79

SCHOOL FUND

99. O.D. Smith, Pro rata share of March salary $24.00 100. Will Isom, Janitor for March #50.00 101. Claudia Thompson, Maid for March 102. Bramlett Drug Store, Administrative Exp. *1 1¢.gg. 103. Farrell-Calhoun, Repairs and replacements #21.60 104. Mississippi School Supply, Repairs and replacements----$13.60 105. P.L. Rainwater, Repairs and replacements #75.00 106. F.W. Gibbons, Repairs and replacements $1.50 107. Crane Company, Repairs and replacements --$7.72 108. Dixie Chemical Products Co., Janitor supplies $13.06 109. Tayloe Paper Company, Janitors supplies- 110. Bobbs Merrill Company, Sundry 111. Gaylord Brothers, Sundry 4. 112. A.C. Mc'.1urg and Company, Janitor supplies- 41!21.i 4 113.Hughes Hardware Company, repairs and replacements $19. • 114.Pittsburgh Plate Glass Company, Repairs and replacements- $8.10 115.Davis-Mize Company, Janitors supplies $7.51 116.Ihe Educational Supply Co., Office expense- $1.82 117.A.D. Wiley, Materials for Inst. s$1. ill 118.R.H. Gillespie, Replacements Total #313.25

176 REGULAR MEETING, APRIL 4, 1939

LIGHT AND WATER FUND 119.C.E. Harrison, Supt., March salary #245.00 120. G.W. Johnson, Engineer, March salary #135.00 121.A.L. Manna, Engineer, Mare4 salary $125.00 0°122. Louis Campbell, " /. •4 41105.00 123.Howard Winder, Lineman, March salary-- $125.00 124.H.C. Bell, Deputy Clerk, Barth salary A 40•00 125. Lillian Jones, Secretary, March salary #40.00 126. T.A. Donnt Rent for March #50.00 127. Mrs. Lillie- Yates, Rent for March #10.00 128.B.S. "Uyton, Rent for March q5.00 129. Oxford Eagle, Adv. for bid wo.35 130.S.C. Toe Company, Light and water bills $117.50 131.444 Service Station, Gas and oil 6.04 132.Sparta Sewer Machine Company, sundry ,#65.00 133.Arkansas Fuel'Oit Company, duel Oil #600,09 134.Briston Company, Sundry $4.39 135.W.P. Haley, Gas and oil .10.45 136.Westinghouse, Electrical supplies #104.18 137.N.O. Nelson Company, Water supplies #1.76 133. American Locomotive Company, Repairs and welding 4445 139.W.S. Dickey "lay MAnfacturing Co., Clay pipe and culvert 34.46 140.J.E. Dilworth Company, Repairs and welding 14.32 141. Oxford Eagle, Adv. en - Power Plant $31.65 142.Davis Mize Company, Sundry $2.75 143.Texas Company,'Gas and oil 6107.04 144.Texieo Service -Station, Gas and oil 12.3b 14. Riechman-Crosby Company; Repairs and water supplies $41.7?. 14i , Graybar, 6undry 4.51 14 . Louisiana Oil Refining Co., Guel Oil 149.General Electric Corp., Electrical supplies, meters .;g3 150. Pittsburgh Equitable Meter Company, Meters and repairs #1.10 .151. Tennessee Valley Electric Supply, Electric Supplies #10.01 152.Surety Rubber Company, Electric Supplies--- $3.97 153.De LaVergne Engine Company, Repairs and welding .04 Total #2515.90 * * * * * * * * * * * * * * * * * * * * * * * * * * *

The American legion represented by a Committee camposed of Lee Beggett, harry Sisk, Shaw Robinson and Durley Jones appeared before the Board asking permission of said Board for the privilege of putting 6n a street carnival by a Mississippi Cor- poration in the City of Oxford (same to be held on the Commudity House lot). After some discussion, permission of the Board was granted, providing the American Legion would appoint five repensible members to be on the grounds each night during the Carnival to maintain order and see teat same is carried on in a legitimate and peaceful manner, also, that the city Wot4kiiikArttelextra expense in secur- . ing the necessary transformers to connect lights, also, subject to the American. Legion securing permission from the Board of Directors of the Community House and Board of Supervisors. The above motion was unanimously passed. - * * * * * * * * * * * * * * * *

At. M.M. Winkler and At. Summerfield presented to the Board a condensed statement of their audit for the year 1938 for publication. After some discussion 4r. *inkier was requested to change this statement to show the actual financial condition of the city 88 on December 31, 1930, * * * * * * * * * * * * * * * * * * *

Be it ordained by the 'Ayor and Board of Aldermen of the Rity of Oxford, Mississippi, that all of that portion of Harrison Street, not already conveyed by the City of Oxford, beginning at the west line of South'10th street and running due west to the east 'line of South 5th street, be conveyed by quit claim deed to the ownerk, of the property adjoining said street. Said deed to be executed by the Mayor and Clerk of the City of Olford for and on behalf of said city. The Mayor and Board of Aldermen find that said street is no longer needed Dor further public purpossi, itbeing a dead street and neverisarings been opened. The property owners adjoining said street are the following: Presbyterian Church, the misses MoGuires, REGULUI mzeittia, APRIL 4, 1939

Alta Ray Keyes, the Lundie Estate, George Lundie, the McMahon Estate, R.X. Williams, Oxford Hospital, and B.S. 4uyton, The expense of the exectl4ion of the above deed' to be borne by the property owners.

* * * * * * * * * * * * * * * * * *

M. Winkler took up with the Board the matter of making the Federal Power Commission report for year 1938 on the electric light plant and sales. After some discussion as to the amount of time required to make this report, Mr. Winkler stating that it was impossible to state definitely, but thought in the niAighborhood of ten days. On motion duly made by Alderman Nana, and seconded by, Alderman 'handler that the Deputy Clerk with the help of Secretary, 's die Jones, amd Mr. C.E. Harrison, make out this report. The above motion was unanimously adopted. * * * * * * *.* * * * * * * * ** * * *

In response to advertisement for bids advertised on trucks and bodies, the following bids were received and read by the Clerk:

By Joe Stokes Motor Company 1 - 1939- Ford * ton Chassis - closed cab, F.O.B. Oxford---$661.51 Will allow for 1933 chevrolet truck 1 .00 Total .51

1 - 1939- Ford 8.5 R.P.M., 134 W.B. truck closed, and chassis, 1* ton, F.O.B. Oxford-4850.10 will allow for 1933 chevrolet truck .100.00 Total $750.10

Our charge for transferring dump body from Internation truck to new Ford truck $30.00

By.R.L. Smallwood I will deliver one 1939 3/4 ton Chevrolet Chassis and Cab for $725.00 and will allow as trade inyout 1933 Chevrolet Pick-up now used by theiWater and Light Department for 4125.00. If long running board and ,rear fenders are desired add 410.00. I will deliver one 1939 Chevrolet * ton Chassis and cab for $650.00 and will allow as trade in your Chevrolet 1933 pick up now used by the Water and Light Department for $125.00. if you desire to take deliver on the 3/4 ton or the * ton in St. Louis may deduct $20.00 from the above prices. I will deliver one 1939 Chevrolet 133 inch Dual Cab Model VB for $825.00 and will allow as trade in your 1933 Chevrolet truck now used by the WPA for $75.00 . I will deliver one 1939 158 inch wheel base Model VD Chevrolet Truck for $850.00 and will allow as trade in your 1933 Chevrolet truck now used by the WPA for $75.00. Either of the above trucks to be equipped with overload springs, oil bath type air cleaner and 32 x 6 eight ply tires on rear. The above prices also include transferring the body from the international truck to the new one. Respectfully submitted 11434 Sthallwood, Jr. After considerable discussion it was put to a vote as to which trucks to purchase. Result of vote ma; 1* ton Chevrolet truck for street service - toted for by four Aldermen * Ton Chevrolet truck for Water and Light Department voted for by four Alderman. Alderman Haney not voting, No votes were cast on Joe Stokes Motor Company's bids.

Bids On Utility Body for the Water and Light Department truck were received from McCabe-Powers Auto Body Company as follows: 178 REGULAR MEETING, APRIL 11, 1939

Quantity 1, Item No. 1. Body Proper, installed, (Painted), on chassis F.O.B. St. Louis or prepgred for Shipthent F.O.B. St. Louis, series 50-M meter installation and General Service body build according to print No. B-1090, priced at $275.00, and a tax of 2%. Above body included rear fenderai overhead ladder and pidgEpole rafts with rear section removable, thru box with four-compartment rubber padded meter tray, sliding vise bracket, tote tray, and various compartments for tools and materials. Above price subject to 10% discount plus tax on net price. For . installation on i-ton chassis, Wheelbase approximately 113", CA Dimension "pprox- imately 38". McCabe-Powers Auto Body Company By Broshe Doly.

From the Graybar Electric Company, St. Louis, Missouri: 01:entity 1, McCabe Powers 50-M meter service body as per print attached, installed and painted to match your chassis, FOB St, Louis, Missouri. The proper procedure is for you to order your vhassis from your local dealer and have him deliver to AaOabe Powers Auto Body Company, 1213 North Broadway, St. Louis, Missouri. Place order for body with the Graybar Electric Company, 1220 Spruce Street Str:444gis, Missouri. When installation is completed, you will be notified and can then send your driver to St. Louis to drive the truck to oxford, for the sum of $247.50 2% Excise Tax 4.95 1252.45 Net, FOB St. Louis, Mo.

On motion duly made and seconded that the order to given to the Graybar Electric Company of St. Louis at their price of $25.45, installed in St. Louis and that delivery of the Chevrolet truck be made to them in St. Louis for installation of Body and that Mr. harrison send a men to St. Louis to drive truck to Oxford when same was ready for delivery. This motion also included that both trucks be painted "red". The above motion was carried. * * * * * * * * * * * * * * * *

Came before the Board mi. R.C. Cook, Director of the UnivoloM#1,025hool with plea that the city make the Pniversity'High School an ailieftiout on their light bill for the year ending September 1st, 1939. After,jcoyAlderabl discussion of this matter, on motion duly made by Alderman Aventi,that—en4M allowance of $250.00 be made for the year and commencing September 1st, 1939, the rate be reduced from 3¢ to 2¢ per KWH with no allowance to be made: The above motion was unanimously passed. * * * * * * * * * * * * * *

4yor R.X. Williams submitted to the Board of Aldermen the matters pertaining to the reports of Night Marshall Duff Davis as to one, Omer J. Bullen, candidate for Public Service Commission from Iuka, Mississippi, being in Oxford drunk and reported that Bullenstated hhst he had just left mayor's house. The mayor read a letter from mi.. Bullen denying that he was intox- icated or drinking and that he had not been in or near the Mayor's home, also, a letter from ' r. Fitch who accompanied Mr. Sullen on ttip to oxford, uterpfptag statement made by Bullen in his letter. The mayor gave a report on the fight between Bullen and Davis and stated that Davis "Told him that he did not hire him and that he could not fire him". The Mayor also read to the Board the Bill for Divorce, being case No. 7182, on file in the Chancery c'lerk's office of Lafayette County and filed by Mrs. Vera Davis, wife of Duff Davis, after which Alderman Avent made a motion that Night Marshall Davis be requested to resign, seconded by Alderman Chandler. Those voting for the removal were Aldermen Avent and Alderman Chandler. Those voting for rentention were Alderman Elliott, Alderman Haney and Alderman Hume. * * * * * * * * * * * * * * * * * REGULAR MEETING, APRIL 4, 1939

The Committee composed of Aldermen ilaney, Chandler and Elliott reported that they rented the eight acres of land outside of the airport to B.T. Markette at flat rental of $50.00 cash for the year. Mr. Markette not having paid the rent, the Deputy Clerk was instructed by the Board to write Mr. Markette that same would have to be paid by April 15th or else he would have to re-rent. * * * * * * * * * * * * * * * * *

This is to certify that the mayor and Board of Aldermen of City of Oxford, lefayette County, mississippi, have on this the 4th day of April , 1939, met in a regular meeting of said Mayor and Board of Aldermen of said city and have agreed to sponsor OP # 465-62-2-115, Oxford Airport. Signed: R.Z. Williams, Mayor Branham HUM, Alderman T.J1. Avant, Alderman Baxter Elliott, Alderman Wiley Chandler, Alderman C.B. Haney, Alderman Personally appeared before me at Oxford, Lafayette County, Mississippi, this the 4th day of April, 1939, the above signed 4iwot and members of Board of Aldermen, Oxford, Lafayette County, Missihmippl.

w itness* hand and seal this the 4th day of April, 1939 R.X. Williams, Mayor * * * * * * * * * *a:A * *4,41 11 1,,

This is to certify that the Mayor and ioard ofAldermen of City of Oxford, Laf- ayette County, mississippi, have on his the 4th day of April, 1939, met in a regular meeting of said Mayor and y2and( of Aldermen of said city sad have agreed to sponsor Sponsor's Proposal # 2, Sewer Extension and Improvements. signed: R.I. Williams, Mayor Branham Hume, Alderman Baxter Elliott, Alderman W.T. Chandler, Alderman C.. Baney, Alderman Edison Avent, Alderman Personally appeared before me at Oxford, Lafayette County, Mississippi, this the 4th day of April, 1939, the above signed Mayor and member of Board of Aldermen, Oxford, Lafayette County,Missippippi.

witness my hand and seal this the 4th day of April, 1939

E.Y. Williams, Mayor * * * * * * * * * * * * * * * * * * * * * *

This is to certify that the Mayor and Board of Aldermen of City of oxford, Lafayette County, mississippi, have on this the 4th day of April, 1939, met in a regular meeting of said mayor and Board of Aldermen of said city and have agreed to Sponsor OP # 165-62-1070, exford Street Project.

Signed: E.X. Williams, Mayor Branham Rums, Alderman Baxter Elliott, Alderman Wiley Chandler, Alderman C.°. Haney, Alderman Edison Avent, Alderman Personally appeared before me at Oxford, Lafayette County, Mississippi, this the 4th day of April, 1939, the above signed Mayor and members of Board of Alder- men, Oxford, 'Lafayette County, Mississippi. Witness my hand and seal this the 4th day of April, 1939 ROC. Williams, Mayor * * **' ** * * * * * * * * 180 REGULAR MEETING APRIL 4, 1935

This is tog certify that the Mayor and Board of Aldermen of City of Oxford, l'efayette County, Mississippi, have on this the 4th day of April, 1939, Laf- ayette County, Mississippi, have on this the 4th day of April, 1939, met in a regular meeting of said Mayor and Board of Aldermen of said city and have agreed to sponsor Sponsor's Proposal 1 3, Sidewal& Construction and Improvggints. Signed: R.X. Williams, Mayor Brenham Hume, Alderman Batter Elliott, ."1derman Wiley Chandler, Alderman C.S. Haney, Alderman Edison Avant, Alderman

iarsonally appeared before me at Oxford, Lafayette County, Mississippi, this the 4th day of 4‘pril, 1939, the above signed Mayor and Member of Board of Aldermen, vxford, l'afayette County, Mississippi. witness my hand and seal this the 4th day of April, 1939 R.X. Williams, Mayor

Mr. Phil Carnathan advised 4thel3Oarcrthat Under the Be, setup of the WPA that they required that all projects in the city be approved by the Board and Mayor and spread on the Minutes. On motion duly made and seconded it was ordered that the these instructions be carried as per the above copied l'rojects. The above motion was passed. * * * * * * * * * * * * * * * * * *

The University High School, through R.C. Cook, Director, presented to the Board request that the University High School be furnished a copy of the official map of the City of Oxford, now being prepared for use in the school. On motion duly made and. seconded it was ordered that a copy of said map be made and presented bo the University High School. The above motion was passed. * * * * * * * * * * * * * * * * * * * * * Pfh AL" Lost WarramtA1 955 for $4,,.09, dated March 8th, 1939, for hauling coal, referred to 'Attorney Andrews for advice as to proper method of issuing duplicate. * * * * * * * * * * * * * * * * * * * *

Came on and for consideration of the City of Oxford making an appropriation towards the upkeep of the St. Peter's Cemetery. On motion of Alderman Bums and seconded by Alderman Avent that the City of Oxford appropriate ont':hf the Corporation Fund the sum of $50.00 per month for the next six months, commencing April 1st, 1939. The above motion was unanimously passed. * * * * * * * * * * * * * * * * * * *

Came on and for consideration the report on rebuilding of sidewalks on Second Street and Pontotoc Streets. On motion duly made by Alderman Hume and seconded by Alderman Avent that the Street Commissioner, Alderman Avent have these side walks repaired, purchasing whatever lumber necessary to do said work to put skid walks in safe condition until such time as city may be able to secure a WPA Project for cement gtdowkIhs. The above Motion was unanimously passed. * * * * * * * * * * ** * * * * * * *

Came on and for tki consideration the matter of carrying Insurance on the new city Hall Building, furniture and fixtures. Mr. George Heard and Mr. Wilson Roberts being present, each submitted to the Board rates of Premium, conditions, etc. After some discussion pro and con as to necessity of carrying insurance. On motion duly made by Alderman Taney and seconded by AlOpplet) Hume that the city enter into contract with Wilson Roberts, agent,foregLa 4 a 3-year policy with his Company or Companies for $2000.00 Insurance on' the building and $1500.00 on furniture and fixtures at a premium of three years from April 4th, 1939. Majority having voted "yea", said motion was passed. * * * * * * * * * * * 4 * * * * 181

REGULAR MEETING, April 4, 1939

Came on and for consideration the matter of necessary additional equipment at the Power-House. Mr. C.E. Harrison reported to the Board result of his investigation on a pair of used engines located in San Antonia, Texas. In discussion of the matter some of the aldermen were of the opinion that it would not be advisable to buy used machinery and that neVequipment should be installed. No definite action was reached. * * * * * * * * * * * * * * * *

Came on and for consideration the matter of salaries of certain city employees. After this matter had been discussed at some length on motion duly made by Alderman Haney and seconded by Alderman Elliott it was ordered that the salaftes of the following employees be and the same are hereby affixed, effective as of March 1st, 1939, as follows: S.E. Spears, 4100.00 per month G.W. johneon, $135.00 per month A.L. Mullins, $125.00 per month Howard Winter, $125.00 per month B.C. Bell, D.C. & T.C. $100.00 per month Those voting yea were Alderman Chandler, Avent, Elliott and Iliney, Alderman Hume not voting. * * * * * * * * * * * * * * c\t - Came on for consideration the matter of requiring the two cotton gins in the city to insbill some contraption to prevent the lint from blowing and spreading. This was deferred to next regular meeting in order to get some further information. * * * * * * * * * * * * * * * * * * * * * *

The Deputy Clerk informed the Board that check had been sent to the Chase National Bank in New York in the sum of $3927.50 on March 28th, to pay off $3000.00 of bonds of the Electric Light Improvenment bonds on April 1, 1$939 and $927.50 covering interest due on this issue of bonds under date of April 1, 1939. * * * * * * * * * * * * * * * * * * * * *

In the matter of petitions of W.S. Harkins through his Attorney, John Falkner, and Fred Wallace on Home exemption for year 1938. The Deputy Clerk was instructed to make them copy of letter of State Tax Commission dated March 22, 1939, denying said authority for making refunds. * * * * * * * * * * * * * * * * * * *

Came on end for consideration through Mrs. J.W. Shelton that a Building- Committ- ee for the Lafayette County Community House be appointed, composed of a representative from the County Board of Supervisors, Mayor and Board of Alderman, and the four Civic Clubs i namely Rotary Club, Junior Chamber of Commerce, American Legion and Business and krofessional WOmen's Club. On motion duly made by Al- derman Avent and seconded by Alderman Elliott that Alderman W.T. Chandler be appointed to said Committee. Those voting "yea" were Aldermen Elliott, Bum, Avent and Haney. * * * * * * * * *

Came on and forAINIMOsion the matter of moving the fire truck to the new City hall Building. After a somewhat lengthy discussion of this matter,(Alderman Elliott leaving during discussion) on motion duly made by Alderman Avent and seconded by Alderman Chandler that this matter be turned over to Mr. Harrison as Fire Chief, to work out on the basis of securing four men to drive the truck with two day men and two night men on the basis of $1.50 each time truck was called out and no hose connection made and $3.00 each time truck was called out and hose connection made by day men and $3.00 dollars on each trip with fire truck and no hose connection at night and $5.00 on each night and hose connection made for night men. Na'to make necessary arrangements with the four men, that each may thoroughly understand when it was his duty to respond to fire alarm and drive truck. (The two men each deg and night was for the purpose of having a man on duty in case any one of them were to be out of town or not available for duty. The above motion was carried. * * * * * * * * * * * * * *

Upon motion duly made and seconded and passed, it was ordered that this Board do now recess until $7.30 P.M. on Tuesday night, April 11th, 1939. 182

RECESSED MEETING, APRIL 11, 1939 OXFORD, MISSISSIPPI

The Board met pursuant to the foregoing Recess Order of April 4, 1939, at 7:30 P.M., when and where the following were present:

W.T. Chandler, Mayor Pro Tem, Presiding Branham Hume, Alderman - at - large O,S, Haney, Alderman Ward Four * * * * * * * * * * * * * * * * * *** * * * * * ** * * * *

H.C. Bell, Deputy Clerk L.C. Andrews, Attorney

After the meeting had been opened according to law, the following busineds was had to-wit: W.G. Roberds appeared before the Board asking relief from the Water on University Street during heavy rains over flowing the drift and yard leading to his house occupied by Ticer Young, also, that the city re-gravel the drive-way on account of thewashed out condition. Referred to WalterD. Pettis, City Engineer. * * * * * * * * * * ** * * * *

A RESOLUTION AUTHORIZING THE MAYOR TO FILE A SUPPIWITURYAPPLICATION TO THE UNITED STATES OF AMERICA FOR A LOAN AND GRANT TO AID IN FINANCING TBE EQJJIPING THE AUDITORIUM ON MISSISSIPPI 1245-F, OXFORD NEGRO SCHOOL AND DESIGNATING THE PARTIES TO FURNISH SUCH INFORMATION AS 1HE GOVERNMENT MAY REQUEST.

Be it resolved by the Mayor and Board of Aldermen of the City de Oxford, Mississi- ppi. SECTION 1. That R.X. Williams, Mayor, be and he is authorized to file a supplementary application to Project 1245-F on behalf of the city of Oxford, Mississippi, to the United States of America for a loan and grant to aid in financing necessary additional equipment to the Oxford Negro School, Oxford, Mississippi, in as much as this Project No. 1245-F Oxford Negro School is substantially completed including an auditorium, seating approximately 414 auditorium chairs and the city is unable to equip this auditorium, which will be necessary before it can be used as intended in the original ppplication. The City of Oxford needs a grant of $697150 and has on hand in the Municipal Light and Water Fund $852.50 that can be used to match a grant of this nature. SECTION 2. That H.C. Bell „Deputy Clerk of the City of Oxford, Mississippi, be hereby authorized and directed to furnish such other information as the United States of America may reasonably request in connection with the application which is herein authorized. * * * * * * * * * * * * * * * * * * * * * *

Came on and for re-consideration the matter of purchase of truck for Water and fight Department. On motion duly made and seconded that the Board reseiadi the order for the * ton Chevrolet Truck and eredept the bid of R.L. Smallwood on the 3/4 ton Chevrolet truck on the price bid of $725.00 less alloiance of 125.00 on the 933 Chevrolet pick-up now used by the Water and Light Department, net price of 0.00 less additional allowance of $20.00 of accept delivery in St. Louis, Misso uli.i ° The above motion was unanimously carried. * * * * * * * * * * sc * * * * * *

Came on for consideration the purchase of creosoted pine poles for Water and Light Department. It appears from the statement of C.Z. Harrison, Superintendent, RECESSED MEETING, APRIL 11, 1939

)1-4,4 that the emergency existed for immediate need of poles. It was ordered by the Board that Mr. Harrison be authorized to purchase a car load of said poles at the lowest competitive bid. The above motion was tarried. * * * * * * * * * * * * * * * * * * * 4

Came on and for consideration the assessment of Carl R. Coors on Fr. of Lot 68 and 92. It appearing from the assessments books that he was assessed and paid taxes for year 193d, on Fr. Lot 68, this being the vacant lot purchased from George dope and wife and assessed at $1000.00 and that Fr. Lot 92 on which a building, known as the Pelican is located, was not assessed to Car. R. Goers, but that the assessment of Fr. Lot 68 was intended to comer the lot on which the Pelican was located. On motion duly made by Alderman Hume and seconded by Alderman Haney that the city Tax Assessor, make correction on said books as well as on Receipt for taxes paid to combine said Fr. Lot 68 and Fr. Lot 92 and that assessment of $1000.00 cover both - Ogees of property.. The above motion was carried. * * * * * * * * * * * * * * * * * * * * * * *

In the matter of dogs running at large, the Deputy Clerk was instructed to r - look up city Ordinances covering same and report at next meeting. * * * * * * * * * * * ** * * * *

On motion duly made, seconded and possessed, it was ordered that this Beard do now recess until April 17, 1939, at 7;30 P•41. 184 RECESSED MEETING APRIL 17, 1939

The Mayor and Board of Aldermen met pursuant to a recess Order Of April 11, 1939, at 7:30 P.M. when and where were present the following members:

MC,yor R.X. Williams, Presiding Branham Hume, Alderman-at-large T.E. Avent, Alderman Ward One B.O. Elliott, Alderman Ward Three C.S. baney% Alderman Ward Four * * * * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney H.C. Bell, Deputy City Clerk

After the meeting had been opened according to law the following business was had to-wit: Mr. Watson representing the Mississippi Publicationof University of Miss- issippi, presented to the Board Program for the Press Convention to be held at the University of Mississippi, soliciting the city to carry an ad in the Miss- issippian towards defraying expesne of convention. On motion duly made by Aldermen lams and seconded by Alderman Elliott that the City of Oxford subscribe to a one-halt page add at cost of $21.00. Above motion was unanimously carried.

* * * * * * * * * * * * * * * * * * * * * *

Came on and for consideration the Insurance policy written by Wilson Roberts, agent,on the New City Hall building and equipment. There being considerable doubt as to what this policy really covered, etc. On motion duly made by Alderman Elliott and seconded by Alderman Avent that the Deputy Clerk send the policy to the State Insurance Commissioner, John Sharp Williams, 111, Jackson, Mississippi, to ascertain as to the amount of protection the city of Oxford lies in case of fire loss amounting to $21,500.00 or more on building and equipment and that an order on the minute for this insurance be held up until next regular meeting of the Board. The above motion was unanimously passed. * * * * * * * * * * * * * * * *

Mr. L.O. Andrews, Attorney for the Board reported that in the matter of the lost warrant of Mr. Pat Haley, for $48.09 covering hauling coal for school issued on March 8th, 1939, it would be necessary that he make affidavit that warrant had been lost or not received and would have to make bond to twice amount warrant before duplicate could be issued. (Section 2343, Code 1930) * * * * * * * * * * * * * * * * *11

Came on and for consideration the bill of Alex Load, Inc., covering cost of band uniforms, under written by the City of Oxford, amounting to $174.25 less amount raised by the B and band mothers, amounting to $118.34 leaving balance of $55.91 due Alex Loed, Inc. On motion duly made by Alderman Elliott and seconded by Alderman Blaney that this balance be paid out of the Light and and Water Fund, also, that the $50.00 allowed by the Board for the trip of the Band to 7ackson,ahinutiBook 10, page 160 under date of February 17, 1939, be and is hereby amended to read "be allowed band to apply on expenses on a trip to Jackson or any other place they may decide on". Above motion was unanimously passed, * * * * * * * * * * * * * * *

185

RECESSED MEETING, APRIL 17, 1939

Came on and for consideration the request of Mr. A.D. Caulfield, Superintendent of the I.C.B.B., Water Valley. Upon motion duly made by Alderman Hume and seconded by Alderman Elliott that the city purchase *MK*. Cawldwell a copy of map on paper at cost of $3..00 to be sent to Mr. Caulfield. Above motion passed. * * * ** * * * * * * * * * * * * * * *

Mr. Bartison tooprup with the Board the matter of securing men to drives fire truck, stating that he was having trouble to secure volunteer men for service on Sundays. He suggested that by paying a man to remain on du7r Sunday at expense of around $2.50 per day he could work out a staisfactory plan. On motion duly made by Alderman Hume and seconded by Alderman l'aney that this matter be left to Mr. Harrison to work out to best advantage. Above motion was unanimously passed. * * * * * * * * * * * * * * * * * * *

Came on for consideration the purchase of two lawn mowers for the use of Mr. Spears on the street department. On motion, duly made by Alderman Elliott r.) and seconded by 4-'1derman Hume that Mr. Spears and the Deputy Clerk purchase two lawn mowers at wholesale price. Above motion unanimously passed. C./ * * * * * * * * * * * * * * * * * *

Upon motion duly made, seconded and carried, it was ordered that this Board do now adjourn sine die.

X IN mayor REGULAR MEETING

MAY 2, 1939 OXFORD• MISSISSIPPI UNITED STATES OF AMERICA

STATE OF MISSISSIPPI COUNTY OF LAFAYETTE

CITY OF OXFOORD 1939 * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *

Be is remembered that the Board of Mayor and Aldermen of the City of Oxford Mississippi, met in regular session in the City Ball at 7:30 P.M., Tuesday, May 2, 1939, it being the time and place for holding of said meeting, when and where the following were present:

Mayor R.X. Williams Presiding Branham Hume, Alderman at Large T.E. Avant, Alderman Ward One W.T. Chandler, Alderman Ward Two

B.01 Blliott;,,IAldermaht:Wart Three

C.S. Raney, Alderman Ward Four * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney B.C. Bell, Deputy Clerk C.E. Harrison, Supt. Light and Water Plant After the meeting had been opened according to law the following business was transacted:

Upon motion duly made and seconded it was ordered that the following accounts be allowed and that warrants be issued accordingly. From the

CORPORATION FUND 189.R.'. Williams, Mayor, April salayy $80.00 190.Branham Hume, Alderman, April salary $10.00 191. T.E. Avent, Alderman, April salary 410.00 192.W.T. Chandler, Alderman, April salary $10.00 193.B.O. Elliott, Alderman, April salary #10.00 194.C.S. 4aney, Alderman, April salary 410.00 195.H.C. Bell, Deputy Clerk, April salary $50.00 196.Lillian Jones, Secretary, April salary $40.00 197.Sam Keel, Marshal, April salary $125.00 196. Duff Davis, Night watchman $100.00 199.L.C. Andrews, Attorney, April salary $40.00 200.R.N. Whitfield, Band master, April salary 40.00 201.Mrs. O.E. Holcomb, Matron, April salary $20.00 187

=MAR MEETING, MAY 2, 1939

CORPORATION FUND (Continued)

202. OpE. Douglass, Upkeep of cametary $50.00 203.Standard Service Station, upkeep of fire truck 02.50 204. Tennessee Valley Electric Supply Co., hjupplies $9.00 205.Patton-Courtney Hardware Company, Supplies- 206.W.P. Haley, Gas for truck 419.93 207.Hall Blacksmith, Reparis to truck 47.25 208.J.A. Martin; Jr., Supplies $23.15 209.Roberts Insurance Company, Insurance on city hall-$137.45 210.George D. Barnard Company, Supplies 211. .C. Toof Company, Supplies $316.0g8 212.Ideal Cheanical and Supply Co„ Floor polish $8.00 213.Tayloe Paper Company, Supplies $21.30 214. Oxford Eagle, Supplies--- .15 215.C.G. 'Huggins, Gas for fire truck $4.05 216.Goers Variety Store, Supplies .15 217.Commercial Print Shop, Supplies $2.00 218.Porter Hardware Company, Dust mop $1.02 LCD 219. P.E. C,) Bateman, Lumber and building material $9.78 eq 220. Hughes Hardware Company, Lumber and building Mat.- 7.19 L.--• 221.G.T. Pound, Supplies for work shop 5.00 .!::: 222. Hughes Hardware Company, Sundry 45.29 223. F.W. Belk, Fire truck $20.00 224. Elton•Addington, 1 day fire house $2.50 225. Walter D. Pettisl-Account for April $88.00 1013.91 STREET FUND

226.S.E. Spears, Foreman, April salary $100.00 227.Hederman Brothers, Office supplies 422.70 226. Standard Service Station, Rep. to truck $1.90 229.S.C. Toof Company, Surulies $21.25 230.bob Davis 5i days work $11.00 231.westinghouse, supplies for police horn 415.09 232.W.T. Jones, Keeping prisoners fdr April $24.00 233. Orgill' Brothers, Lawn mowers $12.74 234.Patton-Courtney Hardware, Supplies $4. 54 235.W.S. Darley Company, Supplies for horn $4.15 236.W. aP.'Heley, Gas and oil- $34.62 237.Hall Blacksmith, Work on truck and pick $4.15 238.Davissaize Company, Nails and files $5.50 239.Memphis Blue Print Company, Blum print paper $5.44- 240.C.G. - Huggins, Oil for dump body •35 241.N•L.•Smallwoork, Jr., Truck for street 0750.00 242.Riechman Crosby Company, Sundry $29.96 243.D.*. Belk, repairs to washer motor 42.00

Total W9 SCHOOL FUND

244.O.D. Smith, Prorate share of April sa&ary $24.00 245.till Isom, Janitor for April #50.00 246.Glaudia Thompson, '''aid for April *15.00 247. Underwood Elliott Fisher Co., office exp. $70.00 L.__ 20. Coers Variety Store, Adm. Exp. $2.92 249. Orgill Borthers, Material for inst. $36.68 250. St. Paul Fire and Main Insurance Co., Insurance *39.75 251.Iheeler Publishing Company, Materials for Inst. „.40 252.J.A. Martin, Jr., Supt. office Exp. $6.90 253.R.H. Gillespie, Repairs and replacements $1.51 254.D.C. Heath Company, Library Exp. $3.10 255.N.F. Campbell, Repairs and replacements $3.58 256.Westrook Insurance Agency, Insurance $39•75 257.Alex-Lieb, Allusic and athletics- $12.10 258. ‘'urrtculum Journal Editor, Library $2.50 259. Oxford Eagle, Supt. office exp. 1/64-5 260.Educational Test Bureau, Adv., Exp. *b•55 261.S.C. Toof Company, Materials for Inst. $28.57

188 REGULAR MEETING, MAY 2, 1939

SCHOOL FUND ( iontinued)

262.Pittsburgh Plate Glass Company, Repairs and replacements $8,10 263.Patton-Courtney Hardware Company, Repairs and replacements $742 264.America Book Company, 'ibrary $2.23 2b5. Mississippi School Supply Company, Janitor supplies #10.01 266. American Association of Zahbol Adm., Adm. Exp $2.00 267.Benj. E. Sanborn and Company, Library 18.96 26d. Avent's Drug Store, Repairs and replacementsWr ----(11320e-e-i3 ...... 269.Webster Publishing Company, Library- $2.61 $354.93

LIGHT AND WATER FUND

270.C.E. Harrison, Superintendent, April saihry $245•00 271.G.W. Johnson, Engineer, * " $135.00 272.A.L. Mullins, vi , " l, $125.00 275, Louis Campbell, " n " $105.00 274.Howard Winter, Lineman * " $125.001 275.H.C. Bell, Deputy Clerk, April salary 50.00 276. Lillian Jones, Secretary, April salary- 40.00 277.B.S. Guyton, Rent flir april 35.00 278, T.A. Dunn, " " 50.00 279. Mrs. Lillie Yates, Rent for April 10.00 250. Tennessee Vellpy Electric Supply Co., Electrical supplues 28.87 281.Duncan Electric Manfacturing Company, Electrical supplies 45.39 282.Westinghouse, " " 12.07 283.Arkansas Fuel Oil Company, Fula Oil $360.18 284.Oxford Repair Work, Repairs $2.25 5. Pittsburgh Equitable Meter Company, Meter and repairs $27.00 286. Graybar, Meter and repairs $40.02 287. Hughes Hardware Company, Small supplies and hardware $14.88 285.444 Service Station; Upkeep of truck .75 289.J.J,-. Herndon,sundry---- .25 290.Cabell Electric. Company, Electrical supplies $5.29_ 291. Texas Company, 'imbricating oil #26.88 292. Crane Company, Water supplies and repairs- 8.13 293.Patton-Courtney Hardware Company, small supplies and Hardware 14104 294.W.P. Haley, Gas and-oil . 295.American Sand-Barnum Company, Sundry $45.69 296.Texaco Service Station, Gas and oil 42.70 297, Wood Preserving Corporation, Electrical supplies $2b1.57 29d, American Locomotive Company, repairs an welding $17.44 299. H. Bbockman and Company, Waster $12.00 100. J.E. Dilworth Company, Swill supplies and hardware, $11.47 101.Riechman Corsby Company, Supplies 10.17 $1 55.90

BOND FUND

302. Chase Nationa. Bank, Commission on paying coupots- $5.32 REGULAR MEETIM, MAY 2, 1939

Dr. Armstrong with the County Health Unit presented Dr. Parker with the State Board of Health who presented to the Board the.matter of an ordinance by the City of Oxford adopting uniform milk control regulations for Grade "A" milk under the county Health Unit. On resolution by Alderman Haney and seconded by Alderman Hume that the City Attorney, Mr. L.C. Andrews, meet with Dr. Parker and draw up said ordinance. The above motion was passed. t.'

Ni. Will Lewis appeared before the Board in the matter of having the plat of ground on which the Buie Museum is located surveyed in order that Miss Kate Skipwith may deed said lot to the City of Oxford, also, that Mr. L.C. Andrews, the city Attorney, prepare the necessary papers to have the Buie property located in Arkansas deeded to transferred to the City of Oxford. Tir Lbwie-alab-advieetktht-Boatd that-it was the pleasure of Miss Kate Skipwith to have a Board of trustees appointed to have charge of the Buie Museum. It being necessary that an act bg PagsgdbY fhb State Legialdtdre before this could be done, on motion by Alderman Avent and seconded by Alderman Elliptt that the Board request Miss Kate Skipwith to select an advising Committee to work with the Mayor and Board of Aldermen until such time that the Legislature may pass the necessary act to permit a Board of Trustees to be appointed and that the Mayor Of the City of Oxford be an ex-officio member of the said Board of Trustees. The above LrD motion was passed.

Mr. Goerge Buffalos appeared before the Board with a plea for special rates on electricity on lighting the Legion Field grounds for soft ball and other activities for which said Field maybe used for during the summer season. After some discussion, Alderman Haney moved that the City grant the Oxford Athletic Association the option of a straight 30 KWH rate on the regular commerical rate. They to notify Mr. Harrison, Superintendent of Light and Water Plant, and the Deputy Clerk before they need lights which rate they have decided to accept, Said motion was seconded by Alderman Hume and passed * * * * * * * * * * * * * * * * * * * * * * *

Alderman Hume's term as Board Weber of the Oxford Athletic Association on motion duly made by Alderman Chandler and seconded by Alderman Avent that Alderman Hume be re-appointed for the coming year to represent the Mayor and Board of Aldermen on said Association. The above motion was carried. * * * * * * * * * * * * * * * * * * * * *

Ni, W.I., Cladwell advised the Board that in orde -t=t the proper description on the city map that it was necessary to hayq4 File-___- )Town surveyed. At an expense of twenty-five dollars and asked the City of xford to pay said expense. On motion duly made by Alderman Avent,and seconded by Alderman Haney that the account be paid; said warrant to be made to Clifford Worsham. Above motion was passed.

Upon motion by Alderman Avent and seconded by Alderman Haney that the City of Oxford advance Ni. W.L. Caldwell the sum of Fifty dollars on his contract. The above motion passed.

Mr. Harrison, chief of the Fire Department, advised the Board that he had made arrangements with Messers toward Hodge, Howard Winter and Ira Mills to drive the fire truc also, that he had employed Mi. Elton Addington as driver of fire truck for on Lundays at the rate of 0.50 per day.

Mr. Harrison also brought to the Board's attention the advisability of having some one on duty living adjacent to the fire department building for night service. Be advised that if the apartment in the old grammar school building, now occupied by Mr. Byers, was available, rent, lights and water furnished, that it could be arranged with Mr. Elton Addington to move into this apartment and be available for night service on the fire truck, the city to continue paying him $2.50 per day for Sunday duty. On motion duly made by Alderman Avent and seconded by Alderman Elliott that as soon as the Byers apartment had been vacat- ed and fumigated under supervision of the county Health Unit, that Mr. Harrison make an agreement with Mr. Addington under conditions as above stated. The above motion carried. * * * * * * * * * * * ** * * REGULAR METING, MAY 2, 1939 7 Came on for consideration the matter of completing black topping the following streets: 'ryler Avenue east frok south Lamar o street between Bramlett's Hospital and L.Y. Cobbs from Madis • Jefferson street, Street from North Lamar to North 11th street of Miss Maude Heard's residence, 4th Street running north from ' J ackson Avenuefr street at University high school and Elliott Addition,

On motion duly made by Alderman Elliott and seconded by Alderman Hume that the city hire whatever additional trucks necessary to have sand and gravel needed in the completion of said streets, and that the City "ngineer survey and mark by stake& 4th street, running North from Jackson Avenue,Ao R.`37. Campbell's place in order to properly locate said street. Above motion was carried. * * * * * * * * * * * * * * ** *

Came on and for further consideration the re-marking of ,streets on curbs. On motion duly made-,by Alderman Hume and seconded by Alderman haney that the Deputy Clerk employ Bob Davis and two helpers to do said work. Above motion was passed. * * * * * * * * * * x * * *

On motion by Alderman Hume and seconded by Alderman Elliott that Deputy Clerk see sir. Cofield about making pictures of new city hall and neg Negro School when graded. Aobve motion was carried. * * * * * * * * * * * * * * * *

Alderman Avent and Attorney Andrews excused themselved at this time. * * * * * * * * * * * * * * * * *

On motion made by Alderman Hume and seconded by Alderman Haney that the Leputy City Clerk be instructed to issue warrant in payment Of the truck and body purchasedfor the Light and Water Department when OKed by Mr. Harrison. Above motion was carried and passed. * * * * * * * * * * * * * * *

The Deputy Clerk was instructed to consult with Air. Seay and ascertain the cost of having c-souvenir postal cards made and report to the Board. * * * * * * * * * * **

On application of Tobe Carothers that the city allow the colored church the street paving account for year 1937 on account of using the church for school purposes. On motion duly made by Alderman Elliott and seconded by Alderman Hume that this account be not allowed. Above motion was carried. * * * * * * * * * * * * * * * * * * * * *

Came on and for consideration the assessment of $1650.00 against J.N. Shellebarger's residence. On investigation it was found that this was gross error and on motion duly made by Alderman Chandler and seconded by Alderman Hume that a refund of $11.55 be made on account of error. Above motion was carried. * * * * * * * * * * * * * * * * *

On motion duly made and seconded by Alderman Fiume that said Board do now recess until 7:30 P.M., Monday, May 8th, 1939. 191

MAY 8, 1939, limEssED MEETING

The Mayor and Board of Alderman met pursuant to a recess Order of May 2nd, 1939, at 7:30 P.M. when and where were present the following members:

Mayor R.X. Williams, Presiding Branham Hume, Alderman at large

T.E. Arent, Alderman Ward One N. T. Chandler, Alderman Ward Tmo B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Ward Four * * * * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney Sam Keel, Marshal H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted: Minutes of Regular Meeting of Monday, May 2, were read and on motion duly made by Alderman Hume and seconded that minutes up to present reading be approved. Above motion passed.

Mr. ROSS Brown, representing the T.B. Brown and Son, appeared before the Board with reference to coOplaints on account of dust and lint made by the gins located in the city. After considerable discussion, Mr. Brown agreed to consult with Mr. A.B. Arent and they to ascertain what changes could be made to relieve the situation and report at the Tune meeting of the Board. * * * * * * * * * * * * * * * * * * * ,* *

An ordinance prohibiting the slaughtering of animals;

AN ORDINANCE PROHIBITING THE SLAUGHTERING OF ANIMALS AND THE MAINTAINING OF SLAUGHTERHOUSES IN ME CITY.

SECTION 1: Be it ordained by the Mayor and Board of Aldermen of the City of Oxford that it shall be unlawful to slaughter any animal or to maintain any slaughterhouse within the City of Oxford unless permission is first obtained from the Mayor and Board of Aldermen and the State Health Department. SECTION 2: Any person or persons found guilty of violating this ordinance shall be deemed guilty of a misdeameanor and fined not less thatn $10.00 nor more than $100.00.

SECTION.5: Provided, however, that this ordinance shall not apply to the slaughtering of a single animal by a person for his own consumption.

SECTION 4: For good and sufficient reasons this ordinance shall be in force and *effect from and after its passage.

On motion by Alderman Arent and seconded by Alderman Haney that Section 1 be Adopted. On motion by Alderman Arent and seconded by Alderman Elliott that Section 2 be adopted. On motion made by Alderman Arent and seconded by Alder Hume that Section 3 be adopted. On motion made by Alderman Arent and adconded by Alderman Hume that Sect- ion 4 be adopted. On motion made by Alderman Arent and seconded by Alderman Hume that the Resolution be adopted as a whole. Those Voting "yea" were T.E. Arent, W.T. Chandler, .C.S. Haney, B.O. Elliott and Branham Hume. Those voting "nay" None. * * * * * * * * * * * * * * * * * * * * * 19`2 RECESSED MFA":TINa, MAY 8, 1939

A RESOLUTION EXTENDING THE TIME ON THE NEGRO ELEMENTARY AND HIGH SCHOOL BUILDING, DOCKET MISSISSIPPI 1245-F

WHEREAS, it appears that the City of Oxford made application to the Public Works Administration for a grant for the construction of a Negro School Building and equipping same for the City of Oxford, Lafayette County, Mississippi.

WHEREAS, it appears that this project was approved and grant made and the building is now substantially completed and that the final completion date was March 25th, 1939.

WHEREAS, it appears that the City of Oxford has made an additional application for a grant to assist in the purchasing of auditorium seats for this project and if this application for an additional grant is approved it will be necessary for an extension of time in order to install the auditorium seats.

THEREFORE, be it resolved by the Board of Mayor and Aldermen that the approval for an extension of time to June 25th, 1939, based on approval of the grant, for the completion of all work is hereby requested from the Federal Emergency Administration of Public Works.

The above resolution was this day offered and adopted by theBoard of Mayor and Aldermen in agleolowl meeting convened on this the 8th day of May, 1939. rEcr,4.1, On motion duly made by Aldermen Avent and seconded by Alderman Hume that the said resolution be adopted and spread on the Minutes. The above motion passed. * * * * * * * * * * * * * * * * * * *

Alderman Haney brought to the attention of the Board some negro houses being built by Mr. Claude Patterson in ward Four with out any provision for sewerage connection. Same being located close at the residence of Mr. R.F. Campbell. The Board instructed the Deputy Clerk to refer this matter to Dr. Armstrong of the County Health Unit for investigation. * * * * * * * * * * * * * * * *

R.N. Whitfield, Band director of City Band, ap:Jeared before the Board in the matter of transporting the band instruments to and from 44amphis for the use of band at the Cotton Carnival. On motion duly made by Alderman Bumf) and seconded by Alderman baney that the city street truck be properly equipted to pass all Highway requirements and that Mr. Spears be instructed to use said truck to transport the band instruments to "emphis Friday morning, May 12th, 1939 and that he take truck to Memphis Saturday evening to bring the band instruments back to Oxford. Mr. Whitfield to make necessary arrangements with "ir. Spears. The above motion carried. * * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Haney and seconded by Alderman Elliott that the Deputy Clerk be instructed to pay the account of the Oxford Floral Company for landscaping the grounds aroun* the city hall as per contract. Amount of account being •120.00. The above motion passed. * * * * * * * * * * * * * * * * * * *

Came on and for consideration the printing of standard forms for the police Department to be used in traffic violations. On motion of Alderman RECESSED MEETIM, KEY 8, 1939

HU$e and seconded by Alderman Elliott that the Deputy Clerk be authorized to secure prices and to place order with lowest bidder. The above motion was passed.

* * * * * * * * * * * * * * * * * * * Came on and for further consideration the matter of fire insurance on City Hall and equipment. On motion duly made by Alderman Haney and seconded by Alderman Elliott that the amount of insurance on building of $20,000.00 not be changed but that the insurance on the furniture and fixtures be increased from $1500.00 to $2500.00 and that the Deputy Clerk be instructed to issue warrant for the premium on original policy amounting to $137.45, also, warrant conwerning the premium on the additional insurance on furniture and fixtures. The above motion carried. * * * * * * * * * * * * * * * * * * *

Came on and for consideration installing catch basin at junction of South Lamar and Tyler Avenue. On motion_duly made by Alderman Hume and seconded by Alderman Elliott that the WPA install catch basin in connection CN/ with the work on Tyler Avenue and ttarifi. Carnathan be instructed to hire any L7-4 additional labor he found necessary to properly install said catch basin. The above motion was carried. * * * * * * * * * * * * * * * * * * * Uppn motion : duly made bpd carried, it was ordered that the Warrant made payable to Avant Drug Store for the sum of $1.07, payable out of the School Fund be cancelled due to the fact that Mr. Arent is a member of the Board of Aldermen. The warrant was allowed at the Regular meeting held on May 2nd, 1939. * * * * * * * * * * * * * * * * *

On motion duly made, seconded and passed, it was ordered that this Board do now Recess until Tuesday, May 9th, 1939, at 9 o'clock A.M.

L 194 RECESSED MEETING, MAY 9, 1939

The Mayor and Board of Aldermen met pursuant to a recess Order of May 8th, 1939, at 9:00 A.M., when and where were present the following members:

R.X. Williams, Mayor Presiding

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward One

W.T. Chandler, Alderman Ward Two

B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Weil; Fou' * * * * * * * * ** * * * * * * * * 3I‘ * * * * * * * *

L.C. Andrews, City Attorney H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted to-wit:

Came on and for consideration the offering of the Mississippi State Highway Department office space in the city Hall. On motion duly made by Alderman Aent and seconded by Alderman Elliott that Mayor R.X. Williams Aldermen Hume and Chandler be appointed on a committee to interview Mr. F.L. Linker, Highway CammiSsioner, offering him the use of three offices, free of rent, on the second floor of the city Hall building for his use. The above motion was passed.

* * * * * * * * * * * * * * * * * * *

Upon motion, made, seconded and unanimously passed it was ordered that this Bo do now adlourn sine die.

lerk 195

SPECIAL MEETING May 26, 1939

NOTICE OF SPECIAL MEETING

TO THE MEMBERS CF THE BOARD OF ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI Notice is hereby given that a Special Meeting of the Board of Mayor and Alder- men of the City of Oxford, Mississippi, will be held in the City Hall, Oxford, Mississippi, at 3:00 fa. on Friday, May 26, 1939, for the purpose of receiving bids on auditorium chairs for the Negro School Building, Supplementary PWA Docket 1245-F. Dated this the 26th day of hSay, 1939

R.X. Williams, Mayor CONSENT TO MEETING Cq We the members of the Board of Aldermen of the City of Oxford, Mississippi, 6.;-• .-0 do hereby accept service of the above and foregoing notice, waiving any and all ..,tIrregularities in such service and such notice, and consent and agree that said board of Aldermen shall meet at the time and place therein named, and for the said purpose stated therein. Witness our signatures this the 26th day of May, 1939 B.O. Elliott W.T. Chandler C.S. Haney T.E. Avent Branham Hume * * * * * * * * * * * * * * * * * * * * * * * * * * * *

The Mayor and Board of Aldermen met pursuant to theabove',eall, at 3 o'clock P.M., when and where were present the following members: R.X. Williams, Mayor Presiding T.E. Avent, Alderman Ward 1 B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 Branham 'Hume, Alderman at large * * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney H.C. Bell, Deputy Clerk

After the meeting had been opened. according to law, the following business was transacted to-wit:

A RESOLUTION ORDERING THE FILING OF BIDS. WHEREAS pursuant to advertisement, bids for the auditorium chairs for the Negro Elementary School Building, Oxford, Mississippi, have been filed by the following bidders: Mississippi School Supply, Jackson, Miss. Herschel Smith, Jackson, Miss. E.N. Martin, Jackson, Miss. F.A. Hulett and Son, Meridian, Miss. J.W. McCorkle Southern Desk Co., Meridian, Miss. Tayloe Paper Company, Memphis, Tenn. that the said bids have been duly received, opened and publicily read:

NOW , THEREFORE, BE IT RESOLVED that the bids listed in the preamble hereof be filed and presented to James T. Canizaro, consulting architect, and that the

L 196 SPECIAL METING, MAY 26, 1939

said James T. Canizaro, is hereby directed forthwith to tabulate said bids, and at the earliest practical moment, report to this Board of Mayor and Alder- men his findings as to the lowett and best bid. The above resolution was read and adopted by a unanimous vote on the 26th day of May, 1939. * * fi * * * * * * * * * * *

A RESOLUTION AWARDING CONTRACT

WHEREAS, James T. Canizaro, Consultillg Architect pursuant to a Resolu- tion heretofore adopted,. has tabulated and considered all bids heretofore received for the auditorium chairs for the Wegro School Building, City of Oxford, Mississippi, and has duly made his recommendation to this Board of Mayor and Aldermen and it appearing from said recommendations and report that E.N. Martin, Jackson, Mississippi, is the lowest and best bidder for the auditorium chairs for the Negro School Building city of Oxford, Mississippi, in the sum of 11377.86 and that the Board of Mayor and Aldermen after considering said report.

NOW, THEREF04, BE IT RESOLVED BY THE MAYOR AND BOARD CF AlDWRMEN CF THE CITY OF OAFORD MISSISSIPPI AS FOLLOWS:

SECTION 1: That the bid of E.N. Martin, Jackson, Mississippi, for the auditorium chairs for the Negro School Building, in the sum of $1377.86 is hereby accepted, determined end declared to be the lowest and best bid; however, this award shall not be effective until the awardee shall have been notified by Mayor R.A. Williams in writing of such award. That upon the awardee being so notified in writing a contract for the construction of said work, as heretofore prescribed by the plans and specifications and contract documents, shall be forthwith executed for said construction. SECTION 2: That R.X. Williams, Mayor, is hereby authorized and directed to execute said contract ih the name of and for and on behalf of the Mayor and Board of Aldermen of the City of Oxford, Mississppi. The abofe resolution was thid day adopted by the Mayor and Board of Aldermen of the City of Oxford, Mississippi, in a Special Meeting. *,* * ** * * * * * * * * * * * * * * * * * * * * * *

There being no further business, upon motion duly made, seconded and passed, it was ordered that this Board do now adjourn sine die. /fA/ tua40-14,- Clerk Mayor SPECIAL MEETING

MAY 27, 1939

TO THE =MIND =CABERS OF THE BOARD OF ALDERLIN OF THE. CITY CF OXFORD, MISSISSIPPI

Notice is hereby given that a Special Meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City Hall, Oxford, Mississippi, at 12:00 o'clock noon Saturday, May 27, 1939, for the purpose of accepting the resignation of R.D. Davis, nightwatchman, gnd electing his successor and any other'business pertaining thereto.

Dated this the 27th day of May, 1939

Branham Hume, Alderman at large

C.S. Haney, Alderman Ward Four

B.O. Elliott, Alderman Ward Three

COWEN TO MEETING

We, the Mayor and Mambers of the Board of Aldermen of the City of Oxford, Mississippi, do hereby accept service of the above and foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Aldermen shall meet at the time and place .et therein named, and for the purpose stated therein. Witness our signatures this the 27th day of May, 1939

R.X. Williams, Mayor

B.O. Elliott Branham hume T.E. Arent C.S. Haney

* * * * * * * * * * * * * * * * * * * *

The Mayor and Board of Aldermen met pursuant to the above call at 12:00 o'clock Noon, when and where were present the following members:

Mayor R.X. Williams, Presiding

Branham Hume, Alderman At large

T.E. Avant, Alderman Ward 1

B.O. Elliott, Alderman Ward 3

C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * L.C. Andeews, City Attorney H.C. Bell, Deputy Clerk S.M. Keel, City Marshal

After the tasting had been opened according to law, the following business was transacted:

Alderman Elliott presented to the Mayor and Board of Aldermen the resignation of Mr. R.D. Davis, as night watchman as follows:

May 27, 1939 To the Mayor 4 Board 4 iAldermen City of OxfOrd . Oxford , Mississippi.

Gentlemen: I herewith tender my resignation as night watchman of the City tO become effective at once. Respectfully,

R.D. Davis

198 SPECIAL MEETING, MAY 27, 1939

On motion duly made by Alderman home and seconded by Alderman Elliott that Mr. Devis's resignation be accepted effective at 12 o'clock Noon, this the 27th day of May, 1939. The above motion was unanimously passed.

* * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Haney and seconded by Alderman Hume, that Mr. Davis be allowed the full month's salary of 4100.00 and that warrant be issued for this amount; that the Deputy City clerk be instructed to notify Mr. Davis of the acceptance of his regisnation and that said warrant for salary be made payable tc RID. Davis and Guy cook, as per assignment submitted to the Board by Guy Cook and signed by 'jr. R.D. Davis, jas shown hereinafter) upon the following conditions: Upon the return of your uniform and all other equipment purchased by the City of Oxford for your use, and the return of one 38 Special pistol taken from a Cohran negro and the 22 automatic pistol gotten from a negro woman at the Dew Drop Inn, who threw the gun down and ran away from scene of action, that said letter be delivered to Mr. Davis by City Marshal, Sam Keel, and said articles be delivered by Mr. Davis to Mr. Keel or the Deputy City Clerk at City Hall. The above motion was unanimously passed.

CCPY OF ASSIGNMENT I hereby sell, convey and assign unto Guy Cook the warrant due me by the City of Oxford for services rendered as night Marshall during the month of May, 1939, said warrant due me being in the amount of approximately $100.00 This the 27th day of May, 1939 R.D. Davis,; * * * * * * T * * * * * * * * * *

Upon motion duly made by alderman Hume and seconded by Alderman Elliott that a vacancy existed in the position of night watchman. The above motion was unanimously passed.

Alderman home nominated W.G. KiMmOns for the position of night watchman at a salary of $125.00 per month, he to receive none of the costs in cases in city court, and that the night watchman need not punch watchman's clock, except to register on and off duty and optional as to whether he wear uniform when on duty, said permission to remain in force until further ordered by Board. Nomination seconded by Alderman Avant, no other nominations being made for the position of night watchman, Mr. W.G. Kimmons was unanimously elected. * * * * * * * * * * *

Upon motion duly made by Alderman Avent and seconded by Alderman Bums that W.G. Kimmons be requested to furnish surety bond in the sum of $1250.00 expense to be borne by the City of Oxford. The above motion was unanimously passed. *II** * * * * * * * * * * * *

Upgen motion duly made, seconded and passed, it was ordered that this Board do now adjo sine • e.

C erk Mayor 199

SPECIAL MEETING

MAY 1, 1939

NOTICE CF SPECIAL MEETING • TO THE NMUBERS OF THE BOARD OF ALDER= OF TF2 CITY OF OXFORD MISSISSIPPI

Notice is hereby given that a Special Meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the City of Oxford, in the City Hall at 9 o'clock A;M. on Tuesday, May 16th, 1939, for the purpose of furnishing, renting or leasing of the old Mayor's office to Mr. F.L. Linker or otherwise disposing of it and matters pertaining thereto. This the 15th day of Nay, 1939

R.X. Williams, Mayor

CONSENT TO MEETING

We, the members of the Board of Aldermen of the City of Oxford, Miss- issippi, do hereby accept service of the above and foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Aldermen shall meet at the time and place therein named and for the purpose stated herein. Witness our signatures this the 15th day of May, 1939.

B.O. Elliott Branham Eume

W.T. Chandler 'T.E. Avent

C.S. Haney * * * * * * * * * *. * .* *,, * * -* * * -* ,* * * * * * * *

A quorum was not present, therefore, no meeting was held. 200 REGULAR MEETING

JUNE 6, 1939 OXFORD7 MISSISSIPPI UNITED STATES OF AMERICA STATE OF MISSISSIPPI

COUNTY OF LAFAYETTE

CITY OF OXF0RD 1939 * * * * * * * * * * * * * * * * * * * * * * * * * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session in the City Hall at 7:30 P.M., Tuesday, June 6th, 1939, it being the time and place for holding of said meeting, when and where the following were present: Mayor R.X. Williams Presiding

Branham Hume, Alderman at large

T.E. Anent, Alderman Ward 1

W.T. Chandler, Aldetman Ward 2 B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * al,

L.C. Andrews, Attorney H.C. Bell, Deputy Clerk C.E. Harrison, Supt. Light and Water slant S.M. Keel, Marshall After the meeting had been opened according to law the following business was transacted: Upon motion duly made and seconded it was ordered that the follow- itg accounts be allowed and that warrants be issued accordingly. From the

CORPORATION FUND

344.R.A. Williams, mayor May salary $80.00 345.Branham Hume, Aldermen ft $10.00 346. T.E. Anent, Alderman, n $10.00 347. W.T. Chandler, Alderman " $10.00 30. B.C. Elliott, Alderman ,-, $10.00 349.C.S. Haney, Alderman " $10.00 350.H.C. Bell, Deputy Clerk 't $50.00 351.Lillian Jones, Secretary " 352. Sam Keel, Marshall, May salary $N.C)0 353. Garland Kimmons, Night watchman for May $16.67 354.L.C. Andrews, Attorney for May--- $40.00 355.R.N. Whitfield, Band master for May $40.00 356.. Mrs. O.E. Holcomb, Matron for May $20.00 357. 0.H. Douglass, Cemetery upkeep for May $50.00 35d. Gathright-Reed Drug Co., Supplies .65 . 359. CzburnAbston and Company, Battery tester $1.00 360.Hughes Hardware, Suprlies for old school building 412.22 361. Butch Cohran, Lumber and building material $15.18 201 REGULAR MEETING, JUNE 6, 1939

CORPORATION FUND (Continued)

362. Elton Addington, 4 days work $10.00 363. J.A. Martin, Jr., office supplies $7.65 1 364. S.C. Toof and Company, Office supplies $10.30 365. Patton-Courtney Hardware, File .15 366.A.R. Taylor and Company, supplies $9.90 367. A.H. Lvent, Supplies $2.25 36 . Tennessee Valley Electric Company, supplies $35.22 369.3 National Theatre Supply Company, Supplies $2.80 370.Farmer's Warehouse Company, supplies 41.30 371. Standard Service Station, Oil for truck $1.00 • 372. Tom L. Ketchings, Office supplies $5.28 373. Oxford Eagle, Ordinance against slaughtering $3.98 374. Oxford Insurance Agency, rremium on bond $(1).25 3. Oxford Floral Company, Supplies $3.50 3 .International Business Machine Corporqtion, Clock k6.25 377. Hughes Hardware Com,)any, Building material $34.8 375. Hall Blacksmith, Repairs $1.05 379. Voestinghouse, Supplies $2.84 (;)..( 380. F.W. Belk's Garage Rep. bb truck $1.50 381. H.J. Lovelady, Hauling samd $17.25 C./ 382. W.P. Foley, Gas and oil .:7416•46 r,.,-.., 460. W.G. Kimmons, 1 day work $4.18 .e.r_l Total -ell 4628.11

STRUT FUND

383. S.E. Spears', Foreman, May salary $100.00 384. Doi) Davis, 4 days work $8.00 38. Western Autb Supply Company, Supplies $3.74 38i 7 W.P.P. Baley,'Gas and oil $32. .4 38 6 Hughes HardWare Store, Cement and rakes $2.66 389. Standard Sertice Station, Grease ans fuses $1.00 390. Dement Printing Company, Supplies - $4.55 391. Davis-MizeCompany, Files ---$2.25 392. Patton-Courtney Hardware, Lime, blades, etc $4.17 393. Oxford Service Station, Gas and oil $1.52 394.J.A. Martin, Jr., Street brooms $9.18 395.W.S. Darley and Company, lens for street light $2.71 396. W.T. Jones, Keeping prisoners for May 30 .7 397. • Carpenter and son, 1 tire for flusher---- 15!g1 .2.2 Total $254.55

SCHOOL FUND 398. O.D. Smith, Pro rata share of May salary $24.00 399. Will Isom, Janitor for May .$50.00 400. Claudia Thompson, Miid for May 415.00 401 , Oxford Floral Company, Moving shrubs ,L$4.50 402. Patton-Courtney. Hardware Company, Repairs and Rep. 019.b0 403. R.H. Gillespie,' Riplubronandtbeplicante440-...: $14199 404. Alex-Loeb, Music and athletics . 414.05 40 • Vinton School Form Company, Supt. office exp. $3.00 4 Commercial Print Shop, 4'upt. office exp. $3.75 407. Z.A. Martin, Jr.* Supt. office expense $5.50 406. Wilma Rushing, 14 days work $21.00 409. C.A. Gregory Company, Administrative Exp. $6.45 410. American Badge Company, Administrative Exp. 43.04 411. A.H. Arent, Repairs and replacements $1.60 412. Oval and Koster, Administrative Exp. $2.05 413• Allyn & Bacon, Library exp. .93 414• California State Dept. Education, Library Exp. 41.00 415. Southern California School Book Dept. Adm. Exp. $19.85 416. Vestal Chemical Laboratories, J anitor supplies- $13.75 417. A.C. McLlurg and Co., Material for Inst. $10.66 LP-bi• Pittsburgh Plate Glass Company, Repairs and replacements----$16.44 .Total 246.43 202 REGULAR NIEETING, JUNE 6th, 1939

LIGHT AND WATT; FUND 419. C.E. Harrison, Supt., Aay salary 4945.0 420. C.W. Johnson, Engineer, May salary 0135.00 421. A.L. Mullins, Engineer, " " 1125.00 422. Louis Campbell, " " it 4105.00 It 423. R.H. Hinter, “ II 4125.00 424. H.C. Bell, Deputy Clerk, Flay salary $50.00 425. Lillian Jones, Secretary, May salary $40.00 426. B.S. Guyton, Rent for ;v.ey 435.00 427. T.A. Dunn, Rent for lay $50.00 426. Mrs. Lillie Yates, Rent for May 010.00 429. Cabell Electric Company, Electrical supplies 41.42 430. Arkansas Fuel Oil Comp ny, Fbel oil $ E17.46, 431. kittsburgh Equitable Meter Company, meters and repairs---0.7.16 432. The Texas Company, Lubricating oil $52.79 433. Westinghouse Supply Company, Electrical supplies 47.24 434. F.N. Belk Garage, upkeep of truck .6o 435. Hughes Hardware Company, Small supplies and hacksaw 411.33 436.444 Service Station, gas and oil- 'w33.3; 43 . Mue ler Company, Water supplies $3.3.04;' 43,. Mississippi Foundry and Machine Company, water supplies-424.06 439. H. Blockman Company, Waste, (rags) 412.00 440. Cooper Petroleum Company, Fuel Oil 4263.88 441. Dovis-Lize Company, Gold dust 412. Patton-Courtney Hardware, supplies- - 'f:D A13. American Locomotive Company, Repairs and welding- 4-'0.00 444. ::ell Mochirery And supply Company, meter and repairs---$116.04 44 . CY 4'ond Service Station, Sundry- .P0 44 . J.E. Dilwortl.._ company, ';; ate sup2lies aLl irrdware--- __. ,e..;(i 447. Hall Blacksmitl Shop, Slarpening pic!:a 44'q). Tz0P ical l'aint ericl Gil Company, Sundry- tiK61 449• w." Haley, Gas and oil ,11.101 450. Tennessee Valley Electric Company, Electrical supplies-- 7.72 451. Tirane Company, Clay pipe and water supplies--- 4 0.4 452. Riechman Crosby Company, Electrical supplies 0e.4 453• N. 0 . Nelson Company, ,later supplies 41.45 454. Craybar Electric Company, Truck body 4284..58 455. Standard Oil'Company, Lubricating Oil 42.41 456. Western Auto Store, Small supplies and hardware $1.22 45 .De LaVergne Engine Company, Repairs and welding $171.88 45, Duncan Electric Aanfacturing Company, Ureters and repairs----49.51 Total 2910.4e1

BOND FUND

459. Chase National Bank, Commission for paying coupons 06.12

203

REGULAR MEETING, EUVEH6th, 1939 OXFORD, MISSISSIPPI

A petition was presented to the Board by ors. Ada Melerty, as follows:

TO THE HONORABLE MAYOR AND BOARD CF ALD ° of OF CITY OF OXFORD, MISS.

We the undersigned citizens of Oxford and Lafayette County respectfully petition you to open and maintain for all weather travel that part of Jefferson Avenue, now closed, that lies east of North sixteenth Street. Attention is called to petition circulated for the Board of Supervisors to ppen and maintain a road connecting this street with the Old Oxford and Pontotoc road near the home of Mrs. Ada MeLarty. Attention is called to the fact that the connecting of these two will open an area inside the corporation for development and also an area just beyond the corporation line for the same purpose. Signed: Mrs. Clifton Price, Mrs. Dda MeLarty, et al.

Upon motion duly made by Alderman .11iott and seconded b Alderman haney that said petition be tabled. The above motion was unanimously passed.

* * * * * * * * * * * * * * *

C\1 r—Lo 116T. Roy Bailey brought to attention of the Board a request that the city put in drainagel system across west side of Pegues lot to take care of surface water .cfr! from west and south.

On motion duly made by Alderman Elliott and seconded by Alderman 4aney that the Mayor and Board with the City Attorney, L.C. Andrews, meet at 10:30 A.M. Wednesday morning and look over the situation, reporting back at next weeting of the Mayor and Board of Aldermen. Above motion was unanimously passed. * * * * * * * * * * * * * *

Mr. R.F. Campbell and "r. L.L. Roebuck appeared before the Board in the matter of black topping North 4th street. The Board advised that the City Engtneer survey and stake out just where the prpperty owners want said street located and make description of property where said street would encrough on their property. The property owners abutting on said street then to make deed to city for whatever land necessary to locate street where desired. when property owners have located stteet and deeded necessary loand to the city of Oxford they would proceed to grade and blackttp said street. * * * * * * * * * * * * * * * * *

Campbell appeared before the Board with complaint against Mr. Claude Patterson not having any of his houses on his property connected with sewerage system or sanitary out houses.

On motion of Alderman hume and seconded by Alderman Avent that City Attorney Adnrews draw up a resolution supporting the County neelth Unit in its work in the corporation and the County health Unit to furnish him a list of property owners not complying with the Ordinance or Ordinances on Sanitation, bncorporating thereion provision to enforce said ordinances and penalities, ete. The above motion was unanimously passed. * * * * * * * * * * * * * * *

With reference to passing of Milk Ordinance it was thought best to pospone same until the new rules were issued by the Government and adopted by the State in June or July. Above motion was unanimously passed. * * * * * * * * * * * * * * * *

With reference to building ordinance covering sewerage, Dr. Armstrong stated he would secure and furnish a copy of a Building Ordinance by City of Meridian. * * * * * * * * * * * * * * *

On motion duly made b Alderman Hume and seconded by Alderman Chandler that Mr. F.L. Linker be granted permission to put up campaign banners across North Lamar Avenue near First National Bank and South Lamar Avenue at entrance section of highway 6 and 7 or near Mack's Cafe also across street by or near the old Mayor's office at his Headtuarters and that 1h'. Harrison's crew assist in putting up said Banners. The above. motion was unanimously passed. 204 REGULAR MEETING, TUNE 6th, 1939

Pertaining to matter of Mr. H.E. Denton wanting to buy alley in rear of the old Lawhorn Ice Plant be passed to next meeting and in meantime check up and see if city owns dead alley or not. * * * * * * * * * * * * * * * *

On motion duly ade by Alderman Avent and seconded by Alderman Elliott that the city advertise for bids for hay to be cut inside of the airport fence during year 1939. E4ch bidder to deposit cashier check for full amount fo bid.

The above motion was unanimously passed. * * * * * * * * * * * * * * *

On motion duly made by Alderman Chandler and seconded by Alderman Avant that Mayor Williams appoint some one to look after the cities interest in checking and collecting commission due city on any program on the Municipal Airport. The above motion was passed.

Mayor Williams then appointed H.C. Bell, Deputy City Clerk, to ajlend to same. * * * * * * 4, * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that the City Attorney, L.C. Andrews, draw up a contract between the City of xford and Oxford Soft Ball Association on the basis of the Commercial Electric light rate. The above motion wee unanimously passed. * * * * * * * * * * * * * *

Mr. Caldwell presented a copy of the official mpa of the City of Oxford made by him under contract, the cityhhaving one week to accept or reject said map and Mr. Caldwell to make any changes or corrections desired by the Mayor and Bcard of Aldermen.

Alderman 'Arent went home at this time.

On motion duly made by Alderman Elliott and seconded by Alderman Chandler that Mr. Caldwell be advanced bhe sum of 425.00 on his map contract. The above motion was passed. * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that Mr. Caldwell be allowed the sum of $65.00 to work with the Deputy City Clerk in making up a complete assessment roll from the official map providing that Mr. Caldwell furnish the city with the copy of map on which all names of property owners are shown or an exact copy of same. The above motionwas passed. * * * * * * * * * x *

On motion made by Alderman Chandler and seconded by Alderman Elliott that the Deputy Clerk renew contract with the CCC Camp on electric lights and water on basis of old contract. The above motion was unanimously passed.

* * * * * * * i * * k *

On motion duly made by alderman Hume and seconded by Alderman Elliott that Mr. Harrison make an estimate of the cost of making necessary changes suggested by the Rating Bureau to secure reduction on insurance rates in the city. The above motion passed.

On motion of Alderman Chandler and seconded by Alderman Elliott that Alderman Fiume and Alderman "aney accompany the Mayor and other i11dermen to the meeting to be held in Grenada, Mississippi, at the City Hall at 2 o'clock, k.M. Tuesday, June 13th by the Mississippi elanning Commission. The above motion passed. * 4 * * 4 4 lc NI' Ie 205

REGULAR MEETING, June 6th, 1939

On motion duly made by Alderman Elliott and seconded by Alderman Chandler that the city make a donation to the summer playground Committee from the PT( for a summer program for the children of the cit7. The abountofthedonation :toz156.$50.00. The above motion was passed. * * # * * * y * * * * * * * * * *

The Board ordered that Mr. Spears cut limbs adjoining E.W. BeardIs e residence providing the property owners have no objections. Also, upon motion duly made by Alderman Hume and seconded by Alderman Elliott that M:". Spears, if agreeable T,Ith him, dump the garbage on his on place and dis- continue using the present location. The above motions were passed. * * * * * * * * * *

On motion by Alderman Hume and seconded by Alderman Elliott that the Marshall, Mr. Keel, see 'r. Cofield and notify him to keep his dog off the streets. The above motion was unanimously passed.

* * * * * * * * .4- * - * * 117)

(.7■2 On motion duly made by klderman Hume and seconded by Alderman Haney r- that Mr. Spears be instruct to buy lumber end nails and board up the space 0.00 between Brown's barn and store room. The above motion was passed. <..11 * * * * * * * * M * * * * * * .

On motion by Alderman Hume and seconded by Alderman Ellio t t the catch basin in front of Lynch"s place On North Lamar Street be over to where it will drain off the water properly. The above motion was unanimously passed.

Mr. Chandler went home at this tire.

* * * * * * * * * * * *

On motion duly made by Alderman Bume and seconded by Alderman flaney that Mr. Spears be instructed to remove as garbage the junk and material on the city's property in front of Hall's Blacksmith Shop if same is not removed by the 10th day of rune, 1939. The above motion was unaimously passed. * * * * * * * * * *

On motion duly made by Alderman Haney and seconded by Alderman Elliott that the account of W.D..Pettif for the month of May amounting to $91.40 be held up until the side walk project has been completed and that the Deputy Clerk notify Mr. Pettis to meet with the Board at its meeting on Tuesday night, June 13th, 1939, at 7:30 P.M. to report the progress he is making on this project. The above motion carried. ** * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Aldermen Elliott that gas for the City Light and Water truck and City Garbage truck be purchased from J.B. Carpenter and Son at a price of 160 per gallon until next regular Board meeting. The above motion was passed. * * * * * * * * *

Upon motion duly made and seconded, it was ordered that this Board do now recess until Wednesday, June 7th, at 10:30 L.

• [ 2 Utz RECESSED MEETING, JUNE 7th, 1939

The Mayor and Board of Aldermen met pursuant to a recess Order of June 6th, 1939, at 10:30A.M. when and where were present the following members:

Mayor R.X. williams, Presiding Branham Hume, Alderman at large T.E. Avent, Alderman Ward One

V.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman hard 3 C.S. Haney, Alderman Viard 4 * * * * * * * * * * * * * * * *

L.C. Andrews, Oily Attorney Lillian Tones, Secretary a

After the meeting had been opened according to law, the follbwing business was transacted to-wit:

Pursuant to motion made and passed at a regular meeting of the Mayor and Board of Aldermen on June 6th, 1939, the Mayor and Board of Aldermen in- vestigated the drainage across the lot of Mrs. I.E. Pegues. Upon motion made by Alderman Hume and seconded by Alderman Haney it was ordered that C.E. Harrison, Superintendent of the Light and Water Plant, go down to this lot and estimate which would be cheaper to run the drainage pipe north and south or across the lot of Mrs. I.E. Pegues and then ask the WPA Malaria Control Division to open up ditches. The above motion was unanimously passed.

* * * fi * * * =7, * * * * * * * * * *

Upon motion duly made byt Alderman Haney and seconded b Alderman Hume that the permission for Kbuilding a filling station on the corner of SID. Roane's lot be held up intil permission is granted from the neighbors 08 S.D. Roane * * * * * * * * * * * *

Upon motion duly made b Alderman Hume and seconded by Alderman Haney it was ordered that the buying of a spare tire for the street truck be passed until next meeting. * * * * * * * * * * * * * * * * * *

Upon motion duly made by Alderman Hume and seconded by Alderman Avent it was ordered that Mr. Joe Irby submit plans and specifications to the Mayor and Board of Aldermen for the lowering of the side walk for approval before thl Board passes on same. * * * * * * * * * * * * *

Wei 'lig UV 11 IOi 6WC1 0;Ad'it11611is tOard- do noia"r eat di Tuia4V 3q6) 13vh , 7-Z0 0 ClOtk 207 SPECIAL MEETING, OXFORD, MISSISSIPPI, JUNE 8th, 1939

NOTICE CF SPECIAL MEETING.

To the Members of the Board of Mayor and Aldermen of the City of Oxford, Mississippia Notice is hereby given that a Special Meeting of the Board of Mayor and Aldermen of the City of Oxford will be held in the Mayor's office at four o'clock P.M. on the 8th day of June, 1939, for the purpose of considering an offer of the United States of America to aid b, way of grant in financing the construction of a school building, including necessary equipment and adopting a resolution approving and authorizing the acceptance of such offer. Dated this the 8th day of Tunel b939.

"williams, Mayor

CONSENT TO MEETING

We, the undersigned, being all of the members oftthe Board of Aldermen of the City of Oxford, Mississippi, heregy accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Aldermen shall meet ,at the time and place therein named, and for the purpose therein stated. W.T. Chandler Branham Hume B.O. Elliott C.S. Haney Mr. Avent, Alderman W ard 1, being out of town, the notice could not be served on him. * * * * * * * * * * * * * * * * * * * * * * *

A special meeting of the Board of Mayor and Aldermen of the City o Oxford, Mississippi, held pursuant to the preceding call of the Mayor, was held on the 8th day of :tine, 1939. The meeting was called to order by the Mayor and on roll call the following answered present: ______Branham Hume Alderman Ward 31--) W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4

The Folloing were absent: T.E. Avent, Alderman W ard 1 The members named constitute a majority of all the metbers•of the Board of Aldermen of the City of Oxford, Mississippi.

• After discussion of the Offer of the United States of America to aid by way of grant in financing the construction of a school building, including r— necessary equipment, the following Resolution was proposed b . -tilderman Hume and read in full:

A RESOLUTION ACCEPTING THE OFFER OF THE UNITED STATES TO THE CITY OF OXFORD, MISSISSIPPI, TO AID BY WAY OF GRANT IN FINANCING THE CONSTRUC- TION OF A SCHCDL BUILDING, INCLUDING NECESSARY. EWIPMENT.

Be it resolved by the Board of Mayor and Aldermen:

SECTION1: That *he Offer of the United States of America to the city of Oxford to aid by way of grant in financing the construction of a school building, including necessary equipment, a copy of which Offer reads as follows, be and the same is hereby in all respects accepted: 208 SPECIAL MEETING, JUNE 8th, 1939

"FEDERAL EMERGENCY ADMINISTRATION"

OF PUBLIC WORKS

Washington, D.C.,

Dated: June 5, 1939

Docket No. Miss. 1245-F

City of Oxford,

Oxford, Lafayette,County, Mississippi

1. subject to the Terms and Conditions (PWA Form No. 230, as amended to the date of this Offer), which are made a part hereof, the United States of America hereby offers to aid in financing the construction of a school building, including necessary equipment (herein called the "Project"), by making a grant to the City of Oxford, Mississippi (herein called the "applicant"), in the amount of 45 per cent of the cost of the -eroject upon completion as determined by the Federal Emergency Administrator of Palle Works (herein called the "Administrator"), but not to exceed, in any event, the sum of *21,129.00.

2. Ey acceptance of this Offer the Applicant covenants to complete the -iroject with all practicable dispatch, and in any event by July 2Q, 1939, 3. This Offer is made subject to the express condition that, if the Administrator shall determine at any time that the Applicant has paid or agreed to pay, whether directly or indirectly, a bonus, commission or fee to any person, firm or corporation for attemptong to procure an apprival of the Applicant's application, of for alleged services in procuring or in attempting to procure such approval, or for activities of the nature commonly known as lobbying permofmed or agreed to be performed in connection with the application, then the Administrator shall have the right, in his discretion, to rescind this Offer and any agreements resulting herefrom, and in the event of such rescission, the United States of'America shall be under no further obligation hereunder.

4. The acceptance of this Offer by the Applicant shall effectuate a 9ancellation of the contract created by the acceptance of the Offer dated rune 24, 1938, made by the United States of America to the Applicant: Provided, that the cancellation of such contract shall not impair or vitiate any acts performed or proceedings taken thereunder prior to such cancellation, but ol_1..eh nets or preceedinc7s mey le continued under the contract created by the qcceptance ofth!_ Offer.

Emer7eney ;:orks

By (3L1) Clark For the A",,sestent Administrator

SECTIbNZ: That said City of Oxford agrees to abide by all the Terms and Conditions of said Offer, including the Terms and Conditions aneexed hhereto and made a part thereof.

SECTIOE 3. That the Clerk be and he is hereby authorized and directed forthwith to send to the Federal Emergency Administration of Public Werke three certified copies of the proceedings of this meeting in connection with the adoption of this R esolution, setting forth this Resolution in full, and such further documents or proofs in connection with the acceptance of said Offer as may be requested by the Federal Emergency Administration of lic Works.

R.I. Williams Mayor The above Resolution was seconded by Alderman Haney and was adopted, with the following voting aye: W.T. Chandler, Branham liume B.O. Elliott C.S. Haney SPECIAL MEETING, JUNE 8th, 1939

and the following voting nay: None

The Mayor thereupon declared said R solution carried and the Mayor thereupon said Resolution in approval thereof:I,

* * * * * * * * * * * * *

Upon motion duly, made and seconded it was orderg that this Board do now liketj0Orit1atie jdit.

• 2 ■4

RECESSED MEETINa, DONE 13, 1939 OZENRD, MISSISSIPPI

•The Mayer ale Board of Aldermen met pursuant to a Recess order of Juaq Oth t 1939, at 7•30 P.M. when and where were present the following members: Mayor R.X. Williams, Presiding Branham Hume, Alderman at large

T.E. Avant, Alderman Ward 1 W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3

C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, Attorney H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted db-wit: Joe Irby appeared before the Board with request that side walk on North side of lot of Mr. Lee Davis facing Jackson Avenue be lowered so that drive way could be put in.. No action taken/ * * * * * * * * * * * * * * * * * * *

At the request of the Boars, Mr. Walter D. Pettis, City Engineer appeared explaining to the Board the present status of the Side-Walk Project, as well as other work he had been doing for the city. Mr. Pettis stated that he felt the action of the Board made it appear to him that his services were not satisfactory and he would therefore terminate same, effective at once. That any further work he did for the city would be at his regular chargew1010.00 per day. Alderman Hume stated that it being necessary to approve all billsthat he rel it that the Board should know something about the work, being donel After same liscussion on the subject Alderman Hume suggested that if agreeable to Mr. Pettis his connection with the city stand as "status quo". On motion duly made by Alderman Hume and seconded by Alderman Elliott that Mr. Pettia•s account or the month of May be • allowed. The above motion passed. * * * * * * * * * * * * * * * * * * * Pat Haley appeared before the Board in the matter of City having discontinued buying gas from him for city truck. le was advised that J.B. Carpenter & son had made a lower price than he had been making. On motion duly made by Alderman Hume and seconded by Alderman Avent that the city attorney, Mr. Andrews, ascertain the proper time and prepare the proper advertisement for the city to advertise for bids on gasoline and motor city trucks. The above motion passed. * * * * * * * * * ** * * * * Mr. W.L. Caldwell appeared before the Boa had made and presented to the City of OxfordlMr. During the discussion Alderman Chandler went h Alderman Hume mend seconded by Alderman "aney official map of the City of Oxford and that city the proper remolut*on to be spread on the minute tAlic • RESOLUTION Whereas, the Mayor and Board of Aldermen of'4,14A4' Minute ▪ appearing on page of Minute Book No. 10, of and Board of Aldermen, 'on file in the proper offil et with W.L. Caldwell to make a map of the streets, of Oxford, Miss., And whereas, the said W.L. Caldwell blocks and Lots, and submit the same to the said their approval and correction; And, Whereas, said Mayor and Board e sa and has been checked and the same corrected, and should be approved: Therefore, be it resolved by said Mayor and Board of Alderman that said Map be and the same is hereby approved, and said Map shall constitute the official map of said Municipality, and a duplicate thereof be filed in the office L 212 RECESSED MEETING, TUNE 13th, 1939

of the chancery Clerk of itfayette County, Mississippi, in the manner provided by law. Be it further ordered that in adopting and approving said map street belonging to the city of °xford and not heretofore conveyed by said city shall be released, or the City of Oxford's title to same relinquished to any person, but its title shall remain the same as if the dap had not been approved and adopted. * * * * * * * * * * * * * * * * * * * *

On motion duly made by Aldermen Hume and seconded by Alderman Elliott that Mr. T.D. Pettis be authorized bbo buy the necessary material and have constructed a cabinet for the proper filing and indexing of the different blue prints, etc made for the City, to be installed in the office of the City Engineer, at the expense of the City. The above motion passed. * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that Mr. W.L. Caldwell be paid the contract price of $370.00 for making map of the City of xford, less amount advanced him. The motion passed. * * * * * * * * * * * * * On motion duly made by Aldermen Hume and seconded by Alderman Elliott that Mr. W.L. Caldwell be allowed the additional amount of $20.00 for putting on the map the'SiveleyVAdditeon:' Abbve motion passed. S' * * * * * * * * * * * * ** * *

_On motion duly made by Alderman Hume and seconded by Alderman flaney that W.L. Caldwell be employed to work with the City tax col for to make the proper assessments from the official map also, to furnish Wadditional copy of the official map showing thereon all the named of the present property. owners on said lots and parcels of land, and to make all csorrectionsfound necessary. on said map. Above motion carried. * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that the pigtion of the Dunn Building, except that part partioned off and which had been used as a grocery store, be leased to Mr. W.L. Caldwell to operate a laundry, as of July 1st, 1939, at rental of $25.00 per month. The City reserving the right to terminate said lease on thirty days notice. The above offer to be approved by of Mr. T.A. Dunn. Above motion passed. * * * * * * * * * * * * * * * * * * * * * * * * * Caldwell presented request of Mrs. James Stone, Sr., that a certain portion of her land be taken into Corporation. On motion duly made by Alder-

man Hume and seconded by . Alderman Elliott that this matter be passed until all members were present. the above motion passed. * * * * * * * * * * * * * * * * * *

On motion of Altd0Man Hume and seconded by Alderman Elliott that bid of Tommie Foshee be rejected and money returned for the cutting of hay on the Oxford Air Port. Passed * * * * * * * * * * * * * * * * * * * *

Petition for removal of Bramlett's Barn on North 11th street signed by W.P. Reynolds and others. On motion duly made and seconded that the Deputy elerivuotgy the petitioners and Dr. E.S. Bramlett that said petition was passed to next Regular meeting and reques that they be present at this meeting. Also, that the Deputy Clerk have Mr. W.L. Caldwell and mi.. W.D. Pettis check North 9th street and 11th Streets as to distance that was open and belonging to city. * * * * * * * * * * * * * * * * * * * *

At petition of Mrs. Ralph White for additional street linght on North 7th Street. On motion duly made and seconded that Mr. C.E. Harrison make a esoverves to what additional street lights were needed on North 7th Street between Intersection of Jackson and 7th street and I.C.R.R. crossing and to add whatever pwpss'by lightsobdoensidered necessary to properly light said street. Motion passed. * * * * * * * * * * * * * * * * * 213 RECESSED MEETING, JUNE 13th, 1939

On motion duly made and seconded that the Deputy Clerk notify Mi.:- Denton that the city does not own the 9' north and south and 61.8' east and west of alley north of his warehouse on Harrison and 11th Street, but that Mr. Sneed and others have an easement on said alley as passageway. Above motion passed. * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hums and seconded by Alderman Elliott that the contract between the City of Oxford and Oxford Soft Ball Association be spread on the minutes of the Board, as follows:

CONTRACT This agreement made and entered into this the 14th day of June, A.114, 1939, by and between the City of oxford, of Lafayette County, Mississippi, party of the first part, and Soft Ball Association, of Oxford, said state, by and through Jack Gordon, President, Carlisle Wilson, Vice President, Gemmel Buffaloe, Secretary and Treasurer, and F.M. Posey, director, parties of the second part, witnesseth:

That for and in consideration of the party of the first part furnishing the power, current or electrical energy to light the American Legion Field, same being in the rear of the University High School, in Oxford, said County and state, for a period of three months, beginning May 15th, 1939, and ending August 15th, 1939, particle of the second part agree to pay said party of the first part at the end of each 30 day period during said three months party of the first part's regular commercial rate per kilowatt hour for such power furnished in lighting said field during the period aforesaid. Signed on the day and year first above written. City of oxford By R.X. Williams, Mayor B.C.• Elliott Soft Ball Association by Jack Gordon Carlisle Wilson George Buffaloe PoSey It is ordered that said contract be executed for and on behalf of said City of "xford, by its Mayor and Clerk.

The Above motion was passed. * * * * * * * * * * * * * * * * * * * * * * * * * * * *

On motion dilly made and seconded that the Deputy Clerk send Mr. W.P. Haley a copy of Hog Ordinance and request that he comply with said Ordinance. Above motion carried. * * * * * * * * * * * * * * * * * * * * * * * * On motion duly made by Alderman Hume and seconded by Alderman Haney that the following sanitary Resolution be adopted and spread on the minutes: y WBERFAS it has been reported to the Mayor and Board of Aldermen of Oxford that the ordinance adopted on the 3rd d of August, mi ly, recorded in Ordinance Book Mo. 9, at page 224, on file in the eiyoes office of said city is being violated:, AND, MMUS the County Health Unit of Lafayette County, Mississippi, by and through Dr. J.H. Armstrong, does declare the conditions existing on certain premises are violations of the above ordinance of the City of Oxford and the Rules and Regulations of the State Board of Health, and as such should be corrected: AND, WHEREAS, these conditions have existed, to the detriment of the public health of the citizens of Oxford, Mississippi, even though an ordinance regulating excreta disposal has been in effect since August 3rd, 1937: NOW? THEREFORE, be it resolved by the Mayor and Board of Aldermen of the City of Oxford that it is the will of the Mayor and Board of Aldermen to cooperate with the said County Health Unit in the enforcement of said ordinance: 214

RECESSED MEETING, JUNE 13th, 1939

Be it further resolved that copies of said ordinance be delivered to the marshall of said city, and that he in cosapany with Doctor J.H. Armstrong, or his assistant, Mr. Keith Smith, give to each person alleged to be violating said ordinance a copy of same, and notify each offending party that if their premises are not put in sanitary condition required by said ordinance within 30 days, such persons not complying with the provisions thereof will be prosecuted, and the ordinance enforced against them.

The above motion approving this Resolution was unanimously passed. * * * * * * * * * * * * * * * * * * * * * * * * *

On motion lade by Alderman laney and seconded by Alderman Elliott that to correct conditions made by the City, that tile be laid down ditch instead of around the other way, by securing an easement from the owners of Lot 84, 28-8-3, on Garfield Ave. between South 10th street and South Lamar Street, as will be a saving of some $40.00 and the further consideration that there will be built homes if this condition is corrected. Those voting "Aye": Alderman Elliott and Alderman Haney. Thbse voting "nay", Alderman Hume. * * * * * * * * * * * * * * * * * * * * * * * *

On motion duly made and seconded that W. Harrison make necessary arrangements for Nmen t s supper and dtill. Above motion passed. * * * * * * * * * * * * * * * *

On motion duly made and seconded that the City advertise for bids for 500 feet of Underwriter's standard fire hose.

NOTICE

Above motion passed. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *

In the matter of letter from Electric Home And Farm Authority, signed by A.T. Hobson, secretary, dated June 7th, 1939, stating that they had been advised that the city desired to have cancelled the agreement dated April 7, 193#. On motion duly made and seconded it was ordered that the deputy clerk reply to said letter that the city had not requested cancellation hor desired same bo be cancelldd. Above motion carried. * * * * * * * * * * * * * * * * * * *

Upon motion duly made and seconded that this Board dorecess until July 5th, 1939, at 7:30 P.M. 215'

NOTICE OF SPECIAL MEETING '

To the Members of the Board of Mayor And Aldermen of the City of Oxfod4, Mississippi: Notice is hereby given that a special meeting of the Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the Mayor's office at 3 o'clock P.M. on the 15th day of June, 1939, for the purpose of considering the matter of running a sewer line to the property of Claude Patterson's situated in the City of Oxford, Mississippi. R.X. Williams, Mayor

CONSENT TO MEETING We, the undersigned, being all the members of the Board of Aldermen of the City of oxford, Mississippi, hereby accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Aldermen shall meet at the time and place therein named and for the purpose therein stated. Avant, Branham Hume C.S. Haney W.T. Chandler

Mr. B.O. Elliott, being out of town the notice could not be served on him.

No quorum present. Meeting not held 216'

NOTICE OF SPECIAL MEETING

To the "ambers of the Board of Mayor and Aldermen of the City of Oxford, Mississippi:

Notice is hereby given that a Special meeting of him Board of Mayor and Aldermen of the City of Oxford, Mississippi, will be held in the Mayor's office at 7 o'clock P.M. on Thursday, June 22nd, 1939, for the purpose of Awarding Contract for Auditorium chairs and two typewriters for negro school building, PWA Docket 1245-E, to E.N. Martin, who was, on May 26th, 1939, awarded contract for auditorium chairs for the sum of *1237.86 and two typewriters for $140.00, making a sum total of $1377.86, the amount shown in the resolution adepted may 26th, 1939, but failed to include and specify the typewriters. Alsof, for the purpose of considering and adopting and passing of a zoning ordinance for the City of Oxford, mississippi, as provided in Chapter 333, of the Laws of Mississippi, of 1938 and if the Mayor and Board of Aldermen decide to pass and adopt such ordinances, then adopt and pass same and do any and all other things necessary to validly pass and adopt said zoning Ordinance and all other things pertaining thereto.

Dated this the 22nd day of Tune, 1939 Cx. Williams, Mayor

CONSENT TO MEETING

We the undersigned, being all the members of the Board of Aldermen of the City of °xford, Mississippi, hereby accept service of the foregoing notice,, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Alddrmen shall meet at the time and place therein named, and for the purpose therin stated.

B.O. Elliott, Alderman Branham Hume C.S. Haney T.E. Avant

W.T. Chandler, Alderman Ward 2, being out of town,the notice could not be served on him. * * * * * * * * * * * * * * * *

The Mayor and Board of Aldermen met pursuant to the above call of the Mayor and the meeting was held on June 22nd, 1939.

The meeting was called to order by the Mayor and on roll call the tollowing wanswered present:

Mayor R.X. illiams, residing

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

B.O. Elliott, Alderman Ward 3

G.S. baney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * * L.C. Andrews, Attorney A.C. Bell, Deputy Clerk After the meeting had been opened according to law, the following business was had to-wit:

RESOLUTION AWARDING CONTRACT

WHEREAS, James T. Canizaro, Consulting Architect, pursuant to a Resolu- tion heretofore adopted, has tabulated and considered all bids heretofore received for the auditorium chairs and typewriters for the Negto School Building, City of Oxford, Mississippi, and has duly made his recommendation to this Board of Mayor and Aldermen and it appearing from said recommendations and report that E.N. Martin, Jackson, Mississippi, is the lowest and best bidder for the auditorium chairs and typwriters for the Negro School Building of Oxford, Mississippi, in the sum of $1377.86 and that the Board of Mayor and Aldermen after consider said rrport.

NON, THEREFORE BE IT RESOLVED BY THE MAYOR AND BOARD OF ALDERMEN 217 SPECIAL MEETING, TUNE 22nd, 1939 ar TSB MITT OF OXFORD, MISSISSIPPI AS FOLLOWS: SECTION 1: That the bid of E.N. Martin, Jackson, Mississippi, for the auditorium chairs and typewriters for the Negro School Building in the sum of *1377.86 is hereby accepted, determined and declared to be the lowest and best bid; however, this award shall not be effective untib She pwardee shall have been notified by Mayor R.X. Williams innr writing for such award. That upon the awardee being so notified in writing a contract for the construction of said work, as heretofore prescribed by the plans and specifications and contract documents, shall be forthwith executed for said construction. SECTION 2: That R.Z. Williams, Mayor, is hereby authorized and directed to execute said contract in the name of and for and on behalf of the Mayor and Board of Aldermen of the City of Oxford, Mississippi.

The above resolution was this day adopted by the Mayor and Board of Aldermen of the City of Oxford, Mississippi, in a Sppcial Meeting.

* * * * * * * * * * * * * * * * * * * *

Be it remembered that the Mayor and Board of Aldermen of the City of xford, Mississippi, met in the City "all, being thepplace designated by law for holding meetings of the error and Board of Aldermen of the City of Oxford at 7 o'clock P.N. on the above date, same being thammopdatinmealsof said Board.

Upon motion duly made and seconded, the following Resolution was placed upon its adoption:

WHEREAS the Mayor and Aldermen of the City of 'xford, Mississippi, desire to co-opeiate with the Mississippi State Planning Commission in Sponsor- ing a basic comprehensive survey project in several municipalities in the State of Mississippi.

AND WHEREAS, the Mayor and Aldermen of the City of Oxford, Mississippi, agree to co-operate in sponsoring said project by furnishing headquarters for operating said project, by furnishing the necessary equipment for the headquarters of said project, by paying for incidental expenses in maintaining the local headquarters of said project and defraying cost, in part, of technical assistance, direction, and consultation. THEREFORE, BE IT RESOLVED that the appropriate officers, Ra. Williams, mayor, B.O. Elliott, Clerk, and N.C. Bell, Deputy City Clerk, of the City of '1xford, Mississippi, are authorized, directed and empowered (1) to furnish local headquarters for operating the above mentioned survey project:

(2)to furnish the necessary equipment for the local headquarters fo said project, and (3)to draw warrants upon the city funds in favor of said project to pay for the indidental expenses in maintaining the local headquarters E said project. (4)To make payments for technical sassistance and advice in an amount of 1150.00 per month for a period not to exceed 6 months from the beginning of the proposed survey. -, It is ordered by the Mayor and Board of Aldermen of that the above is hereby adopted. * * * * * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Elliott and seconded by Alderman Name that the Mayor; R.X. iilliams, Attorney L4. Andrews and Deputy Clerk, H.C. Bell, compose a letter to the Arkansas Fuel Oil Company stating that the Mayor and Board of Aldermen had been informed they were proceeding to build a filling station on -their lot on South Lamar Street (purchased from Dr. East) and advising them that the City of Oxford had twice refused said Company a permit to build said filling station and that the City of Oaford would not grant a permit for said filling station, but would use all lawful means to prevent them from building said filling station, * * * * * * * * * * * * * * * * * * * * r 218 SPECIAL MEETING TUNE 22, 1939

Came on for consideration the adoption and passage of a zoning Ordin- ance for the City of Oxford, pursuant to Chapter 333, of the Laws of the State of Mississippi of 1938, and a "usamap".

A "use map" was then and there presented to the Mayor and Board of Alder- men for its considerationa together with proposed "Zoning Ordinance", whereupon both were taken up and considered for passage and adoption, and the Mayor and Board of Aldermen finding more time is needed to consider same. * * * * * * * * * * * * * * * * * * * * * * *

Upon motion made,• seconded and unanimously passed, it was ordered that this board do now recess until Monday, Tune 26th, 1939,at 7:30 P.M. o'clock. RECESSED MEETIMI, JUNE 26, 1939

OXFORD, MISSISSIPPI

The Mayor and Bcpid of Aldermen met pursuant to a Recess order of June 22nd, 1939, at 7:30 P.M., Monday, June 26th, when and where the following were present:

Mayor R.X. Williams, Presiding Branham Hume, Alderman at large

T.E. Avant, Alderman Ward 1 W.T. Chandler, Alderman Ward 2

B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * * * * * * *

L.C. Andrews, City Attorney B.C. Bell, Deputy City Clerk C.E. Harrison, Supt. Light and Water Plant

aAtter the meeting had been opened according to law, the following business was transacted to-wit: T.E. Avent was called away from meeting to go to Avant 1,1-,16 store. Where upon the following Ordinance was introduced by Alderman Elliott; AN ORDINANCE TO REGULATE AND RESTRICT THE LOCATION, CONSTRUCTION AND USE OF BUILDINGS AND PREMISES IN THE CITY OF OXFORD, ASS FCR SAID PURPOSES DIVIDING TEE CITY INTO DISTRICTS, AND PROVIDING A.PENAITY FOR THE nOIATION or ANY PROVISION OF SAID ORDINANCE.

ZONING ORDINANCE Authority of City

SECTION 1. WHEREAS, Chapter 333 of the Laws of the State of Mississippi of 1938 confers authority upon municipalities of over 1500 inhabitants to establish districts or zones within its corporate limits for the purpose of better regulating the use of land, and controlling the diversity of property to the ,end that. congestion upon public streets may be lessened, the public health, safety and convenience and general welfare promoted: Now therefore,

SECTION 2. Be it ordained by the Mayor and Board of Aldermen of the City of Oxford, Mississippi: Definitions

That for the purpose of this ordinance certain terms and words are hereby defined as follows: Words used in the present tense include the future; words in the singular number include the plural number, and words in the plural number include the singular :umber; the word "building" includes the word "structure", the word `shall" *I'mandatory. Any words not herein defined shall be construed as defined in the building code. Alley 1. A Public thoroughfare not over (20) feet wide. Apartment house 2. A building or portion thereof used or intended to be used as the home of three of more families or householders living independently of each other. Basement. 3. A story partly under ground, which is not occupied for living purposes by other than.the janitor or his family, shall not be included as a story for impose of height measurements. Boarding Houses. 4. A building other than a luitel, where lodging and meals, for five or more persons, are sefved for compensation. r 220 RECESSED MEETING JUNE 26, 1939

Buildings 5. A structure having a roof supported by columns or walls for the shelter, supporting of enclosure of persons, animals or chattels: And when seperated by division walls from the grou#d up, and without openings, each portion of such building shall be deemed a separate building.

Lodging House. 6. A building other than a hotel where lodging and meals for five (5) or more persons are served for compensation. Lot. 7. Land occupied or to be occupied by a building and its accessorybuildings, and including such open spaces as are required under this ordinance, and having its principal frontage upon as public ptreet or officially approved place.

Non-Conforming Use. 8. A building or premises occupied by a use that does not conform with the regulations of the use district in which it is situated.

One Family Dwelling. 9. A detached building having accomdations for and occupied by only one family.

Place. 10. An open unoccupied space reserved for purposes of access for abutting property.

Porch. 11. A roof space open on three sides, one or two stories in height.

rrivate Garage. 12. A garage with capacity for not more than four (4) steam or motor driven vehicles, for storage only, for private use and not more than one space in which shall be rented to persons not occupants of the premises. Of the vehicles allowed, not more than one shall be a commercial motor driven vehicle, A private garage may exceed a four (4) vehicle capacity, provided the area of the lot whereon such a private garage is to be located shall contain not less than (2500), twenty five hundred square feet for each vehicle stored.

Public Garage. 13. Any premises except those described as a private garage, used for housing or caring for marl than three (3) steam or motor driven vehicles, or where any such vehicles are equiped for operation, repaired, or kept for remuneration, hire or sale.

Public Stable. 14. A stable with capacity formore than four horses or mules.

Street 15. A public thuroughfare more than twenty (20) feet wide.

Structural Alterations. 16. Any change in the supporting members of a building, such as bearing walls, columns, beams or girders.

PTenement House. 17. See "Apartment House".

Two Family Dwelling. 18. A detached or semi-detached building having seperate accomoda4 tions for and occupied as a dwelling by two (2) families.

SECTION 3.

Be it further ordained that in order to regulate and restrict the location of trades and industries and the location of buildings errected or altered for specific uses, the City of Oxford is hereby divided into "USE DISTRICT" of which there shall be the following: "A" Residence District. "B" Commercial District. "C" Industrial District. The City of oxford is hereby divided into three districts, aforesaid, and the boundaries of such districts are shown upon the map now on file in the office of the City Clerk of the City of oxford, Mississippi, being designated as the "USE DISTRICT MAP", and said map and all notations, references and other things 221 RECESSED MEETING, :UNE 26, 1939

shown theron shall be. as much a part of this ordinance as if.the matter set forth by said map were all fully described herein. Ekcept as hereinafter provided, no building shall be errected or altered, nor shall any premises be used for any purpose other than is permitted in the "Use District" in which such building or premises is located.

SECTION 4 Residence District. Be it further ordained that in the "A" Residence District no building or premises shall be used and no building shall be hereafter, errected or struct- urally altered, unless otherwise provided in this ordinance, except for one or more of the following uses: 1. One-Family Dwelling 2. Two-Family Dwelling or apartment house 3. Schools 4.Libraries 5. Farming and Truck Gardening 6. Accessory buildings including oneprivate garage or private stable when located not less than 60 feet from the front lot line, or a private garage in a (fireproof) compartment C's„) as a part of the main building. C,^3 L;-4 Incidental use of Residence. Uses customarily incidental to any of the above uses when located on the same lOt and not involving the conduct of a business; including also home occupitions engaged in by the occupants of a dwelling not involving the conduct of a business on the premises, and including also the office of a physician, surgeon, dentist, musician or artist, when situated in the same dwelling used by such physician, surgeon, dentist, musician or artist as his or her private dwelling; provided no name plate exceeding one (1) square foot in area, containing the name and occupation of the occupant of the premises, nor a sign exceed eight (8) square feet in area appertaining to the lease, hire or sale of a building or premises, nor advertising sign of any other character, shall be permitted in any ("A") Residence District. SECTION 5

Commetciel District Be it further ordained that in the "B" Commercial District, all buildings and premises, except as otherwise provided in this ordinance, may be used for any use permitted in the "A" Residence District or for any use except the following: 1. Bakery (employing more than five (5) persons) 2. Blacksmith or Bores Shoeing shop 3. Bottling,Works 4. Coopme40e Works 5. Livery Stables 6. Machine Shop 7. All uses excluded from tha,"0" Industrial District b. All kind of treatment of*nufacture, or treatment ether than the manufacture, or treatment of products clearly incidental to the conduct of a retail business conducted•on the premises. 9. Public Garages: Provided however, that special permits for the location and maintenance of public garages shall be granted by the Mayor and Council when there shall be on file with said council the written consents of the owner of 75 per cent of the area of all property within two hundred (200) feet of any part of the premises whereon such 'public garage is to be established, erected, or enlarged. ?rovided further, that no public garage shall have an entrance or exit for motor vehicles within two hundred (200) feet of an entrance or exit of a public or private school•, play ground, public library, church, hospital, childrens or.old People's home or other similar public or semi-public institutions.

SECTION 6 Industrial District Be it further ordained that in the "0" Indust#ial District all buildings and premises except as otherwise provided in this ordinance may be used for any use permitted in the "B" Commercial District or for any other use except the following: 222 RECESSED MEETING, JUNE 26, 1939

1. £bbattoirs 2. Accetylene Manufacture 3. Acid Manufacture 4. Amonia, Bleaching Powder or Chlorine Manufacture 5. Arsenal 6. Asphalt Manufacture or Refining 7. Blast Furnace b. Boiler_Works 9.Brick, Ilio, or Terra Cotta Manufacture 10 dlem6nufacture 1 .\Ba Cl ing 12. ellul Manufacture 13. Coke Ovens 14. Crematory 15. 2reosote Treatment of (gAi n ufacture 16.esinfectant Manufacture 17. Distillation of bones, Coal or Wood 13. Dyestuff Manufacture 19. Emory Cloth and Sand Paper 20. Exterminator and Insect Poison Manufacture 21. Fat Rendering 22.Fertilizer Manufacture 23.Fire Works or Explosive Manufacture or Storage 24.Fish Smoking or Curing . Forage Plants 25. Cas (illuminating or heating) manattacture 27. Glue, Size of Gelatine manufacture 2t. Gun Powder Manufacture or Storage 29. incineration or reduction of Garbage, dead Animals, Offal or Refuse 30. iron, Steel, Brass or Copper Foundry 31. Oil Cloth or Linoleum Manufacture 32. Lamp Black Manufacture 33. Oil, Rubber, or - Leather Good Manufacture 34. Ore Reduction 35. Pew, Oil, Shellac, Turpentine or varnish Manu- facture. 36. Paper and Pulp Manufacture 37. Plating Works 36. Potash Works 39. Printing ink Manufacture Pyrozlin Manufacture 41. Rock Crusher 42. Rolling Mill 43. Rubber or Gutta Percha Manufacture or Treatment 44. Salt Works 45. Sour Kraut Manufacture 46. Sausage Nnufacture 47. Ship Yards 4p4 Shoe Blacking Manufacture 49. Smelters 50. Soap Manufacture 51. soda and Compound manufacture 52. Stock Yard 53. Stone Mill or Quarry 54. Storeage of baling of scrap Paper, Iron, Bottles, wirx.air Junk. 55:-Stove Polish '''amufacture 5b. Sulphuric, Nitric or hydrochloric Acid manufacture 07. Tallow, Grease or Lard Wianufacture or refining from animal fat. 58. Tanning, Curing or Storeage of Rawhide or Skins. 59. Tar Distillation or manufacture 60. Tar Roofing or Water Proofing Manufacture 61. Tobaccos manufacture or Treatment 62.Vinegar Manufacture 63.Wool Pulling or Scouring 64. Yeast Plant 65. And in General those uses which have been declared a nuisance in any court of record, or which may be obnoxious or offensive by reason of the~ emmission of ,,,,Axdor, dirt, smoke, gas or noise

RECESSIOMMEETMG, JUNE ;6, 1939

SECTION 7

'resent Use to Continue Be it further prdained that the lawful use of land exhisting at the time of adoption of this ordinance, although such use does not conform to the provisions hereof, may be continued, but if such non-conforming useWdescontin- ued, any future use of said premises shall be in conformity with the provisions of this ordinance. The Lawful use of a building exhisting at the time of the adoption of this ordinance may be continued, although such use does not conform with the provisions hereof, and such use may be extended throughout the building, prbvided no structural alterations except those required by law or ordinance, are made therein. If no structural alterations are made, a non-conforming use of the building may be changed to any use permitted in the same use district as that in which the use existing at the time of the adoption of this ordinance is permitted, according to the provisions of this ordinance. Whenever, a use district shall be hereafter changed, any then existing non-conforming use in such changed district may be continued or changed go a use permitted in the same district as that in which the exhisting use is permitted, provided all other regulations governing the L.rJ new use are complied with. Whenever, a aon-conforming use of a building has been changed to a more restricted use or to a con-forming use, such use shall not there- c\./ ter, be changed to a less restricted use. ,e1_1 SECTION 8 Application ter Permit The City Building Inspector shall pass on all applications for permits, on all matters under this zoning act and he shall pass upon all plane and specifications relating to the use, and the applied for use, of said property.

SECTION 9 Appeals Appeals day be taken from the findings of the City Building Inspector to the Mayor and Board of Aldermen, effecting any decision of said Building Inspector with reference to said zoning act. Such appeal shall be taken within five days'by filing with said inspector the notice of appeal in such form as may be specified. Said notice shall specifically state the grounds of appeal. The said Building Inspector shall Corthwith transmit all papers constituting the record, dupe m which the appeal is taken, to the Mayor and Board of Aldermen.

SECTION 10 Variations. The Mayor and Board of Aldermen may authorize, by permit, a variation of the application of the use and regulations herein established in harmony with the general purposes as follows, to-wit: (a) The Character and use of buildings and structures ddjoining or in the vicinity of the property mentioned in the application. (b)Vhe number of persons residing, studying, working in or otherwise occupying the buildings adjoining or in the vicinity of the property men,- tird in the application.sgdt O'bemrtgee :,gtrmgAugggs14460 ideimityeallhelareportlix.A (c)The location, kind and size of the OurfacIsjAn the.application t a.""waw‘a such as water mains, sewers and other utilities. (d)Traffic conditions, insofar as they or any of them relate to ha- zards from fire or disease, or in the public security, health or morals.

Right and Appeal. A person aggrieved at the finding of the Board of Mayor and Aldermen shall have the right of appeal from the findings of the said Board of Mayor and Aldermen in the manner provided for in section 61 of the Code of 1930. SECTION 11 No Building Altered Without Permit Be it further ordained that no building hereafter errected or altered shall be occupied, used or changed in use until a certificate of occupancy and compliance shall have been issued by the Building Sinspector, stating that the bUilding or proposed use of a building or premises, complies with all of the building and health laws and ordinances and with the provisions of this regulation. _Je.,L./ Certificates of occupancy and compliance shall be applied Ohm coinci- dent with the, application for a building permit and shall be issued within ten days after the errection or alteration of such building shall have been completed in conformity with the requirements of these regulations. A record of all certificates 224 RECESSED MEETING JUNE 26, 1939

shallbe kept on file in the office of the Building Inspector and 00yiewshall be furnished on request, to any person having a proprietary or tenancy interest in the building effected. No fee shallbe charged for an original certificate, but for copies of any original certificate, a fee of fifty cents each shall be charged.

No permit for excavation for any building shall be issued before application has been made for certificate of occupancy and compliance.

The use of no building already errected at the passage of this ordinance shall be changed from one class of use to another unless and until a certificate of tmeupanyy and compliance with the provisions of this ordinance shall have been obtained from the Ryilding Inspector.

SECTION 12

Application to Be Accompanied by Plat'. Be it further ordained that all applications for building permits shall be *accompanied by a plat drawn to scale, showing the actual dimensions of the lot to be built upon, the size of the building to be errected, and such other information as may be necessary to provide for the enforcement of these regulations. A careful record of these applications and plats shall be kept in the officeof the Building Inspector. No yard, court or other open space provided about any building for the purpose of complying with the provisions of these regulateons shall win be used for a court, yard oA other open space for another building. SECTION 13

Be t further ordained that in interpreting and applying the provisions of this ordi ance, they shall be held to be the minimum requirements for the promotion of the public safety, health, convenience, comfort, prosperity and general welfare. It is not intended by this ordinance to interfere with or to abrogate or annul any easements, covenants or other agreement between parties; provided, however, that where the ordinance imposes a greater rempliction upon the use of building or premises or upon height of buildings, or requires larger open spaces than are imposed or required*other ordinances, rules, regulations or permits, or by easements, covenants or agreements, the provisions of this ordinance shall a control.

SECTION 14

Penalty Be it further ordained, that any person, firm or corporation who violates, disobeys,,mmits, neglects or refuses to comply with or resists the enforcement of any of the provisions of this ordinance shall be fined not less than five (5) dollars or more than one hundred (100) dollars for each offence, or imprisoned in jail for thirty (30) days or by both such fine and imprisonment. Each day that violation is permitted to exhist shall constitute a separate offense.

SECTION 15

Saving,Clause. Be it further ordained, that shoRld any section, clause or provision of this ordinance be declared by the courts to be invalid, the same shall not effect , the validity of the ordinance as a whole or any part thereof, other than the part declared to be invalid. SECTION 16

Mayor and Board of Aldermen May Amend Be it further ordained that the Mayor and Board of Aldermen of the City of Oxford may from time to time, amend, supple-Vent or change by ordinance the boundaries of districts or regulations herein established/ A public hearing shall be held by the Mayor and Board of Aldermen before adoption of any proposed amasernt, supplement, or change, notice of which hearing shall be given by publishing7three times in some local paper of general circulation, stating the time and place of such hearing, not earlier than fifteen (15) says from the last date of such publication. If a protest against such proposed amendment, supplement, or change be presented in writing to the City Clerk within fifteen days from the last publication, duly signed and acknowledged by the owners of twenty (20) per cent or more of any frontage within 160 feet proposed to be altered or by the owners of twenty (20) per cent of the frontage immediately in the rear thereof, or by the owners of twenty (20) per cent of the frontage within 6o feet directly opposite the frontage proposed to be altered, said change shall not be made. 225 RECESSED MEETIAU JUNE 16. 1939

SECTION 17 City Clerk to Give Notice.

That the City Clerk of the City of Oxford be and he is hereby required to give notice to the property owners that the Meyor and Board of Aldermen-of. the City of Oxford will, on the 17th day of July, 1939, in the Mayor and , Board of Aldermen Chamber of the City Hall, hear any and all objections with reference to the Use District, and as to the regulations and restrictions as contained and setforth in said Zoning Act. SECTION 18 Ordinance in Conflict Repealed. Belit further ordained, that all ordinances or parts of ordinances in conflict with any of the provisions of this ordinance, are hereby repealed. Date Of BeAbgaffective

Be it further ordained that this ordinance shall be in effect from and after the 17th day of July, 1939, the Public Welfare redrinu, it. The above ordinance having been first reduced to writing was introduced by Alderman Elliott at a recess meeting of a Special Meeting, said Spec- ial Meeting having beened called, as required by law, said "Special Meeting, Thursday, June 22nd, 1939, at 7 o'clock P.11. said recess meeting being on the 26th day of June, A.D. 1939, eddthell‘or and Board of Aldermen of the City of oxford, Mississippi, held at the City Hall in said city and was read and considered by actions and voted on by "yea" and "nar,vwbe and was then considered as a whole and the following Aldermen voting "yea" on each and every section and the ordinance as a whole" "Merman Branham Hume Alderman ".T. i0handler Alderman B.O. Elliott Alderman C. 6. Haney

Having received a nuanimous vote of the Board present in favor of said ordinance it was declared duly passed and the "use map" referred to in said ordinance on file in said City Clerk's office was adopted by unanimous vote of said Board. * * * * * * * * * * * * * * * * * * * * * *

NOTICE

Notice of Public Hearing with Reference to the "Use District, " and As *o the Regulations and Restrictions as Contained and Set Forth in a Zoning Act or ordinance Adopted and Passed by the Mayor and Board of Aldermen of the City of Oxford, Mississippi.

WHEREAS, the Mayor and Board of Aldermen of the City of Oxford, Mississippi, pursuant to Chapter 333 of the Laws of Mississippi of 1938, did at a recess meeting of a Special Meeting held and called for that purpose, the recess meeting of a Spedial Meeting held and called for that purpose, the recess meeting being held in the City Hall of said City on the 26th day of June, A.D., 1939, at 7:30, P. A. pass and adopt an Ordinance entitled "An ordinance to Regulate and Restrict the Location, Construction, and Use of tUibdings and Premises in the City of Oxford, and For Said Purpose dividing the City into district, and providing a Penalty for the Violation of any of the provision of said Ordinance", and making the drimiloWdate of said ordinance from and after July 17th, 1939: AND, WHEREAS said ordinance provides that the City Clerk shall givanotici'to the 'pt4ertVOinere that the Mayor and Baird of Aidetwet—it the City of Okford will on'tha 17th'daylcif July:A.D:;-*1939, in the Mayor and Board of Aldermen Chamber of the City Bill, hear any and all objections with reference to the "Use District", and as to the regulations and restrictions contained and set forth in said Zoning Act: 226 WS= LIV, :UN 26,. 1939

AlOW, THEREFORE? notice is hereby gtven tp all,property owners, parties inAntorest'And xiltz441 ,00b9M10 1 be,held in . the. 1049r and Board ot'Alder- men Chamber in the City Ball of 'Oxford, Mississippi, at 7:30 P.m. on July 17th,

1939,a publip-hearing, in , relation to the "Use District", and restrictions contained and set forth in said Ordinance or "ZoningIet",at which time the Mayor and Board of Aldermen of said City of oxford will hear any and all objections with reference or in relation tp-,the'"UsaZiatrict.", And as to the regulations and restrictions contained and:48t t9rthA,A.said:Ordinance‘,. or Zoning Act.

Said Ordinance is on file and Reeorded in knute Book of Said City, the Clerk's office of said City of Oxford.

Witness my signature this the 28th day of June, A.D., 1939

B.O. Elliott, Clerk City of Oxford, Miss

B.Y. B.C. Bell, D.C. * * * * * * * * * * * * * * * * * * * * * * * *

Upon motion duly made, seconded and carried, it was ordered that this Board do now aecess until 7:30 P.M., June 27th, 1939'. RECESSED MISTING, JUNE 27, 1939 OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen met pursuant to a Recess order of June 6, 1939, at 7:30 P.M., when and where the following were present:

Mayor R.X. Williams, Presiding Branham Hume, Alderman At Large

T.E. Avent, Alderman Ward 1 B.O. Elliott, Alderman Ward 3 * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted to-wit:

On motion duly made by Alderman Hume and seconded by Alderman Elliott that Mr. C.R. Harrison be appointed Building Inspector for the City of Oxford. The above motion unanimously passed. * * * * * * * * * * * * * * * * * * * *

4 Aurthe r The re beingine4Dusiness to come before the Board at this time, on motion duly made, seconded and carried, it w s ordered that this Board do now adjourn sine die.

.X. illiams, or B.O. Elliott, Clerk 226

REGULAR MEETING

JULY 4th, 1939 OXFORD, MISSISSIPPI UNITED STATES OF AMERICA

STATE OF MISSISSIPPI COOUNTY OF LAFAYETTE

CITY OF OXFORD 1939 * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *

Be it Remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session in the City Hall at 7:30 P. Tuesday, June 6th, 1939, it being the time and place for holding of said vesting, when and where the following were present:

Mayor R.X. Williams, Presiding W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3 C.S. bianey, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * * * * * *

This being a legal Holiday, motion was made by Alderman Elliott and seconded by Alderman haney that this Board do now recess until 7:30 o'clock 2.M., Wednesday, July 5, 1939• Those voting "Yea" Aldermen Chandler, Elliott and Below. Those voting "nay", none RECESSED NESTING, JULY 5th,

OXFORD MISSISSIPPI

The Urn. and Board of Aldermen met pursuant to a Recess order of July 4th, 1939, at 7:30 P.M. when and where the follming were present:

Mayor R.X. Williams Branham Hume, Alderman at large T.E. Avant, Alderman Ward 1

W.T. Chandler, Alderman 2 B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * *?*

H.C.Beil, Deputy City Clerk r..\/ Sam Keel, Marshal C.E. Harrison, Sutp. Light and Water Plant .e!r L.C. Andrews, Attorney

After the meeting had been opened according to law the following business was had to-wit: Mrs. Siveley, Dr. Bremlett and others met with the Board in regard to petition for removal of barn owned by Dr. Bramlett and located on North 11th and Washi gton Ave., After some discussion on the matter, on motion of Alder- man Elliott that the City have the City Engineer survey the streets, being North 9th and llth atreets and Washington Ave., showing what parts of said streets the city hold title and that said petition be held up until survey had been completed and reported to Mayor and Board of Aldermen. The above motion passed. * # # * * * * * * * * * * * * * * •

Mr. will Lewis representing Miss Kate Skipwith and Buie Museum, presented to the kcyor and Board of Aldermen the 'VA project by the Federal Art project, for enhibiting Government series of art, being on a nation-wide scope, setting forth what the Government proposed to do and asking the city to cooperate and meet certain reluirements, such as light and heat, files, stands office furniture, typewriter, etc., also, to make available the sum of $300.00 for one year operation. No action was taken by the Saadi; # * * * * * * * * * * * * * * * * * * * * *z

Mr. W.T. Chandler, was called from the meeting at this time. * * * * * * * * * * * * * * * * * * * * * *

Mr. Hargis, representing University of Mississippi, with reference to sewer line on South 2nd Street(this being University Property) stating that the Universiyy was not financially able to help in putting in a sewerage line at this time, but would connect houses owned by them if sewerage was installed. Estimate would take some 1870 feet of 6" pipe at a cost of around $1500.00. No action was taken. * * * * * * * * * * * * * * * * * * * * *

In Burley Tones, Pat Haley and Joe Irby, representing the Coal doealers of the city entered protest against ones hauling caol from Alabama mines by truck and sellint to consumers in the city. After some discussion as to the manner on which these sales were being:handled, it was moved by Alderman Hume and seconded by Alderman Elliott that the matter be referred to City Attorney Andrews to ascertain as to what assistance the city of Oxford could give the retail dealers. The above motion was carried. * * * * * * * * * * * * * * * * * * * 230 RECESSED MEETING, JULY 5, 1939

Alderman Avant was called from the meeting at this time. * * * * * * * * * * * * ** * * ** * * *N* * *

Louis Stephens, on behalf of Miss Robbie Eades, asked the Mayor and Board to issue an order to deed that part of North 7th street facing on University Avenue, being east and west 30' the width of said street, and originally being 458' north and south, same lying between Lots 50 and 57. No action was taken at this time. * * * * * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that the city advertise for bids on gasoline, motor oils and greases for use by the City Light and Water truck and the City Street truck for the months of August, September and October. The above motion was carried.

•

On motion duly made by Alderman Hume and seconded by Alderman Elliott that the city make reply to the letter received from Green, Green & Jackson, attornies, representing Arkansas Fuel Oil Company, of date of June 27, 1939. Vast was in reply to letter written to the Arkansas Fyel Oil Company, under date of June 23, 1939, dy Deputy Clerk by order of Mayor and Board of Aldermen of the city of Oxford, attaching to said letter copy of the Zoning Ordinance, also, copy of page of Oxford Eagle dated, June 29th, 1939, marking article written by Mr. Duff. That copy of letter with other enclosures by mailed to the Arkansas Fuel Oil Company at Shreveport, Louisiand, and to Leo Smith, their representative at Oxford, Mississippi. Said letter be compiled by attorney Andrews and written by the Deputy Clerk. The above motion passed. * * * * * * * ** * * * * * * * * *

Upon motion duly made, seconded and passed, it was ordered that this Board do now recess until 7:30 P.M., July 7th, 1939. RECESSED MUTING, JULY 7th, 1939

OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen met pursuant to a Recess Order of July 5th, 1939, at 7:30 P.M. when and where the following were present:

Mayor R.A. Williams, Presiding

Branham Hume, Alderman At Large

W.T. Chandler, Alderman Ward 2

B.O. Elliott, Alderman Ward 3

C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * ** * * *

H.C. Bell, Deputy Clerk L.C. Andrews, City Attorney Sam Keel, Marshall C.S. Harrison, Supt. Light & Water Plant C\i r After the meeting had been opened according to law, the following business was transacted to-wit:

Upon motion duly made, seconded and passed, it was ordered that the follow-- ing accounts - be allowed and warrants be issued accordingly:

CORPORATION FUND

494. R.X. Williams, Mayor, June salary $80 .00 495. Branham Hume, Alderman 2 " 7$40.00

4 • T.K. Avert, " " $10.00 497. W.T. Chandler, " $10.00 49d. B.O. Elliott, " $10.00 499. C.S. Haney, « * $10.00 500. H.C. BelI, Deputy Clerk, $50.00 501. Lillian Jones, Secretary, " $40.00 502. Sam Kael,'Marshal, * $125.00 503. Garland Simmons, Night watchman, June salary $125.00 504. L.C. Andrews, Attorney, 'rune salary $40.00 505.R.N. Whitfield, Band Master, June salary $40.00 506. Mrs. O.K. Holcomb, Matron, June salary $20.00 507. 0.11. Douglass, Upkeep of cemetery for June $50.00 508. Tennessee Valley Electric Company, Electric supplies---#27.87 509. Otaybar, Upkeep of fire truck 510. Pat Haley, Gas for truck $15.24 511. Porter Hardware Company, Supplies $2.81 512. F.W. Belk's Garage, Repair for truck $10.00 513. Hughes Hardware, Supplies- $5.46 514. Oxford Eagle, Adv. for fire hose $5.30 515. Wallace Hailum, surveying $1.00 516. Hederman Brothers, Office supplies $3.57 517. Tom L. Ketchings, Office supplies - $1.14 518. Geo. D. Barnard Company, Office supplies 519. Detex Watchclock Corp., Office supplies #24b 520. J.L. Harmon, Cabinet for blue print 017.30 521. Walter D. Pettis, Engineer for June $43.00 522. J.A. Martin, Jr., Office supplies- 03.98 523. R.F. Campbell, Lumber .70 524. Oxburn-Abston & Company, Rep. to truck 013.98 *4525. 0.E. Harrison, Chief and 14 firemen 122.50 0603.41 232 R ECESSED MEETING? JULY 7th, 1939

OXFORD, MISSISSIPPI

526. O.D. Smith, Pro rata share of June salary $24.00 527.Willi Ison, Janitor for June $0.00 526. R.H. Gillespie, Janitorial Equipment 4144.4 529.J.A. Martin, Jr., Supplies .60 530.Patton-Courtney, Supplies--- 1.58 531.S. Friedman, Supplies $1.25 532•California Dept. of Education, Bulletin .25 533.Houghton Mifflin Col, Mental Tests $2.07 534.World Book Company, Books $1.60 535.Alex-Loeb, Balls $3.60 53 ail= Rushing, 20 hours work $5.00 537. A.C. Mc'lurg Company, Supplies -94 538$. Tan L. Ketchings, Supplies *13.06 539.Robert Torrey, Insurance $119125 540. Oxford Insurance Company, Insurance $119.25 541.Geo. D. Barnard Company, Supplies- $24.17 542.Louise Blasengame & Robbie Eades, Balary for summer school- -- -420040 570.56

STREET FUND

543, S.E. Spears, Foreman for dune-- $100.00 Hughes Hardware, Cement--- 544. :3:4#$3.83#!! 545.W.T. Jones, Keeping prisoners for June 15 546.Oxford Eagle, Adv. for Gas 547.Bob Davis, 4 days work° 5488. Dr. J.R. Simms, Service On Delmas Moss 549. I.T. Stogner, 10 days work 550.C.G. Huggins, Rep. to truck 551.Pittsburgh Plate glass Company, St. Paint 55E.McKesson & Robbins, Dinenfectant 551. Davis-Mize Company, Supplies

554.ToPpical Paint Company, Curb paint --- 555.Blue Star Service, 1 ice book 556.Standard Service Station, Rep. to truck 111?...3A 557.444 Service Station„ Oil t..50 558.Porter Hardware Co., Supplies 559.W.P. Haley, Gas $2.0 2 560.Hughes Hardware Co., Fork & lock $2.81 561.Hall Blacksmith, Repl to lawn mower, 562.Patton-Courtney Hardware, Supplies $9.14 563.J.B. Carpenter & Son, Wire for flusher $52.31 s 564. " 1 Gas and oil $31.51 $374.32 RECESSED MEETING, JULY 7th, 1939 LIGHT AND WATER FUND 565.C.E. Harrisong Supt., June salary- $245.00 566. G.W. Johnson, Engineer, June salary $135.00 567, A.L. Mullins, Engineer, June salary $125.00 568.Louis Campbell, June salary $105.00 569.R.H. Winter, Lineman, June salary $125.00 570.B.C. Bell, Deputy Clerk, June salary $50.00 571.Lillian Jones, Secretary, June salary $40.00 572.B.S. Guyton, Rent for June $35.00 574.T.A. Dunn, Rent for June 575.Mrs. Lillie Yates, Rant for June- $10.00 576. Graybar Electric Company, Supplies $127.97 577.Thnnessee Valley Electric Co., Supplies 6.58 $4 576. Ozburn-Abston & Co., Elec. supplies

579. Arkansas Fuel Oil Company, Fuel oil -- $ 9 560. Westinghouse, Elec. supplies $!!!1: 581. Oxford Eagle, Adv. for Eagle 415:21:70 582. Pure Oil Garage, Gas and oil $2.10 583. hushes Hardware Co., Hard.and supplies $9.34 584. Blue Star Service, Ice book p .10 585. Porter Hardware Co., Hardware & supplies $9 .66 586. Goulds Pumps, Repairs and welding 587. Wm. Y. Nuggett &CO., Repairs and welding $6.32 586. Hall Blacksmith, Sundry •45 589. Blek's Garage, Upkeep of truck $39.50 590. W.P. Haley, Gas and oil 591. Texas Company, Lub. Oil ... $26.88 592.Riechman-Crosby Co., Elec. supigies- 593. General Elec., Electris supplies 4 $42:90.165 594. Pittsburgh Equitable Meter Co., Meters and repairs 595. W.S. Dickety Clay Manf. Co., Clay pipe & culvert :i487.i 59b. Duncan Elec. Manf. Co., Meters and repairs :38.J.; 597. N.O. Nelson Company, Water supplies 596. J.B. Carpenter & son, Gas and oil Total $2345.4

* * * * * * * * * * * * * * * * *

Pursuant to "Advertisement for Bids" for fire hose, the following bids tere opened and read:

Patton-Courtney Hardware Co., Oxford American-LaFrance-Foamite Corp., Flmira, The B.F. Goodrich Co., St. Louis, Mo. Eureka Fire Hose Division, Cincinnati, Ohio W.S. Darley & Co., Chicago, Illinois The Reichman-Crosby Co., Memphis, Tenn. Hamilton Rubber Mfg. Co., Teatton, E.J. Peter Ptrsch & Sons Co., Memphis, Tenn Lewis Supply Co., Memphis, Tenn.

After all bids had been tabulated, it was found that the Eureka Fire Hose Division, U.S. Rubber Company, Cincinnati, Ohio, had the lowest and best bid, and on motion of Aldermen'Hume and seconded by Alderman Elliott that the bid of the Eureka Fired Hose Division, U.S. Rubber Co., for the 500' of Underwriters hose be accepted. * * * * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Haney that the Mayor, R.X. Williams, and Alderman B.4. Elliott, Clerk be authorized to enter into and execute contract with the Said Eureka Fire Hose Division of U.S. Rubber Company fof 500' of 21" Underwriters hose for the City of Oxford, Miss. The above motion passed. * * * * * * * * * * * * * * * * *

On motion of Alde§man Hume and seconded by Alderman Bailey that the Deputy Clerk arrange with the First National Bank and the Bank of oxford to pay the interest at the rate of 4% on all outstanding notes, and arrange to re-new same for three months at the rate of 4% per annum. The above motion passed. * * * * ** * * * * * * * * * * * * * * RECESSED MEETING, xuLy 7th, 1939

On motion of Aldermen hume and seconded by Alderman Elliott that the account of Porte' Hardware Company in the School accounts for the sum of 4.59 be held up on account of same not having been approved by at least . three of the school Trustees. The above motion passed. * * * * * * * * * * * * * * * * * * *

On motion duly wade by Alderman Elliott and seconded by Alderman haney that Mr. C.E. Harrison, Supt. Light and Water Department be authorized to buy Feel Oil for the use of the power plant at the lowest price and best quality, excepting product of the Arkansas Fuel Oil Company on account of report by the American Locomotive Company that this fuel oil is corro- sive. The above motion passed. * * * * * * * * * * * * * * *

The accounts of W.L. Caldwell, One for writing up description of each piece of property shown on official map, as well as a map showing the names of all property owners, amount $75.00, and one for making "USE MAP", in:connection with the Zoning Ordinance, amount of $21.90, on motion duly made and seconded that these accounts be allowed and paid out of Corporation Fund. ** * * * * * * * * * * * * * * * * * * * * * * * * * *

WORKS PROGRESS ADMINISTRATION

GREENVILLF, MISSISSIPPI

The Honorable R.A.. Williams, Mayor of Lixford Oxford ) Miss.

Dear Mayor Williams:

Ftelowing the suggestion of Mr. Defenbacher, I am outlining the terms of our verbal agreement of June 14, 1939, in Oxford. At that time, D.S. Defenbacher, Assistant to the Director, Federal Art Project, Miss Ethel Payne, State Director, Professional dnd Aserice Division WPA, and I discussed with you the establishing of an extension gallery of the Delta Art Center to be housed in the new Mary Buie Museum, which I understand will be completed sometime in Jyly.

We agreed that the Federal Art Project will provide a econtinuous series'otlexhibitiogs of art, nation-wide in scope. The selection of these exhibitions will remain, for the post part, with the Ekhibition Section in Washington since the exhibitions are circuited through regular channels in the United States. The selection will be found to represent a cross- section of work currently produced in this country including that of many of our better known artists and sculptors. Process exhibitions of educational value, as well as works loaned to the Federal Art Project from valuable collections are included from time to time in this series.

Your Committee may find it practical at a later date to supplement these exhibitions of national interest with shows of local art interest and resources. Such exhibitions may readily include Industrial, Commerttal, Home Arts, Photography, etc., Classes in art may be established in annex quarters at such time as competent art teachers are available on the l'roject.

. The Federal Art Project shall provide and pay :salaries of the following, selected from the lists of per ons eligivle for the Works Program with the joint approval of the Federal Art Project and by your committee.

One gallary Attendant - able to keep gallery records, make out reports, time sheets, etc.

One Gallery Attendant - Artist, able to give gallery talks, supervise arrangement of exhibitions, and possibly teach classes.

General Galleryman - to do janitorial work, light earpentery, pack and unpack exhibitions, etc. 235

RECESSED =TIM, JULY 7th, 1939

To insure the proper presentation of exhibitions, and to provide proper faciklties for an art gallery program, the city of Oxford should agree to the following:

1. Three hundred dollars should be available for one year of operation. This fund is estimated to cover the cost of transportation of exhibitions and incidental gallery maintenance costs. Exhibitions will generally travel to and from the Delta Art Center in Greenville and occasionally to or from neighboring states. General maintenance expenses include such items as picture wire and hangers, office materials, printed or mimeographed handouts, picture glass: replacements, etC.

2. The complete space of two rooms of the Mary Buie Museum with light and heat should be provided for echibition space. A typewriter and office furniture should be available to accomodate gallery corres- pondents and records. Scylpture Stands, should be constructed for use in the gallery, and a glass case or two is desirable for small works included in some exhibits.

In general, it is desirable that the gallry be open to the public as much as is practically possible. The gallery art program sho7ld be made attractive (.7N/ to people of all classes and professions. It is suggested that the unit be called 'The Oxford Federal Art Gallery." As a proper identification of program .e_11 and sponsorship.

As an extension unit, the program in Oxford will not be sufficiently large as to merit a director. However, buidance and supervision by the State Direetor of the Federal Art Project, and the supervising stall of the Delta Art Center will be extended to the Oxford Federal Art Gallery, in every possible instance. Any chane in activities or policies should be decided jointly by the Federal Art Project and the City of )xford ad co-Sponsoring Organization.

The Federal Art project shal continue its aid to oxford until such time as Congress or the President of the United States discontinues the Project, or until such time as it is determined that the work is not being carried out or is not successful.

lery truly yours

Frederick I. Whiteman Acting State Director Federal Art Project

In the matter of the Federal Art Project in connection with the Buie Museum, deferred from meeting of July 5th. On motion duly made by Alderman Elliott and secondee by Alderman Chandler that the city accept the agreement with the Works Progress Administration for Mississippi, as follows:

Those voting "yea" Alderman Elliott and Chandler Thos voting "nay": Aldermen Hume and Haney The vote being tied,(Alderman Avent not being present), the Mayor R.X. Williams, cast his vote "yea". * * * * * * * * * * * * * * * * *

On motion made by Alderman Hums and seconded by Alderman Chandler that a duplicate warrant in favor of the College Inn be issud in the amount of $18.36 on bond furnished by Tom Mistillis and Spiro Vallatos. * * * * * * * * * * * * * * * *

Mr. Chandler went home about this time, being about 11:300P.M. * * * * * * * * * * * * * * * *

On motion duly made by Alderman Elliott and seconded by Alderman Hume that Mr. C.E. Harrison, Building Inspector, have supply of necessary forms required under the "Zoning Ordinance" printed, for use by him as Btilding •■• Inspector. The hbove motion passed. * * * * * * * * * *** * * * * *

On motion duly made, seconded and passed, it was ordered that this Board do now recess until Mandan July 17th, 1939, at 7:30 P.M. . 231

SPECIAL MEETING, JULY 11th, 1939

NOTICE OF SPECIAL MEETING

To the Ambers of the Mayor and Board of Aldermen of *he City of Oxford, Mississippi.

Notice is hereby given that a Special Meeting of the Mayor and Board of Aldermen of the City of Odford, Mississippi, will be held in the Mayor's office in the City Hall of Oxford, Mississppi, at 2 o'clock P.M. on Tuesday i July 11th, 1939, for the purpose of considering adopting and passing an rdinace regulating and Restricting the lowering of the grades of side-walks, end removing and replacing the curbs of the streets, in and of the City of oxford, Mississippi, and in any way interferring with the establishing grades of said side-walks and curbs, and providing that before any such glade shall be-lowered, or the side-walk interferrid with, or the curb removed an application shall be made to the Mayor and Board of LrZ ldermen of said city for a permit accompanined by plans and specifications, and no such permit shall be granted unlesssaid Mayor and Board of Aldermen deem wise, and providing appropriate penalties for the violation thereof, and doing any and all other things to legally pass and adopt such ordinance.

And considering the employment of counsel to take whatever legal action necessary against Arkansas Fuel & Oil Company of Shreveport, La., to restrain it building a filling station on South Lamar Blvd. in said City, and this action to be for and on behalf of the Municipality of ' Oxford, Mississippi, and restraining. said Company from interferring with the sidewalsWand the curbs of the street of( lowering the grades thereof, or in any way tearing them up, and to employ such counsel for said purpose, if they deem it wise.

Dated this the 11th day of July, 1939.

W.T. Chandler B.O. Elliott Branham Hume "ambers of the Board of Aldermen of Oxford, mississippi

CONSENT TO MEETING

We, the Undersigned,being all the members of the Board of Aldermen of wxforti, Mississippi, hereby accept service of the foregoing notice, waiving any and all irregularities in such servicP.and such notice, and consent and agree that said Mayor and Board of Aldermen shall meet at the time and place therein named, and for the purpose therin stated.

C.S. Haney

Mr. T.E. Avant, mlderman of Ward One and R.X. Williams, Mayor of the City of Oxfor4t Mississippi, being out of town, the notice could not be served on them. S.M. Keel, 'arshall * * * * * * * * * * * * * *-* * * * *

The Mayor and Board of Aldermen met pursuant to the above call at 2 o'clock P.M. on Ply 11th, 1939, when and where were present the following:

W.T. Chandler, Mayor Pro Tem

Branham Alma, Alderman at large

B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Ward Four 238 BEECIAL MEETING, JULY 11th, 1939

M.O. Bell, Deputy City Clerk S.M. Keel, Marshall L.C. Andrews, Attorney

After the meeting had been opened according to law, the following business was transacted to-wit:

Upon motion duly made and seconded, the following )4.rdinaXmeimes placed upon its adoption:

AN ORDINANCE REGULATING THE LOWERING OR RAISING TEN GRADES OF SIDEWALKS, THE REMOVAL OR LOWERINU OF THE CURB OF THE STREETS, CR DISTURBING THE SURFACE OF THE SIDE

WALKS OF THE CITY OF OXFORD MISSISSIPPI , PROVIDING FOR THE GRANTING OF PERMITS,t AND PROVIDING PENALITIES FOR THE VIOLATION OF SAID ORDINANCE.

SECTION 1. Be it ordained by the Mayor and Board of Aldermen of the City of Oxford, Mississippi, that

It shall be unlawful for any person, firm or Corporation to disturb the surface, or lower or raise the grade of any side-walk, or lower or remove the curb of any street within the corporate limits of the Municipality of oxford, Miss- issippi, until a permit is had from the mayor and Board of Aldermen of said City of Oxford.

SECTION 2. Any person, firm or corporation desiring the permit mentioned in Section 1 of this ordinance, shall make application therefor to the Mayor and Board of Aldermen of said City of oxford accompanied by plans and specifications of the work proposed to be done, which application shall be filed with the clerk of said Mayor and Board of Aldermen, whereupon the Mayor and Board of Aldermen within a reasonable time after the filing of said application shall meet and consider said application, and may refuse or grant said permit.

SECTION 3. Any person firm or Corporation convicted of violating any provision of this ordinance shall be fined not less than $100.00, or imprisoned in the county jail for not more than 30 days, or by both said fine and imprisonment. Each day that a violation is permitted to exist shall constitute a separate offence.

SECTION 4. be it further ordained, that should any Section, clause, or provision of this ordinance be declared by any courts to be invalied, the same shall not effect the validity of the Ordinance as a whole, or any part hereof, or the part declared to be invalid.

SECTION 5. For good and sufficient reasons, and the public welfare and safety demanding it, this ordinance be in force and effect from and after its passage.

The above ordinance having been first reduced to writing was introduced by Alderman Elliott at a Special Meeting, said Special meeting beeing called, as required by law, held at the City Hell in said city and was read and considered by Sections and voted on by "yea" and "nay" vote and was then considered as a whole and the following Aldermen voting Noigron each and every section and the ordinance as a whole: Branham Hume, Alderman B.O. Elliott, Alderman C.S. Haney, Alderman

Having received a unanimous vote of the Board present in favor of said Ordinance it was declared duly passed. - t

It is ordered that the above Ordinance be published in a newspaper, published in the municipality in the city of Oxford, Miss., as required by law. * * * * * * * * * * * * * * * There being not further businedSto come before the Board at this time, bn motion duly made, seconded and passed, it was ordered that this Board do now adjourn sine die

yor ro Tem Clerk ✓✓ SPECIAL MEETING, JULY 17th 1939.

NOTICE OF SPECIAL MEETING. '

To the members of the Board of Mayor and Aldermen of the City of Oxford, Mississippi.

Notice is hereby given that a Special Meeting of the Mayor and Board of Aldermen of the City of Oxford, mississippi, will be held in the Mayor and Board of Aldermen Chamber of the City Hall of Oxford, Mississippi, at 7:30 P.M. on July 17th 1939 for the purpose of holding a Public hearing in relation to tile USE DISTRICT, regulation and restrictions contained and set forth in an Ordinance entitled "An Ordinance to regulate and restrict the location, construction, and use of buildings and premises in the City of Oxford, Mississippi, and for said purpose dividing the City into Districts, and providing a penalty for the violation of any of the provisions of said Ordinance;"siid Ordinance having been passed by said Mayor and Board of Aldermen on the 26th day of June A.D. 1939, making the effective date July 17th. 1939, and hearing any and all objections with reference to the use district, and as to the regulations and restrictions contained and'setforth in said Ordinance, and taking such action on anysuch objections as they may deem proper, sustaining or overruling same; and introducilg an ordinance and passing and adopting same putting into effect said ordinance as passed by said Mayor and Board of Aldermen on June 26th 1939, including what is nesessary to make such ordinance valid and binding, and do any and all other things pertaining to the matters aforesaid.

Dated this the 17th. day of July, 1939.

(Signed) R. Williams. Mayor.

CONSENT TO MEETING.

We the undersigned, being all the members of the Board of Aldermen of the City of Oxford, Mississippi, hereby accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of May and Aldermen shall meet at the time and place therein named, and for the purpose therein stated. -

B. O. Elliott. Alderman Branham Hula. Alderman.

C.S.Haney. Alderman W.T.Chanlder. Alderman. T.E.Avent. Alderman.

Pursuant to the above notice and call for a special meeting of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, for the purpose therein stated, the Mayor and Board of Aldermen of the City of Oxford, Miss- issippi, met at 7:30,P.M. in the Mayor and Berard of Aldermen Chamber in the City Hall of Oxford, Mississippi, on July 17th. 1939. Present were the following: R.X.Williams, Mayor, Presiding, Branham Hume, Alderman at Large, T. E. Avent, Alderman, Ward No. one, W. T. Chandler, Alderman Ward No. two, B. O. Elliott, Alderman Ward Three, and C. S. Haney, Alderman, Ward Four. After the meeting was called to order, the following proceedings were had:A The Board finds that notice Was required by the Ordinance entitled "An Ordinance to regulate and restrict the location,construction, and use of buildings and premises in the City of Oxford, and for said purpose dividing the City into Districts, and providing a penaltyfor the violation of any of the Provisions of said Ordinance" passed and adoptedby said Mayor and Board of Aldermen on June 26th. A.D. 1939, was given by the Clerk of said Mayor and Board of Aldermen to all property owners, parties in interest and citizens of a public hearing in the Mayor and Board of Aldermen chamber in the City Hall of Oxford, Mississippi* at 7:30, P.M. on July 17th. 1939, in relation to the Use District, regulations and restrictions contained and set forth in said Ordinance, at which time the Mayor and Board of Aldermen of said City would hear any and all objections with reference or in relation to the Use District, and as to the regulations and restrictions contained and setrbrth in said Ordinance; that said Notice was published in the Oxford Eagle, a weekly newspaper, published in Oxford, Lafayette County, Mississippi, appearing in the following issues therof; June 29th. 1939; July 6th, 1939; and July 13th, 1939, and that said notice was given in the manner and for the time required by law, and same is now on file with the clerk of this Board with proof of publication thereof as required by law.

The Board finds that there are no objections or protest oh file to the "Use District", or as to the regulations and resctrictions contained and setforth said Ordinance, or to the said Ordinance, but find that the Arkansas Fuel "Oil Companywas present by its attorney, Forest B. Jackson, Esq., of Jackson, Mississippi, who stated that if the Map adopted as a part of said Ordinance, and made a part thereof was to be changed. he did want to file a protest.

It appeared to the Board that the, Use Map or Map made a part of said Ordinance had since the passage of said Ordinance been altered in that when said Ordinance was adopted and passed by said MayOand Board of Aldermen it did not show a filling station owned by the Arkansas Fuel Oil Company in the residential district on South Larmar Blvd. , but in its altered form now shows a filling station, and such alteration was made without the knowledge, consent or authority of said Mayor and Board of Aldermen; that the attorney for said Arkansas Fuel Oil Company was present when said alteration was being discussed.

It being now 11 O'Clock, P. M. a motion was made by Alderman T. E. Avent, and seconded by Alderman, W. T. Candler, that this meeting recess until 7:30, P. M. on July 18y#. 1939, carrying forward to such recess meeting all the matters and things enumerated in the before mentioned call for this special meeting, which motion was unamiously carried. Recess Meeting, July 17, 1939.

The Mayor and Bobrd of Aldermen met pursuant to a Recess Order of July 7, 1939, at 11 P. M. when and where the following were present:

Mayor, R. X. Williams, Presiding. Branham Hume, Alderman at Large T. E. Avant, Alderman of Ward one W.T. Chandler, Alderman of Ward two. B. O. Elliott, Alderman' of Ward three C. S. Haney, Alderman of Ward four.

20143***,0014*****4444***** **********************4444*********

H.C.Bell,beputy Clerk. L.C.Andrews, City Attorney.

After the meeting had been opened according to law, the following business was transacted to-wit:

It now being after 11 P. M. o# motion duly made by Alderman Avent and seconded by Alderman Chandler that the the Board do now recess until 7:30 P.M. July 18th. 1939. Unamiously Passed. 242

RECESSED SPECIAL MEETING, JULY 18th, 1939

OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen met pursuant to a Recess Order entered on July 17th, 1939, at 7:30 P.M. on July 18th, 1939, same being recess of Special Call meeting when and where the folloWing were present:

Mayor R.X. Williams, Presiding

Branham Hume, Alderman at large

T.E. Avent, Alderman, Ward One

W.T. Chandler, Alderman Ward Two

B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Ward Four * * * * * * * * * ;lc * * * * * * * * * * *

B.C. Bell, Deputy Clerk L.C. Andrews, City Attorney

After the meeting had been opened according to law, the following business was transacted, to-wit:

It was moved by Aldermen Hume and seconded by Alderman Elliott that the following Order be adopted:

This Mayor and Board having met on June 26th, 1939, and having adopted an ordinance entitled "AN ORDINANCE TO REGULATE AND RESTRICT THE LOCATION, CONSTRUCTION, AND USE OF BUILDINGS AND PREMISES IN THE CITY OF OXFORD AND FOR SAID PURPOSE DIVID- ING TEE CITY INTO DISTRICTS, AND PROVIDI! A PENALTY FOE THE VIOLATION OF ANY

OF THE PROVISIONS OF SAID ORDINANCE", heretnafter referred to as "THE ZONING ORDINANCO -, and said Mayor and Board in connection with said ordinance and as required by law having adopted and ordered to be placed on file a Use Map designating with particy- larity, the uses to which the various districts might hereafter be put, with present existing exceptions; and said Use -Map hafing been placed on file in the office of the 9lerk at the City Hall; and neither at the time of its adoption nor of its filing did it show a filling station situated on Lot 3, on South Lamar Street, in said City of Oxford, in Section 28, Township 8, Range 3; being reputedly the property of the Arkansas Fuel Oil Company; nor shoOld it have shown such a filling station on said lot inasmuch as there was none; and it appearing to this Mayor and Board of Aldermen at its meeting on July 17th, 1939, that at some time during the interim and while said map was on file for inspection by the interested public, that said map was altered by super-imposed coloring to show a filling station on said described lot;

Now, Therefore, be and it is hereby ordered that said alteration or error be and it is hereby corrected, that is to say that said map be restored to its original status by noting on the margin plainly that no part of Lot Three (3) as described above is excepted from residential use as defined in the Zoning Ordinance.

Said Order adopted by the following vote: Thosevoting "Yea" Branham Hume T.E. Avent W.T. Chandler B.O. Elliott C.S. Haney Those voting "Nay" None. , * * * * * * * * * * * * * * * * * * RECESSED SPECIAL MEETING, JULY 18th, 1939

OXFORD, MISSISSIPPI

11/1r. Forest B. Jackson, Attorney for the Arkansas Fuel Oil Company, then presented the following protest for said company: "The Arkansas Fuel Oil Company wishes to register its protest to the adoptiOn of the Ordinance on final passage in view of the attempted Amendment of the map that was filed and adopted by the Ordinance, known as the Zoning Ordinance, and serve notice that it will consider said - Ordinance invalid, void and of no effect, having been adopted contrary to the provisions of Chapter #333, Law of Mississippi - 1938, and for the further reaion that said attempted ordinance is violative of Section 14, Mississippi Constitution of 1890, and of Amendment 14 of the Constitution of the United States, in this that the same with amendments thereto is attempted to be adopted without notice and due process of law and denied to this tax payer, a Corporation Organized under the laws of West Virginia, authorized to do business in the State of Mississippi, iihd riebb*tanbetbeardoand denies the equal protecrion of the laws guaranteed by said Constitutional Provisions and is a taking of this tax payers property without just compensation therefore first made for public use contrary to the Constitution of the State of Mississippi, and of the Constitution of the United States of America and for the further reason that said Ordinance and the map made a part thereof and the attempted amendment thereof are on their faces void and of no effectlf

On motion duly made by Alderman Hume and seconded by Alderman Haney that the objections and protests of the Arkansas Fuel al Company be adjudged insufficient and same are hereby over ruled.

Those voting "Yea" Alderman Hume Alderman Avent Aldermen Chandler Alderman Elliott Alderman Haney

Those voting "Nay" None * * * * * * * * * * * * * * * * *

An ordinance putting into effect the Ordinance entitled;

AFCEDINANCEEMIEGULASIVANIFRESTRICTARKLOCATIOL -:;CON•- SENUCTION, AND USE OF BUILDINGS AND PREMISES IN THE CITY OF OXFORD/ AND FOR SAID PURPOSE DIVIDING THE CITY INTO DISTRICTS, AND PROVIDING A PENALTY FOR THE VIOLATION OF ANY PROVISIONS OF SAID ORDINANCE AS PASSED JUNE 26th, 1939.

SECTION"1. WHEREAS the Milyor and Board of Aldermen of City of Oxford, Mississippi, on June 26th, 1939, passed an Ordinance entitled "An Ord41154e' to Regulate and Restrict the Location, Construction, And Use of buildings and Premises in the City of Oxford, and for said Paapose dividing the City Into Districts, and Providing a Penalty for the Violation of any Provisions of said Ordinance", as provided by Chapter 333 of the Laws of Mississippi of the year 1938, and

WHEREAS the Mayor and Board of Aldermen have complied with all the requirements of la* with reference to giving notice and a right of hearing or protest, by the property owners, citizens and parties interested, which hearing was set for 7:30 P.M., in the chamber of the Mayor and Board of Aldermen in the City Hall of Oxford, Mississippi, on July 17th, 1939, and

WHEREAS/ a special meeting of said Mayor and Board of Aldermen Aas called for 7:30 on July 17th, 1939, to hear any and all objections or protest and, Whereas no objections or protests were filed or made, and, WHEREAS, at a recess meeting of said Mayor and Board ofAldermen held in the Chamber of the Mayor and Board of Aldermen of the City Hall of Ox- ford, Mississippi, at 7:30 PAM: on July 18th, 1939, same being a recess meeting of said special meeting, the Arkansas Fuel Oil Company objected and protested to and against said Ordinance:

THEREFORE, be it ordained by the Mayor and Board of Aldermen of the City of Oxford, Mississippi;

Section 2. That ntlections-and protests filed and made to the said Ordinance, or any part of thesSme, or to the Use Map, by the Arkansas Fuel Oil Company be and the same are hereby adjudged insufficient, and the same RECESSED SPECIAL MEETING JULY 18th, 1939

overruled. The said Ordinance as passed June 26th, 1939, be and the same is hereb(made effective as of this date. That for public necessity this ordinance is effective as of this date.

The above ordinance having been List reduced to writing was introduced by Alderman Hume at the Recessed meeting of a Special Meeting of the Mayor and Board of Aldermen of the City of Oxford, the same being at 7:30 P.M., in the Mayor and Board of Aldermen Chamber in the City Hall 9f Oxford, Mississippi, on 18t#, 1939, and was read and considered by sections and voted on by "yea" and "nay" vote and was then onnsidered as a whole and the following aldermen voting "yea" on each and every section and the ordinance as a whole; Alderman Branham Hume Alderman T.E. Avent Alderman WIT. Chandler Alderman B.O. Elliott Alderman C.S. Haney

Those voting "Nay"; None Having received a unanimous vote of the Board in favor of said Ordinance it was declared duly adopted. * * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Haney that the Arkansas Fuel Oil Company objector and protestor to the action of the Mayor and Board of Aldermen in the adoption of the Ordinances and Resolutions be granted ten days time in which to prepare and submit for approval to the Mayor and City Attorney a Bill of Exceptions for the purposes of Appeal to be approved under the provisions of Section 61, Mississippi Code of 1930, as at this meeting of this Board.

These voting "Yea" Aldetmen Hume Alderman Anent Alderman Chanlder Alderman Elliott Alderman Haney Those voting "Nay" None * * * * * * * * * * * * * * * * *

It is ordered that the Ordinance passed by this Board on July 18th, 1939, putting Into effect the Ordinance adopted by this Board on June 26th, 1939, together with the one passed on Tune 26th, 1939, be published as required by law. Passed. * * * * * * * * * * * * * * * * * *

Upon motion duly made, seconded and passed, it was ordered that thit Board do now recess until Wednesday, July 19th, 1939, at 4 o'clock P.M. 24 v r REGULAR REOESSIVMEETING, JULY 18th, 1939

The Mayor and Board of Aldermen met pursuant to a Recess Order of July 17th, 1939, at 7:30 P.M. when and where the following were present:

Mayor R.X. Williams, Presiding

Branham Hume, Alderman at large

W.T. Chandler, Alderman Ward Two

B.O. Elliott, Alderman Ward Three

C.S. Haney, Alderman Ward Four * * * * * * * * * * * * * * * * * * * *

E.C. Bell, Deputy Clerk L.C. Andrews, Attorney

After the meeting had been opened according to law, the following business xr was transacted, to-wit: Air. Harrison brought to the Boards attention the matter of water and -# sewerage lines necessary to cross lot of Neola Banks to reach adjoining property; asking the Hoards authority as to whether to allow her both water and sewerage connections for easement across her property. After some discussion it was left to the discretion of Mr. Harrison whether to allow only one or both connections. * * * * * * * * * * * * * * * * * * *

Mr. Harrison also brought to the Boards attention that there were no water 'dines on Tyler Avenue between 9th Street and 5th Street, for connection with residence being built on Tyler Ave., by Mr. Pierce. After some discussion on this matter, it was thought best to extend a water line from Van Buren Avenue sufficient to supply said residence, along with two or more others that might be builttin near future, at the lowest cost possible, pending the outcome of program of increase water mains, etc. along lines recommended by the Rating Bureau in order to secure reduction in insurance rates. * * * * * * * * * * * * * * * * * * * * *

Mr. Will Lewis had the matter up *ith Mr. Harrison the advisability of filling the supply tank for oil burner heat at the Buie Museum with oil at this time, in order to avoid the condensation and water forming in tank when empty.

On motion duly made by Alderman Hie and seconded b Alderman Elliott, that Harrison look after and take care of this situation. Passed. * * * * * * * * * * * * * * * *

Mr. Harrison brought to the Board's attention the matter of the class of buildings that are contemplated being added to the Worley Marble Works on North Lamar Blvd. This matter was tabled. * * * * * * * * * * * * ,* * * * *

In the matter of the petition presented to the Board some several weeks ago for 'UP, removal of the barn owned by Dr. E.S. Bramlett on Washington Avenue, it was ordered that the Deputy Clerk ask Dr. Bramlett to meet with the Board at the City Hall at 4. P.M. Wednesday, July 19th, to go with the Board to make an inspection of said barn and location of same. * * * * * * * * * * * * * *

In the matter of side-walks and sewerage projeCts on which Mr. Pettis is working, on motion duly made by Alderman Hume and seconded by Alderman Elliott that in order that Mr. Pettis might save the City as much as possible in working out these projects that he take all necessary time in working up said projects. Unan- imously carried. 1 Alderman Haney excused himself from meeting at this time. * * * * * * * * * * * * * * RECESSED MEETING, JULY 18th, 1939

With reference to the amount to the credit of the Automobile Li- cense Fund in Ban); of Oxford, being $330.83, Alderman Chanler advising that he had been paid all that was due him out of said fund, also, with reference to the balance in Bank of Oxford in the Electric Light Improvement Fund, being $69.24; on motion duly made by Alderman Mime and seconded by Alderman Elliott that the deptty Clerk transfer these balances to the Light and Water Fund. Unanimously passed. * * * * * * * * * * * * * *

/ V Upon motion duly made and seconddd that this Board do now recess until Tuesday, July 25th, 1939, at 7:30 P.M• ✓ 1-/ RECESSED MEETIIG OF SFE•IALLMEETING OF;JULY17,4939, RECESSED TO JULY 18, 1939 at 7:30 P.M. RECESSED TO JULY 19, 1939, at 4 P.M. OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen met pursuant to a Recess Order of July Grtrer--oc-Jktlr18, 1939, at 4:00 P.M. when and where the following were present: ✓ ✓ Mayor R.S.Williams Presiding Branham Hums, Alderman at large

I. E. bent, Alderman Ward One B.O. Elliott, Alderman Ward Three * * * * * * * * * * * * * * * * * * * *

L.O. Andrews, Attorney H.C. Bell, Deputy Clerk

127)

Cq After the meeting had been opened according to law, the following business was transacted to-wit:

The above minutes were read,approved and adopted.

/ ✓ Upon motion duly made, seconded and passed, it was ardered,that this Board do now adjourn sine die. 14i; X We:eft-tw Mayor Clerk y ✓

L 245

RECESSED REGULAR MEETING JULY 25, 1939 OXFORD, MISSISSIPPI

The Mayor and Board of Aldermen met pursuant to a Recess meeting Order of July 18th, 1939, at 7:30 P.M. when and where the following were present;

Mayor R.X. Williams, Presiding Branham Hume, Alderman at large B.O. Elliott, Alderman Ward 3

C.. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted, to-wit: On motion duly made by Alderman Hume and seconded by Alderman Elliott that

the City appropriate the sum $35;00 tp be taken out of th Light and Water .' Hind for the builalug of a float to be used in the parade at to Water m'ellon Carnival at Water Valley on August 3rd and that the building of said float and all arrangements connected therewith be under the supervision of H.D. Webster and the Schoo. Trustees hlong with the arrangements of having Oxford City Band taking part in said parade. * * * * * * * * * * * * * *

On motion duly made by Alderman Elliott and seconded by Alderman baney that on account of error in the coblection of the amount of taxes due by E.E. Murray on his home; same having been assessed on the books at $2000.00 and the amount having been shown as $2200.00 on receipt dated January 24, 1939, being receipt $258, making an error of $4.40, be refunded on account of said error. The above motion was unanimously carried. * * * ** * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elltott that the Deputy Clerk spread on the minutes a record of interest paid, notes paid and notes renewed at the banks, in accordance with authority given the Deputy Clerk under date of July 7th, 1939, minute book # 10, page 233. Above =tit= carried. At Bank of Oxford,'paid note dated'October 27, 1938, amount of $850.00, interest at 4% paid $24.65, paid interest on $1000.00 note dated October 31st, 1938, to July 17th, 1939, amount of interest at 4% $28.67. Renewed note Oor $1000.00 for three months from July 17th, 1939, at 4%. At First National Bank, paid note for $1400.00 dated November 2, 1938, and interest at 4% amounting to $37.80. Paid $1336.66 on note dated November 32, 1938, amount of note $6836.66, and interest at 4% to July 5th, 1939, amounting to $169.39. Renewed at 4% interest for three months dated July 5th, 1939, amount of renewed note $5500.00. ******* * ************ * *

Mayor Williams, Alderman Hume and Alderman Elliott met Dr. E.S. Bramlett at the Mayor's office en afternoon of July 19th, in the matter of the location of Dr. Bramlett's barn located on Washington Avenue, Dr. Bramlett advised that he had purchased a site for the barn From Dr. W.W. Phillips east of St. Peters Cemetery, and was building a modern barn on this locatimb and would remove the barn located on Washington Avenue within the next sixty days. The Board instructed the Deputy Clerk to so advise the petitioners. * * * * * * * * * '* * * * * *

1 RECESSEDREGULAR UEETING, JULY 25, 1939

On motion of Alderman Elliott and seconded by Alderman Haney instructing the Deputy Clerk to advise Mr. J.W.T. Falkner in reply to his letter of July 56h, with reference to the Byrd Young lot, that this matter had been deferred until Alderman Avent was present at Board meeting, as he was Chairman of the Committee appointed to investigate this matter. Above motion passed.

* * * * * * * * * * * * * * *

On motion duly made by alderman Elliott and seconded by Alderman haney that the letter fr m the Germo Manufacturing Company of St.Louis, Missouri, dated July 17, 1939, and addressed to the Mayor, with reference to an account for disenfectants purchased in 1933, be tabled. Above motion carried. * * * * * * * * * * * * * * * *

On motion duly made Alderman Hume and seconded by Alderman Elliott ) that Mr. Harrison have the City Attorney draw up an advertisement ebbing for vids on fuel oil for three, six and twelve months, and that the city ask for bids on fuel oil and proper advertisement be inserted the required number of times in Oxford Eagle. Passed. * * * * * * * * * * * * * * * * *

On motion duly made by Alderman hums and seconded by Alderman naney that Mr. Harrison take up with the State Highway Department through 114T. R.S. Myers .end secure permission to install the necessary number of stubs and manholes on Highway # 6, running east from South Lamar. Above motion passed. * * * * * * * * * * * * * * * *

Upon motion duly made, peeonded and passed, it was ordered that this Board do now recess until August, 1st, 1939, at 7:30 • 250

RECESSED REGULAR MEETING AUGUST 1st . 1939

OXFORD, MISSISSIPPI'.

The Mayor and Board of Aldermen met pursuant to a Recess meeting order of Jly 25th. 1939. at 7:30 P. M. when and where the following were present:

Mayor, R. X. Williams, Presiding.

Branham Hume, Alderman at Large.

P. E. Avent, Alderman Ward one. W. T. Chandler, Alderman Ward two.

B. O. Elliott, Alderman Ward three. C.S. Haney, Alderman Ward four. *************************************************

L.C.Andrews, City Attorney. H.C.Bell, Deputy Clerk.

Aftet the meeting had been opened according to law, the following business was transacted, to-wit:

The minutes of Jly 25th. were rea, approved and adopted.

Upon motion duly made, seconded and passed, it was ordered that this Board do now adjourn sine die. 251 REGULAR MEETING

AUGUST 1st, 1939 OXFORD, MISSISSIPPI

UNITED STATES OF AMERICA

STATE OF MISSIPPI COUNTY OF LAFAYETTE CITY OF OXFORD L939 * * * * * * * * * * * * * * * * * * * * * * m* * * * * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford, Mississippi, met in regular session in the City hall at 7:30 P.M. Tuesday, August, 1st, 1939, it being the time and place for holding of said meeting, when and where the following were present: R.X. Williams, Mayor Presiding Branham Hume, Alderman at Urge

T.E. Avent, Alderman Ward One

W.T. Chandler, Alderman Ward Two B.O. Elliott, Alderman Ward Three

B.S. Haney, Alderman Ward Four * * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk L.C. Andrews, City Attorney C.E. Harrison, Supt. Light & Water Platt Sam Keel, Marshal

After the meeting had been opened according to law, the following business was had to-wit: After the monthly accounts had been presented to the Board, on motion duly made and seconded, the following accounts were allowed: CORPORATION FUND 633. R.X. Williams, mayor, July salary Moo° 634. Branham Hume, Alderman, July salary :1100 :00 0 635.T.E. Avent, Alderman Ward One, July salary 410.00 636. X.T. Chandler, Alderman Ward Two, July salary 637. B.O. Elliott, Alderman Ward Three, July salary *10.00 638. C.S. Haney, Alderman Ward Four, July salary $10.00.00 639. H.C. Bell, Deputy Clerk, July salary $ .00 640. Lillian Jones, Secretary, July salary 040.00 641. Sam Keel, Marshal, July salary $125.00 642. Graland Kimmons, Night watchman, July salary 4125.00 643.L.C. Atdrews, Attorney, July salary 040.00 644.Mrs. 0.E. Holcomb, Matron, July salary 645. 0.h. Douglass, Upkeep of cemetery for July gg.01174) 646.Elton Addington, 9 sundays for June and July $22.50 252 REGULAR MEETING

OXFORD, MISSI:IPPI AUGUST 1st, 1939

CORPORATION FUND (ROntinued)

647. R.L. Tomlinson, Repl to watch $4.00 645. Texico Service Station, gas for fire truck $5.59 649.S.C. roof Company, Supplies $7.00 650.W.D. Pettis, Engineer for July $8 .5o 651.American La France Fomaite, Fire Dept. supplies 4 .75 652.Graybar, CANCELLED 653.N.O. Aelson Company, Repairs for toilet 43.23 654.F.W. Belk, Repair to fire truck $6.50 655.W.P. Haley, Gas 412.19 656.Petrie Mitchell, surveying $1.00 657.Hughes hardware Company, Supplies $12.67

65o. Oxford Eagle, Publishing notices- $27.94 Total $777.99

STREET FUND

659.S.E. Spears, Foreman for July $100.00 660.Bob Davis, 5 days special police $1o.00 661.Howard Winter, i day special police $1.00 662. S.E. Spears, j day special police $1.00 663.Davis-Mize Company, Supplies $2.25 664.S.C. Toof Company, Supplies $1.44 665.C.G. Huggins, Rep. to truck $7.19 666.blue Star Service, 1 ice book $5.10 667. Paburn-Abston and Company, light bulbs .5o 668.Riechman-Crosby Company, street lights $33.29 669.W.f. Jones, Care of prisoners for July $18.00 670.Portell, Ber4were Co., Supplies $3.21 671.W.P. Haley, Gas 426.84 672. Standard Service Station, Rep; to tire .75 673. I.T. Stogner, 1271-. days special police $37.50 674.J.B. Carpenter and Son, Gas $ 2.24 675. Oxford Eagle, tidy. in paper- $9.) 261.bb

SCHOOL FUND

676. O.D. Smith, ero rate share of July salary $24.00 677.Will Isom, Janitor for July $52.50 678.Porter Hardware, Supplies $4.59 679.R.N. Whitfield, Band master for July, $40.00 $121.09 253

'UULAR MEETING

OXFORD MISSISSIPPI • AUGUST 1st, 1939

LIGHT AND WATER FUND

680.c. E. Harrison, Supt. of Light and Water Plant for July $245.00 681. G.W. Johnson, Chief Engineer for July $135.00 682. A.L. Mullins, Engineer for July $125.00 683. Louis Campbell, Engineer for July $105.00 684. R.H. Winter, Lineman for July $125.00 68 . H.C. Bell, Deputy Clerk for July 68'. Lillian Jones, Secretary for July $170:0()00 68 . B.S. Guyton, Rent for July $35.00 68 . T.A. Dunn, Rent for July *50.00 689. Mrs. Lillie Yates, Rent for July $10.00 690. W.P. Haley, Gas for July $6.77 691. Electromaster, Electrical supplies $4.5 692. Tennessee Valley Electric CoOpany, Electric supplies 693. General Electric Company, Electrical supplies 142.T 694. J.E. Dilworth Company, Supplies 415.03 695. N.O. .Aselson, Water supplies $113.07 696. Graybar Electrical supplies P528.56 697.Riechman-Crosby, Electrical supplies- 698.Westinghouse, Electrical supplies $11.2g 699. H. Blockman Company, Waste $12.00 700. Qrane Company, Water supplies $19.3 701.Mississippi Foundry and Machine Company, Water sup lies $24.06 70g. Lewis Supply Company, Water supplies 703. "enry H. Cross Company, Fuel Oil 11:2g0.20 704.Arkansas Fuel Oil Company, Fuel Oil 4289.53 705. Commercial Print Shop, Stationery and Printing $3.25 706. Texas Company, Lubricating Oil $26.88 707. Standard Oil Company, Lubricating Oil $1.94 708. Hughes hardware Company, Small supplies and hardware $4.75 709. City Grocery, Sundry 710.Porter Hardware, hardware and supplies #10.(1g Total $2268.16

* * * * * * * * * * * * * * * * * * * * *

On motion duly made by Alderman Haney and seconded by Alderman Elliott that the services of an extra night man be discontinued for the present, and that the Deputy Clerk advise Mr. I.T. Stogner, the extra night man, by letter to this effect, also, that Mr. Bob Davis be used under the supervision of Mi, Keel, as an extra man when and where needed. The above motion carried. * * * * * * * ** * * * * * *

On motion duly made 1)r Alderman Hume and seconded by Alderman Anent that the deputy clerk and the City Attorney make up a list of all lots in the city that have been sold for back taxes; the city attorney making a legal description of each piece of property and advising the number of years of back taxes same can be sold by the city. Unamiously adopted. * * * * * * * ** * * * * *

The following bids, as per advertiiement, for gasoline, oils and greases, were opendd and read: J.B. Carpenter and Son, Oxford, Gasoline 1610; Penne Motor Oil "Gold Seal" 55 Gal, drums, 550 gallon;Wuaker State Motor Dil 55 gallon drums, 800 per gallon (prices on motor oils incl de SAE 20,30, 40 and 50), %uaker State Tran. Oil 100 # drums, .1475 lb; ''.uaker State Chassis lubricatig 100# drums, .1525 lb.; C.G. nuggins i Oxford, Gasoline 70 Octane and over a maximum of 400 end point at price 180 per gallon Federal Tax not included. Essolube motor oil per quatt, all weights, 200 per quart; Mobiloil, per quart 250, per quart, Esso Motor oil, per quart 300: Joe Stokes Motor Company, Oxford, Mississippi, range Pan-Am Gasoline, 1810 per gallon lead treated; Pan-Am motor Oils, all grades, canned, 250 per quart; Valvoline oil, all grades 300 per qt. Pan- Am Automotive Greases, Pressure greases 20#, Transmission SAE 90 to 250, 200 per lb. Extreme pressure Grease, SAE 90 to 250, 200 per pothd; W.P. Haley Oxford, Mississippi; 70-72 Octaine Gasoline 400 EP at 160 per gallon, Enarco Motor Oil in cases, any weight, 680 per gallon, or 200 per quart broken; Nation- al Motor Oil, 600 per gallon; Greases at 100 per pound. REGULAR MEETING

AUGUST 1st, 1939 OXFORD, MISSISSIPPI

All of the foregoing bids were for Service Station Deliveries.

On motion duly made by Alderman Avent and seconded by Alderman Humet that W.P. Haley s prices on gasoline, oils and greases, being the lowest bid, that W.P. Haley^be given the contract on same for the months of August, September and October. The Majority having voted "Yea" said motion carried. * * * * * * * ,1‘ * *

The Budget for the Oxford Separate School District for the school year, 1939-40, amounting to $35,787.15, having been presented to the Board by superintendent A'.H. Gillespie and read to the Board by Mayor R.X. Williams, and on motion duly made by Alderman Hume and seconded by Alderman Avent that the budget be approved. Above motion passed. * * * * * * * * * * * * * * * * *

WHEREAS, it appears to the Board of Mayor and Aldermen of the the City of Oxford, ,viississippi, that the city has bonded obligations and interest due and payable on August 1st, 1939, in the sum of $2675.00; and

WHEREAS, it further appears that said money can be repaid within three months, from this date and not before and therefore, it will be necessary to borrow said sum for sag period of time.

NOW, THEREFORE, be it resolved by the Board of Mayor and Aldermen at a regular session assembled that the Mayor R.X. Williams, and the City Clerk, B.O. Ellibkti be and are hereby authorized, empowered and directed to borrow any amount not exceeding $2500.00 at 4% or less interest, that they find necessary in order to meet the payment of the above bonds and interest promptly, pledging the full faith and credit of the City of Oxford for payment of same according to the tenure and effect of the note executed therefore.

-THE said resolution having been first produced in writing was read and adopted. Those voting "yea" being T.E. Avent, Branham Hume, b.O. Elliott, W.T. handler and C.S. honey, Those voting "nay", None.

Ordered in regular meeting on this the 1st day of August, 1939. * * * * * * * * *

In the matter of having the Zoning Ordinance published, on motion duly made by Alderman Hume and seconded by alderman Elliott it was ordered that same be published in Oxford Eagle in the issue of August 3rd, 1939. Above motion passed. * * * * * * * * * * * * * *

On :motion duly meth7, Alderman Hume and Seconded by Alderman Avent' that the fellewtng advertisementlpe placed the legal number of times in the Oxford Eagle asking for bids on Fuel Oil for the power plant of the city: REGULAR MEETING, AUGUST lst, 1939 OXFORD? MISSISSIPPI

On motion duly made by Alderman thime and seconded by Alderman Chandler that Mr. Harrision, Superintendent of Light and Water Plant is hereby instructed to go ahead and install the necessary manholes and sewer stubs on University Avenue east of South Lamar street. Above motion passed. * * * * * * * * * * * * * * *

In the matter of complaint of Mt.. Dan Roy on behalf of the Blue Star Service, Home Ice Company and New lee Company of their assessment for the year of 1938, on motion duly made by Alderman Hume and seconded by Alderman Avent that Tax Collector H.C. Bell be instructed to go over the properties assessed with Mr. Roy and make his recommendation to the next regular meeting of the Board. Above motion passed. * * * * * * * * * * * * *

In the matter of Assessment against the Porter Hardware Company on merchangise and fixtures for the year 1938, on motion duly made by Alderman Chandler and seconded by Alderman Haney that on account of their appearing to be a g gross error in this assessment of $1000.00 on fixtures and $4000.00 on stock of merchandise, that same be reduced to $500.00 on fixtures and to $2000.00 on merchangise. Above motion passed. * * * * * * * * * * * * * * *

On motion duly made by Alderman Hume and seconded by Alderman Elliott that Spears, Street Foreman, be instructed to engage sufficient labor to have all the grass and bushes along the streets, allies and sidewalks on city property cut and trimmed. Above motion passed. * * * * * * * * * * * * * *

On motion duly made, seconded and passed it was ordered that this Boadd do now recess until the first Tuesday in September, being September 5th, 1939, at 7:40 2•14• 256 SPECIAL MEETING, AUGUST 10, 1939

OXFORD, MISSISSIPPI

TO THE MEMBERS OF THE MAYOR AND BOARD OF ALDEENEN CF THE CITY OF OXFORD, MISSISSIPPI

Notice is hereby given that a Special meeting of the Mayor and Board of Alder- men of the City of Oxford, Mississippi, will be held in the Chamber of the Mayor and Board of Aldermen in the City Hall of Oxford, Mississippi, at 7:30 P."4. o'clock on Thtr- sday, August 10, 1939, for the purpose of discussing whether or not the addition to Mrs. J.O. Ramey's Sandwich shop on University Avenue which she contemplates making thereto violates the provisions of the "Zoning Act" of said city adopted June 26th, 1939, and effective July 18th, 1939, and if it does determining whether said act shall be enforced and party restrained making such addition, and doing any and all other things pertaining thereto, and necessary to carry into execution the decision of the Mayor and Board of Aldermen in the premises.

(Signed) Mayor R.X. Williams

CONSENT TO MEETING

We, the undersigned, being all the members of the Board of Aldermen of the City of Oxford, Mississippi, hereby accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Aldermen shall meet at the time and place therein named, and fot the purpose therein stated. (Signed )

B.O. Elliott, C.S. Raney, W.T. Chandler, T.E. Avent * * * * * * * * * *

I, Sam Keel, Marshal of the City of L)xford, do hereby certify that, after diligent search, I am unable to locate Branham Hume, Alderman at large, in the City of Oxford, therefore, I cannot serve this notice of Special Meeting on him.

(Signed) Sam Keel, Marshal * * * * * * * * * * * * * * * *

The Mayor and Board of Aldermen met pursuant to the above call at 7:30 P.M. on August 10, 1939, when and where were present the following:

Mayor R.X. Williams, Presiding T.E. Avent, Alderman Ward One B.O. Elliott, Alderman Ward Three C.S. Haney, Alderman Ward Four

After the meeting had been opened according to law, the following business was transacted, to-wit:

The following petition was presented to the Mayor and Boadd of Aldermen;

', TO THE HONORABLE BOARD OF MAYOR AND A;BERMEN OF THE CITY OF OXFORD, MISSISSIPPI

I, Mrs. J.Q. Ramey, the undersigned petitioner hereby made application for authority to construct an addition to the building located on University Avenuee in said city, now kno_waas designated as the Marvel Flower Shop, and being the building numberedA6,)on said Avenue. The plan for said addition to include only an addition the present building, on the original foundation of the rear part thereof, measuring 25 feet east and west, the present width of the above mentioned building, and extending 30 north and south at the rear of SPECIAL, MEETING. AUGUST 10, 1939

OXFORD, MISSISSIPPI

the present building, so that the building avoe mentioned, then said addition is completed will compose and constitute a building 94 feet in length north and south, by a width of 28 feet front and 25 feet wide at the rear.

This ',petitioner would show that the need of said addition to said building is urgent to care for the trade during the school session scheduled to begin in early September, that a formal application will be presented for consideration by your honorable Body at the regular September 1939 meeting, and pending the time for the donvening of said meeting, this petitioner prays that authority of the members of the Body be given by approval of this petition to begin construction at this time.

Respectfully submitted: (Signed)Mrs. 3.0. Ramey, letitioner.

Approved for adoption at the Regular geptember, 1939, meeting, this August 10, 1939. c.r2) C3

.0.14 After the matter had been thoroughly discussed between the Mayor and Board of Aldermen, upon motion duly made by Alderman Avent and seconded by Alderman Elliott that the Mayor and Board of Alddrmen do hereby reject your application and petition to construct an addition to the building known and designated as the Marvel Flower Shop and being building 406 on University Avenue, in the City of Oxford, Mississippi, as it is clearly stated in your application and petition "that the need of said addition to said building is urgent to care for the trade during the school zession scheduled to begin in early September:"

This is in a restricted residental section and permit cannot be issued for the construction and addition for a building to be used for any other purpose than a residence. The above motion was unanimously passed. * 114 * * * * * * * * * * * * *

On motion duly made by Alderman Avent and seconddd by Alderman Elliott, that the deputy Clerk, H.C. Bell, notify Mr. Sam Keel, Marshal/to instruct the Artistic Marble Works on North Lamar Avenue to move the marble sled or slabs now located on city property off of city property, account of same being a hazard to the public. The above motion carried. * * * * * * * * * * * * * *

On motion duly made by Alderman Elliott and seconded by Alderman Haney that 1/4. Harrison, Building Inspectot, notify Mr. Worley of the Artistic Marble Works located on North Lamar Avenue or Mr. L.G. Lynch, that he or they must file an application with plat drawn to scale, for any addition or alterations to the k building now occupied by them on North Lamar Avenue as a marble works plant, The above motion was unanimously passed. * * * * * * * * * * * * * * * *

There being not further business to come before the board at this time, on motion duly made and seconded and passed, it was ordered that this Board do now adjourn sine die. or?) 1/0-Le mayor r 258

RECESSED REGULAR MEETING

Stptember 5, 1939.

OXFORD, MISSISSIPPI.

The Mayor and Board of Aldermen met pursuant to a Recess Meeting

order of August 1st, 1939, at 7:30 P. M. when and where the fol-

lowing were present:

Mayor, R. X. Williams, Presiding.

Brangam Hume, Alderman at Large.

T. E. AVent, Alderman Ward one.

W. T. CGandler, Alderman of Ward two.

B. 0. Elliott, Alderman of Ward three.

C. S. Haney, Alderman of WardfOir. ******************************************************

H. C. Bell, Deputy Clerk.

After the meeting had been opened according to iaw,the fol1ig9igg business

wqs transacted, to-wit:

The minutes of August 1st. were read, approved and adopted.

Upon ""otion duly made, seconded and passed, it was ordered that this

Board. do now adjourn sine die.

/X degeet—zia.g.ot.t■• A Mayor. Clerk. 259

REGULAR MEETING

SEPTEMBER 5, 1939 OXFORD, MISSISSIPPI

UNITED STATES OF AMERICA STATE OF MISSISSIPPI

COUNTY OF LAFAYETTE CITY OF OXFORD 1939 * * * * * * * * * * * * * * * * * *

* * * * * * * * * * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford Mississippi, met in regular session in the City Hall at 7:30 P.M. Tuesday, September 5th, 1939, it being the time and place for holding of said meeting, when and where the following were present:

R.X. Williams, Mayor Presiding Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1 W.T. Chandler, Alderman Ward 2

B.O. Elliott, Alderman Ward 3

C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * * * * * H.C. Bell, Deputy Clerk L.C. Andrews, Attorney C.E. Harrison, Sul*. Light and Water Plant Sam Keel, Marshal After the meeting had been opened according to law, the following business was had to-wit: After the monthly accounts had been presented to the Board, on motion duly made and seconded, the following accounts were allowed:

CORPORATION FUND

760.R..A. Williams, Mayor, August salary $80.00 761.Bran#am Hume, Alderman ", $10.00 762.T.E. Avent, " " " $10.00 /I Pt 763.W.T. Chandler, " $10.00 764.B.O. Elliott, " 9 " *10.00 762. C.S. Haney, " " " $10.00 766.H.C. Bell, T.C. " " $50.00 767. Lillian Jones, Secretary,August salary $40.00 9 766. Sam Keel, Marshal, 9 $12500 769. Garland Kimmons, Night Watchman, August salary 4125.00 770.L.C. Andrews, Attorney, August salary $40.00 771.Mrs. 0.E. Holcomb, Matron, " 9 $20.00 772.Hughes Hardware, Supplies--- ' $39.86 773.Porter Hardware Co., " 31.54 774.Patton-Courtney Hardware, Supplies $1.02

775.Tom L. Ketchings P Office supplies $44.55 REGULAR MEETING, SEPTEMBER 5th, 1939

CORPORTION FUND (Continued)

776. Hederman Brothers, Office supplies $11.99 777. S.C. Toof Company, Supplies- #37.44 77n ''cut! rn Disenfectant Co., Supplies -414.70 779. ".P. A 'aley, Gas and oil- $17.t3 780. Coers Variety Store, Supplies for museum- -41.25 781. A.H. Avent, Rest rood' supplies 41.20 782. Oxford Eagle, Advertisements -4126.81

783. falter D. Pettis, Engineer for August -- -462.75 78A. Oxford Eagle, Program for Museum 410.00 41218.27 __J STREET FUND

7F5. Spears, Foreman, August salary $130.00 78g. J.B. Carpenter and son, Gas and oil- ---*3.1 78 . Hughes hardware, Supplies 45.46 -/e1( Patton-Courtney, Supplies $33/7P0 789. Guy &party, Cost in Phil Thompson case $9.05 790. Texaco Service Station, Rep. to tire .5o 791. Porter Hardware Com., Supplies •45 792. Hall Blacksmith, Repair to tire--- - $1.05 793. Davis-Mize, Supplies 44.50 794. C.C. hug&;ins, Repair to truck $7.56 795. Standard Service Station, Repair to truck 41.35 796. W•P• Haley, Gas -436.19 797. F.W. Belk Garage, Rep. to truck 79d. Porter Hardware, Supplies $2.04 799.SA Keel, Special police $33.50 800. Bramlett Hospital, "ospital fee $1.00 8o1. McKesson and Robbins, Disenfectant 46.50 802.W.T. Jones, Keeping city prisoners f9.75 803. ".S. Dickey Clay Manfacturing gppplies 443.2.37 i'FF--0i4

SCHOOL FUND

804. O.D. Smith, '`ro rata share of August salary $24.00 810. "ill Isom, Janitor for .August 452.50 81. R.N. Whitfield, 'andmaster for Augst $40.00 8o c„ A. Gregory, Administrative Expense $3.95 809. American Book Company, books $2.23 81o. Commercial Print Shop, Office expense 41.50 811. Oxford Insurance Company, Insurance $207.24 84. Pittsburgh Plate Glass Company, Repairs and repla&ements $15.90 y& 7. ) $347.32 3 co, 6 I

REGULAR MEETING? SEPTEMBER 5, 1939

LIGHT AND WATER FUND

813.C.E. Harrison, Supt. Light and Water Plant $245.00 814.4.W. Johnson, Engineer, August-salary $135.00 815.A.L. Mullins, " “ $125.00 816.Louis Campbell, " " ti 4105.00 817.R. h. Winter, Lineman It it .125.00 818.H.C. Bell, Deputy Clerk, " It $50.00 819.Lillian Jones, Secretary, " n $40.00 820.B.S. Guyton, Rent for August 035.00 821.T.A. Dunn, " " “ $50.00 822.Mrs. Lillie Yates, Rent for Augst $10.00 823.Westinghouse, Supplies, meters and repairs 4166.64 824. General Electric, Meters and repairs $55.129 825.Riechman-Crosby, Electrical supplies $17.40 826.Tennessee Valley Electtic Company, Electrical supplies *132.62 827. J.E. Dilworth Company, Small supplies and hardware $19.75 82d. Riechman-Crosby, Sundry--- -$7.34 829.W.P. Haley, Gas and oil 410.92 830. Gpulds Pumps, Repairs and welding, $32.85 831.Texas Company, Lubricating oil 832. Oxford Eagle, Stationary and printing $V72:g 833 . Badger Meter Company, Meters and repairs $211.02 834. Tom L. Hatchings, Supplies $12.24 83 .Blue Star Service, Ice book $5.10 836. Commercial Print Shop, Printing $14.00 837.Davis-Mize Company, Supplies $4.50 838.Tri-State Armature and Electrical Works, Repairs .70 839.A- merican Locomotive Company, Repairs and welding 0.75 840.Detex Watchclock Corp., Supplies $1.65 841. Cabell Electtic Company, Supplies $13.10 842.Petroleum Products, Fuel Oil $252.55 843.DeLaVergne Engine Company, Repairs $378.10 844.Mississippi Foundry 8cMachine Co., Watch repairs $24.06 845.H. Blockman and Company, Wipers $12.00 846.Henry H. Cross Company, Fuel Oil $236.31 847.Southern Supply Company, Water supplies $20.22 848.Graybar, Meters and repairs---- $7.28 849.Pitsburgh iquitable Meter Company, Repairs $74.38 850.hughes hardware Company, Supplies and hardware $8.52 851.Patton-Courtney Hardware, Supplies and hardware $23.81 852.x'orter hardware Company, Supplies and hardware $2.79 853. Ozburn-Abston Company, Supplies and hardware .25 854.Texaco Service Station, Oil 41.00 855.N.O. Nelson Company, Water Supplies $20.64 856. ".S. Dickey Clay Manfacturing Company, Clay pipe and culvert 857.Crane Company, Water supplies $3$2112(7) .

* * * * * * * * * * * * * * * 262 REGULAR MEETING, SPETEMBER 5th, 1939

The account of the Eureka Fire and hose Company, amounting to $317.33 was ordered to be paid at the rate of $1.00.00 per month until the total amount is paid.

In the matter of petition of Mrs. J.O. Ramey for Building permit at 406 University Avenue on the same foundation and connected to the Marvel Flower Shop, for use as rooms and apartment. On motion duly made by Alderman Ilume and seconded by Alderman "aney that petition be granted when 'wirs. J.O. Ramey had signed an affidavit to be drawn by '4rs. L.C.Andrews, said affidavit to meet the requirements of the Zoning Ordinance and said affidavit to be attached to and be a part of her mretition for Building Permit" as filed with mr. C.B. Harrison, Building Inspector. The above motion passed.

* * * * 1, * M 4 4. 4

Miss Ella Butler and Miss Dorothy Oldham appeared before the Board in behalf of a Librarian for the Public 44brary, stating that the Board of supervisors had agreed to donate the sum of $17.50 per month if the City of Oxford would match same. Cn motion duly made Alderman Chandler and seconded by Alderman Hume that the city donate the sum of $11.50 per month regardless of what action the Board of supervisors tool; towards the salary of a librarian and expenses, until such time that Miss Lottie Morgan may be reinstated on the Gtvernment 1"roject. The above motion was unanimously passed. * ,1% * * * * * * * *

mr, Billy Gates appeared before the Mayor and Board with reference to the City taking an advertisement in the Football rrogram for the season, stating that to duplicate last years advertisement would cost for the three home games $24.50, and for the four games, three home and one in •emphis, $35.00. On motion duly made by Alderman l'aney and seconded by Aldermen Elliott that the City do not carry an advertisement in this years program. The above motion was unanimously passed. * * * * * * * * *

il4TS. Ada MOLarty appeared before the Board and on being asked by the Mayor if she had anything she desired to present, she stated that she would like to look at the City "ap. The Mayer requested 14iI*. Pettis to show Mrs. McLarty the map in the office. * * * * * * * * * * * * 4 * * *

Mr. Joe Thompson stated that he had had an excessive water bill for the month of August, running some 35,000 gallons, and asked relief. It developed that he had had a heavy water bills for several months, but that the city had adjusted same one or more times. On motion duly mady b Alderman flume and seconded by Alderman Haney, that in view that same had been adjusted at least once, and under the rules it was not a matter for the city to pass upon or an expense that the City should incurr. The above motion passed. * * * * * * * * *

mr. Joe Thompson presented to the Board on behalf of "ors. Siveley a plea that the city accept and take over the streets in the L4veley On motion duly made by Alderman "nme and secondedr by Alderman Elliott that the city accept same aubject to the approval of the deed by the Mayor and Board of Aldermen when presented. The above motion was unanimously passed. * * * * * * * * * * * *

"Ir. Alonzo Westbrook appeared before the Board in the matter of insurance on the Buie Museum Building, On motion duly made by Alderman Mime and secondedt by Alderman haney that the city do not take out any insurance on this building at the present time. The above motion was passed. * * * * * * * * * * * * *

REGULAR MEETING, MPETEMBER 5th, 1939

At this time the Deputy Clerk opened and read to the Board the following bidso on fuel oil for Light and Water Plant, as requested by advertisement in the Oxford Eagle:

Simmons Oil & Refining Company, Inc., Shreveport, Louisiana, three months 5.05V per gallon, including 114 per gallon, Mississippi State Tax.

Pkimrose Petroleum Company, Dallas, Texas, three months 4.92V per gallon delivered uxford, "ississippi, not including per gallon state tax.

henry h. Cross Company, Chicago, Illinois, one year, 3,x per gallon F.O.B. R.R Smackover, Rakansas, present freight rate is 1.92V per gallon, does not include 14 per gallon 'qssissippi state tax. "11 above bids based on the specifications as advertised. On motion duly made by Aldermen Avent and seconded by Alderman Hume that the city accept the bid of the Henry h. Cross Company for a one year contract at price of 3¢ F.O.B. Smackover, Arkansas. Above motion was passed.

* * * * * * * * * * * * * * * * *

LrJ Mr. Avent was called from the meeting at this time, by phone. * * * * * * * * * * * * * * * 171 c.L.4 In the matter of petition for building permit by Miss Anna Lynn Dooley and JIM. Dooley to build a Kindergarten on the residence lot of AJooly, being remit # 6, plat and sketch attached, on motion duly made by Alderman Hume and seconded by Alderman haney that Mr. Harrison, Bullding Inspector be instructed to issue said permit. Above motion was passed. * * * * * * * * * * * * * *

Came on for consideration the renting of the old '41eyor's office. 44i'. W.L. Caldwell, made an offer for same to be used as a laundry; offering rental of $20.00 per month for three months from ' actober 1st and $25.00 per month for the year 1940, asking for repairs not to exceed d020.00.

Mr. Grady Wilson of the uxford rroduction Office had made an offer of $30.00 per month for a three year lease, the city to make necessary repairs, amounting to some $390.00. After some discussion on motion duly made by Alderman haney and seconded by Alderman Chandler that the city make an offer to the Oxford roduction and Credit Association to rent the building to them at $40.00 per month they to pay water and light bills, and lease to run for three years, the xity making the repairs requested, or that they would rent the building to them in its present condition on a three year lease, they to pay water and light, at $30.00 per month. if the Oxford Production and Credit Association did not accept either of the above offers then the city to advertise the building and lot for sale or lease. The above motion wqs passed. * * * * * * * * * * * * * *

In the matter of petition for building permit by Carl Coers, tenant house on the Pelican Lot, being permit # 5, plat and sketc ttached, on lion duly made by Alderman hume and seconded by Alderman hane d petition granted. Above motion passed. * * * * * * * * * * * *

Alderman Fume brought to the attention of the Board a request of Dudley Grimes for permission to move and replace a certain sign at his place of buitness on North Lamar Avenue. After some discussion on this matter it was decided that the Mayor and Board meet at this place of business at 10 o'clock A.A. on Wednesday September 6th, and investigate the matter before passing on same. * * * * * * * * * 264 REGULa MEETING, SEPTENBER 5th, 1939

In the matter of hiring a lawyer to handle the case of the Arkansas Fuel Oil Company vs the City of Oxford in circuti court, alcc, Supreme Court, if appealed wherein they have filed a bill of objections to the use Map. On motion duly made by `alderman "lime and seconded by Alderman 'bendier that Ofttorney L.C. -ndrews blt employed by the City of 'xford in this case, at the rate of K00.00 in circuit and if carried to the Jupf.tme court that he be allowed an additional $5C.00. The above motion passed. * * 11/4 * * * * *

WHEREAS, it appears to the 41yor and Bpard of Aldermen of the City of Oxford, iMississippi, that the following real estate located in Oxford, Laf- ayette county, iiississippi, to-wit:

T.‘1.. Lot 69, Section 21, Townshcp 8, Range 3 west, assessed to Robinson, Taylor (Edmonia) was sold to the City of Oxford to December 5th, 1932, for the t taxes due thereon for the year 1931, including Front-Foot assessments; Fr. it 87, Section 21, Township 8m Range 3 west, assessed to Ella Rowsey, was sold to City of Oxford, mississippi, for the taxes due thereon for the year 1931,1he sale being made on December 5th, 1932; Fr. Lots 87, 91 and street, S.W. Fr. 87, S.E. Fr. 91, and old Street, assessed to "d.TS. S.O. Wall, was sold on December 5th, 132, to City of Oxford for the taxes due thereon for the year 1931, including Front- - oot assessment; Fr. of Lot 88, Section 21, Township 8, Range 3 west, assessed to Wcrtham, 2 cliff, was sold December 5th, 1932, to City of ''xford for the taxes due thereon for the year 1931; Fr. Lot 68, Section 21, Township 8, Range 3 west, assessed to I.J. it .411is, was sold on September 17th, 1934, to City of oxford for the taxes due thereon for the year 1933; N.W. Fraction of Lot 500, Section 21, Township 8, Range 3, west, assessed to J.E. Bounds was sold to City of "xford on September 17th, 1934, for the taxes due thereon for the year 1933; Fr. Lot 64, Section 21, Township 8, Range 3 west, assessed to Turner, Milton, was sold to City of oxford on September 17th, 1934, for the delinquent taxes due thereon for the year 1933) Fr. Ilt 67, Section ;1, Township 8, Range 3 west, assessed to Wileue Flora, was sold to City of 'xford on September 17th, 1934, for the taxes due hereon for the year 1933; Fr. of Lot 69, Section 21, Township 8, Range 3 west, assessed to .L. Brown, was sold to City of Oxford on October 7th, 1935 1 for the taxes due thereon for the year 1934; Fr. Lot 179-180, Section 21, Township id, Range 3 west, assessed to K.M. Hickey was sold to City of Oxford on October 7th, 1935, for the taxes due thereon for the year 1934; Fr. N. Lot 88, Township 8, Range 7 west, assessed to Mayes, Rosa 114. was sold to City of Oxford on October 7th, 1935, for the taxes due thereon for the year 1934; Fr. Lot 66, Section 21, Township 8, Range 3 west, assessed to IiicEwen, S.b. was sold to City of Oxford on October 7th, 1935, for the Front-Foot assessment due thereon for the year 1934; Lot 460 and E. Fr. Lot 461, assessed to "ITS. Julia Kendall, same being in Section 21, Township 8, Range 3 west, was sold on °ctober 21, 1937, for the Front-Foot assessment due thereon for the year 1936, including also sold on same date, for taxes due thereon for the year 1936, assessed to Estate of A.R. Kendall, N.E. Fr. 462, N.E. Fr. 463, likewise in said section, Township and range, all being sold to city of "xford; Fr. Lot 159, Section 21, Township 8, Range 3 west, assessed to Davidson, "amp, was sold on October 21, 1936, to City of Oxford for the taxes due thereon for the year 1935; N.W. Center Fr. Lot 500, south fraction lot 400, Fr. Lot 64, 81, the last Fraction being in Section 2 8, and the others in section 21, Township 8, Range 3 west was sold on September 20th, 1937, for the taxes due thereon for the year 193b, to City of Oxford, Front- Foot assessment included;except on Lots 64 and 81, assessed to Earl Fudge; Fr. Lot 92, Section 21, Township 8, Range 3 west, assessed to "enderson, Savanah, was sold to City of Oxford September 20th, 1937, for taxes due thereon, for the year 1936; Fr. Lot 66-67, Section 21, Township 8, Range 3 west, assessed to Mitchell, Joe, was sold to City of oxford on September 20th, 1937, for the Front-Foot assessment due thereon for year of 1936; Fr. Lot 20, Section 21, -:jownship 8, Range 3 west, assessed to Sam and"nary Isom, was sold to City of Oxford on September 20, 1937, for the taxes assessed against it, due thereon for the year 1936; Fr. Lot 485, Seo- tion 21, Township 8, Range west, assessed to C.E. Slough, was sold to City of oxford, September 20th, 1937, for the taxes due thereon for the year 1936 o-- 6,63,64,,wes t Fraction 81, Fr. Lot including Front-Foot assessment; Fr. Lots 82, Lot 62, Section 28, Township 8, Range 3 west, was sold to City of 'xford for taxes due thereon for the year 1936, on September 20th, 1937, assessed to E.L. Tate; Fr. Lot 501, Section 21, Township 8, Range 3 west, assessed to Carothers, IL.T., was sold to City of Oxford on September 20th, 1937, for the Front-Foot assessment due thereon for the year 1936; Fr. Lot 114 and Street, assessed to Bawkins, W.C. was sold to City of Oxford on September 20th, 1937, for tames due thereon for the year 1936; South Fr. of Lot 31, Section 28, Township 8, Range 3 west, and Fr. Lot 31 same section, township and Range, assessed to airs. L.C. nutton, was sold to 'ity of oxford on April 4th, 1938, for the taxes due thereon for the 1937, including Front-Foot assessment; Fr. -dot 66, Section 21, Township 8, Range 3 west, assessed 268 REGULAR MEETING, SPETEMBER 5th, 1939

to S.B. McEwen, was sold on April 4th, 1938, for Front-Foot assessment due thereon for the year 1937; West Fr. Lot 34, Section 21, Township 8, Range 3 west, assessed to Oswalt, Van was Sold to city of Oxford on April 4th, 1938, for the taxes, including Front-oot assessments, due thereon for the year 1937, Front- Foot assessment being against Fr. Lot 34, said section, township and range; Fr. Lot 87-88, Section 21, Township 8, Range 3 west, assessed to C.B. Webb, was sold to City of Oxford on April 4th, 1938, for the taxes due thereon for the year 19371 Fr. Lots 412, 414, Section 21, Township 8, Range 3 west, assessed to R.H. Tomlinson, was sold to City of Oxford on April 4th, 1938, for the taxes due thereon for the year 1937; On same date Fr. Lot 412, same section, Township and Range, assessed to said R. 11. Tomlinson, was also sold to said City of Oxford for the Front-Foot assessments due thereon for the year 1937; Fr. Lot 69, Section 21, Township r, Range 3 west; assessed to Second Baptist Church, was sold to City of Oxford on April 4th, 1938, for the Front-Foot assessment for the year 1937, according to statement made and presented by Tax Collector of said city;

AND, it further appearing to the Mayor and Board of Aldermen of City of Oxford, Mississippi, that the sale aforesaid of said lands was void, on account of the insufficient or erroneous description by which they were sold;

BE IT, THEREFORE, resolved by said mayor and Board of Aldermen that the sales aforesaid of said lands for said delinquent taxes be and the same are hereby declared void, on account of the insufficient or erroneous description by which said lands were sold for the said delinquent taxes; that all of said property be properly and legally assessed for each of the years for which such taxes have not been paid as provided in Senate Bill 25, Laws of Extra Session Alississippi Legislature, 193b, and the Clerk of this Board id hereby directed to give notice to the property owner or owners of said property in the manner and for the time required by said law th t said Mayor and Board of Aldermen will at 8 o'clock P. 14'. on 'ctober , 1939, at the office of the Mayor of City of "xford, Mississippi, which office is in the City Hall of said city of Oxford, Mississippi, hear all objections to said assessment.

On motion duly made by Alderman Chandler and seconded by Alderman Elliott that the above resolution as read be adopted. The above motion passed.

* * * * * * * * * * * * * * * * *

In the matter of complaint by "irs. Dezzie Harris on the amount assessed against her Apartment house on Van Buren and South 5th street, on motion duly made by Alderman Elliott and seconded by Alderman Aaney that 'rs. "arris be requeste/to meetwith the Board at the proper time for the equalitation of taxes and thatine take this matter up with the Mayor and Board or Alderman. Passed. * * * * * * * * * * * * * * * * *

In the matter of furnishing a water line to the property of Dr. E.S. Bramlett where he is building a new barn located east of the Cemetery, on motion duly made by Alderman Hume and seconded by Alderman Haney that Mr. Harrison construct the line, laying same through the Cmmetary, replacing the pipe now laid in Cemetery, using his judgment as to the size of pipe to be used, necessary to supply water for Cmmetary and Dr. Bramlett's place east of said Cemetery. Above motion passed. * * * * * * * * * * * * * * * *

Came ort4or consideration the report of the Deputy Clerk in the matter of re-assessing the personal property of the Home Ice Company, ilew Ice Company, BAue Star Service, Cities Delivery Company and Dan Roy. t he Deputy Clerk Acommended that account of their evidently being a gross error in the original assessment, that same be reduced as follows: Blue Star Service machinery reduced f from $5000.00 to $2500.00, merchandise from 41000.00 to $500.00, one storage tank from 4150.00 to 4100.00 and no change on one truck at $50.go, also, that Dan Roy be assessed with machinery located in the old Lawhorn Ice Plant at $500.00. On motion duly made by Alderman Elliott and seconded by Alderman Hume that the Board approve the findings of the Deputy Clerk and that the changes recommended be made. The above motion was passed. * * * * * * * * * * * * *

L REGULAR MEETING, SEPTEMBER 5th, 1939

Te e following record cf stile being recorded in minutes of elayor and Board of Aldermen:

We, the undersigned Board of Aldermen of the City of Oxford, Mississippi, do hereby agree to sell to :.c. L'imms and Fred Wallace te hay rights on the Oxford Airport for the year 2939, ending December 31st, 1939, in consideration of 425.00 cash to be paid in advance with the further consideration that the ground shall be left in as good condition as it is at this time and that no machinery, wagons or trucks are permitted on the field while the ground is soft or muddy.

This the 26th day of August, 1939. Signed: Branham Hume W.T. Chandler C.S. Haney B.0..Elliott

T#e following bonds and interest were paid September 1st, 1939, through the 'rational Bank of Commerce, 'emphis, Ternessee:

Street improvement and iretersection,54 issued 9/1/27 bonds--41500.00 Interest and charges 422.93 41922.93

* r * 4 4 *

The Mayor and Board of Aldermen ordered that all colored churches, Masonic hal and any ether buildings used for school purposes during the time that the city did not have a colored school building, shall resume paydrg for all lights and water used comencing with hills rendered as of 6eptember 1st, 1939.

There being no further business to come before the board at this time, upon motion duly made, seconded and passed it dis ordered that this Board do now recess until 7:3C ie.•"., Yetober 3rd, 1939. gassed. NOTICE OF SPECIAL MEETING

TO THE MEMBERS OF THE MAYOR AND BOARD op ALDERMEN OF THE CITY OF OXFORD, MISSISSIPPI. Notice is hereby given that a Special meeting of the Mayor and Board of Aldermen of the City of Oxford, Mississippi, will be held in the chamber of the Mayor and Board of Aldermen in the City Hall of Oxford, Mississippi, at 11:30 A.M. o'clock on Thursday, September 21st, 1939, for the purpose of considering advertising the City of Oxford in the Century of Progress Edition of the Commer- cial Appeal, payment of same and all matters pertaining thereto, also, to consider the purchase of material and supplies for the sewer project now under construction by the Works Progress Admin- istration and for the advertisdment of bids for said material and all matterw pertaining thereto. R.X. Williams, Mayor Le-D CONSENT TO MEETING C./ We, the undersigned, being all the members of the Board of e.11 Aldermen of the City of Oxford, Mississippi, hereby accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of Mayor and Aldermen shall meet at the time and place therein named and for the purpose therein stated. Signed: B.O. Elliott. W.T. Chandler C.S. Haney Branham Hume

I, S.M. Keel, Marshal, City of Oxford, Miss. do hereby certify that after diligent search, I am unable ti locate T.E. Avent Alderman Ward One in the city of Oxford, therefore, I cannot serve this notice of special meeting on him. S.M. Keel, Marshal * * * * * * * * * * * * * * * * *

No quorum met, therefore, no meeting was held

RECESSED REGULAR MEETING

OCTOBER 3rd. 1939. OXFORD, MISSISSIPPI.

The Mayor and Board of Aldermen met persuant to a Recess order of Septetber 5th 1939, 7:30 P. M. when and where the following were present: Mayor, R. X. Williams, Presiding. Branham Hume, Alderman at Large. Avent, T. E. Alderman Ward one. W.T. Candler, Alderman Ward two. B. O. Elliott, Alderman Ward three C.S. Haney, Alderiaan Ward four. *************************************************** L.C.Andrews, City Attorney. H.C.Bell, Deputy Clerk.

*************************************** After the meeting had been opened according to law, the following business was transacted, to-wit: The minutes of September 5, 1939, were read, approved and adopted.

Upon motion duly made, seconded and passed, it wad ordered that this Board do now adjourn sine die.

X iz,f MA OR A/v

REGULAR MEETING

OCTOBER 3, 1939 OXFORD, MISSISSIPPI

UNITED STATES OF AMERICA

STAT E OF MISSISSIPPI

COUNTY OF LAFAYETTE

CITY OF OXFORD

1939 *°* * * * * * * * *

* * * * * * *

* * * * *

* * krD * * *

Be it remembered that the Board of Mayor and Aldermen of the City of Oxford Mississippi, met in regular session in the City Hall at 7:30 P. 1#1. Tuesday, October 3, 1939, it being the time and place for holding- of said meeting, when and where the following were present:

R.•. Williams, Mayor Presiding

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

W.T. Chandler, Alderman Ward 2

B.O. Elliott, Alderman Ward 3 C.S. Haney, Alderman Ward 4 * * * * * * * * * * * * * * * * *

H.O. Bell, Deputy Clerk L.C. Andrews, Attorney C.L. Harrison, Supt. Light and Water Plant S.M. Keel, ;iiarshal

After the meeting had been opened according to law, the following business was had to-wit:

"fter the monthly accounts had been presented to the Board, on motion duly made and seconded, the following accounts were allowed:

CORPORATION FUND

896. R.X. Williams, Mayor, September salary $80.00 897. Branhat Hume, Alderman n n /9 ft tt 898. T.E. Avent, ttgg 89g. W.T. Chandler, " n " $10.00 ft ft 900. B.O. Elliott, " $10.00 tt tt ) 901. C.. Ilahey, " $10.00 ft 902. H.C. Bell, Deputy Clerk " $50.00 903. Lillian Jones, Secretary " n $40.00 904.Sam Keel, Marshal ft t1 -$125.00 905. Garland Kimmons, Night watchman, Sept ember salary $12"_;,00 906. L.C. Andrews, Attorney ft ft 907. Mrs. 0.E. - Holcomb, Matron ft tf $20.00 908. Elton Addington, 5 Sundays work C $2.50 $44102::: 270 REGULAR NEELIEC, OaTOBER 3, 1939

CORPO:eTi01: FMB (Hntinuel)

909. College Inn, Firemen' s 1:.anTlet------412.2A 910. Texaco Cervice Statien, Gas for fire truck-- ------$2.65 0d 11. "alter B. Pettis, Engineer -----$76.00 912. Orgill Brothers, t:upnlies- - $20.04 913. hughes Hardware ,t ..... _._. ;:-Ig 7 1 914, Hall Blacksmith,Repair to truck ----41.35 915. Patton-Courtney, ,3upplies - $ 15.93 916. Southern Disenfectant Company, Supplies $2.2 017.1 L.C. ,,ndrews, ;ettorney fee in Ark. Fuel 013 Co. $100.06 9_,. Dement Printing Company, Office supplies- $6.52 919. Fulton. Patterson, Recording tute deed -45.20 920. Oxford Eagle, Notice for rid ii -cr's office 414.10 921. Hughes Hardware, Supplies for Museum------$2.55 . 01 p,r) 922. F.W. Belk Garage, Rep. to fire truck ,,,, 923.s.c. Tocf c o,T,,,y 0-e. fi,... - ,„,, , -,.. ..., ,p, 924. C.E. Sleugh, Recording deed------______ 0 2P,. .,3.,° 52g_. 'Westinghouse, Upkeep of fire truck------- $29.b2 95. riugher Hardware, sundry- $15.00 92_, Patton-Courtney, Building Materiel------- - $4.08 oe,o..)e:• Elton feddington, 1 day fire truek eervice ------$1.0

SIREEI icUND

930. se-, spears, ioreman, september salary - $100.00 931. Guy McLarty, Cost in appealed cases ------4I ,e5 932. Hall Blacksmith, Repairs------$1.35 07," W.T. Jones, Keeping prisoners------494.50 934. w...e. Haley, Gasoline---------$29.12 (', 07de',R, J.B. carpenter & Son,' Creasing truck------1.25 93b. Mississippi State Lighway Department, Labot------$43.03 937. Davis-Mize Company, supplies------$2.2 5 938. V.3. Huggins, Repair to treck------1.3 93). F.W. Belk Garage, Rep. to street washer------$6.0 940. Commertial Print -hop, --)rinting---------$25.25 .iorter Hardware. tupplies- 941...... ti!go 94,:. ob Davis, 6 days werk 943. Oxford ',';elding Shop, Repair to sewer cover ______46.00, $50 1.24 SCHOOL FUND

944.L.L. Smith, Pro rata share of Septembersalary------$24.00 94rs. will Isom, Janitor for September $2.90 9.4. Rode Campbell, Maid for Leptember------i1P,.00., 948. --. ,hirley Kilgore, Janitof for colore school- $15.00 949. Magnolia Printing Company, Material for inst.----------$7.19 .. P,r). Gaylord Brothers, Dibrary------$9.70o 951• Porter Hardware, Materiel for instructione------$25.'.6 952. Hall &WicCreary Company, Library- .8o 953. S.C. Toof Company, Material for instructions- • $47.30 954. Phillip Werlein, Music and athletics $11.25 95', . A.D. Wiley, 'Ilaterial for instructions------$1.34 956. Desoto hardware Company, Material for instructions-- OR7r.e .Longman's Green &Company, Library !Iip.'22-.2 95,,:s. Beckleyt-Cardy Company, 'J anitor supplies -$9.28 99. The Selig Company, j anitor sapplies---------$7.09 9g0. Wilson Roberts, Insurance- ------961. Coemercial Print shop, Office expense- 412.75 962. R.L. Tomlinson, Office expense- 963. R.F. Campbell, Repairs and replecements $14.3.i2 964.p.A. Dunham Company, Repairs and replecemente---______-$52.00 965. Aohert Torrey, itnurance--- $237.48 966. Lorenz Publishing Company, Mjsic and athletics 413.53 967. B.". Smith, Repairs and replacements------440.25 968. R.H. Gialespie, Lundry- 969. A.C. Mc lurg, administrative expense- $*6•61 970. C.k,.. Gregory, Administrative xpense------$8.52 971. J. 4-.. Martin, Material for instructions $11.72 972. fayloe Paper Company, Janitor supplies,- $98.84

SCHOOL FUND(Continued)

973.Educational Test Bureau, Administrative expense 42.67 974.Bestal Chemical Laboratories, Janitor supplies 411.00 975.Davis-Mize Company, Janitor supplies 41.7o 976.variety Store, Office Expense 977. International Circulation Company, Library 414.75 $862.08

LIGHT AND WATER FUND

978. C.E. Harrison, Supt., September salary $245.00 979. G.W. Johnson, Engineer, September salary $135.00 980.'-'..L. Mullins, " vf It *125.00 “ 981.Louis Campbell, " " -- -4105.00 982.R.H. Winter, Lineman ft It ----$125.00

“ 983.H•`'• Bell, Deputy Clerk, " $50.00 984.Lillian Jones, Secretary.; " tt $40.00 985.B.S. Guyton, Rent for september- $35.00 986. T..&. /iunn, " " “ $50.00 987.Mrs. Lillie Yates, Rent for September $15.00 988.Hall Blacksmith, Repairs- $2.15 989.W.P. Haley, Gas and oil $10.62 990. Texaco Service Station, Geease .50 991.Ilmerican Locomotive Company, Repairs and welding $19.50 992.Pittsburgh Equitable Meter Company, Meters and rep. 411.6.25 993.Cabell Electric Company, Meters and repairs- $6.13 994.De LaVergne Engine Company, Repairs and welding $4.70 Memphis Electrical laboratory, Meters and repairs 42.?4 7 995.

996.Diesel Elant Specialties, Repairs and welding -- 997.Badger Meter Manf. Co., Meters and repairs $4.45 998.W.E. Dickey Clay Aanfacturing Co., Clay pipe and culvert $93.60 999.Riechman Cvosby Company, Small supplies and hardware $5.30 1000. Southern Supply Company, Water supplies $20.1 1001. Miss. Foundry & Machine Col, Meters and repairs $24.06 1002. Graybar zlectric Co., Meters 4146.40 1003. N.O. "elson Company, Water supplies---- $115.97 1004. Duncan Electric Man. Co., Meters and repairs- 18.32 100 5. Crane Company, Small supplies and hardware 1006. Westinghouse, Electrical supplies 4316 1007. Texas Company, Lubricating oil $53.27 1008. Petroleum Products, Fuel Oil 4253.22 1009. Davis-Mize Company, Small supplies $4.50 1010. Standard Oil Company, Lubricating oil 41.94 1011. merican Locomotive Company, Repairs and welding 1012. Henry h. Cooss Company, Fuel Oil---- $tit17- Jjg 1013. I.E. Dilworth Company, Supplies- 450.59 1014. Tennessee Valley Electric Supply Co., Electric supplies----$117.69 1015. Porter Hardware Company, Sppplies .61 1016. Patton -Uourtney Hardware, Supplies $1.21 1017. nughes Hardware, Supplies $8.98 1018. Cooper Petroleum Company, Fuel Oil #244.24 $2807.99

272 REGULAR MEETING, OCTOBER 3, 1939

Mr. Kyser representing the Farm Security Administration appeared before the Board with request-that the City furnish Janitor service at a cost of $6.0o per month. On motion made by Alderman Elliott and seconded by Alderman Avent that this request be denied. The above motion was unanimously carried.

.D.F MaxidManks, owner of the Ole Miss Taxi ColEany4A;apared before the e d in the matter of having theepekm.edf aVOrtilIarStre4tire front Cf the Kirkwood buildiit reserved for parking taxicabs. After some discussion on this matter, on miption made by Alderman Haney and seconded by alderman Elliott, that if ttefh was no objections by the firms renting the fstore rooms., of- the Kirkwood building_to_thts spaeeltOing -Ighd-ror taxi cabs. only; Mr. Keel to consult with them and secure their approval and if agreeable he then to ascertain te, the manner in which to mark the street in the space in front of the Kirkwood building, and so mark same, and that the space to be used for this purpose until further action of the Mayor and Board of Aldermen. Motion passed. * * * * * * * * * * * # * *

4. Phil Stone appeared before the Board in regard to sewerage connection with the city line, it appearing that his mother's residence on Washington- Avenue and the house they are now moving,and remodeling not having any sewerage connection. The Board instructed Mr. Harrison to check the cost of connecting same with line now west of the 1 .C.R.A. Company on University property and,. also, with the city line east of the I.C.R.R. Company right-of-way and report back to the Board. * * * * * * * * * * * * # * * * * *

On motion duly made by Alderman ilume and seconded by alderman haney instructing the Mayor and Deputy Clerk to write a letter of recommendation for Mr. W.L. Caldwell covering his servifes in making the official map of the City of Oxford. Motion approved. * * * * *

Came on and for consideration the matter of the city entering into contract with the Commercial Appeal for an advertisement to appear in their "Centennial Edition, Jantary 1st, 19y51". On motion duly made by Alderman Avent and seconded by Alderman Elliott that due to the depletion of the funds in the adzprtising fund at the present time that the city was not in position to enterto a contract and could therefore have to pass up the opportunity to participate in their "Centennial Edition". Unanimously carried.

Came on and for consideration the offer of Mr. John Wolfe of 45.00 for the old typewriter desk in the old Mayor's office. After some discussion, on motion duly made by Alderman Anent and seconded by Alderman Hume that the typewriter desk be offered to mr. Wolfe at price of 412.50. Above motion passed.

Came on and for discussion the disposal of all chairs in the old. Mayor office. On motion duly made by Alderman Hume and seconded by Alderman Avent, that these chairs be loaned to the community House. gassed.

l t appearing to the mayor and board of Aldermen of Lixford, ;Mississippi, that the land located in the City of Oxford, Lafayette County, Mississippi, subject to sale for the non-payment of municipal taxes, both ad valoreum end for special Improvements, was not made on the 3rd Monday of September, A.L. 1939, it being the time appointed by law for such sale, due to over-sight upon the part of the tax collector; Therefore, it is ordered that all lands situated in Oxford, Lafayette County, Mississippi, liatie to sale for the non-payment of municipal taxes or special improvements be sold on the second Monday of November, being the 13th day thereof, 1939, and notice of such sale shall be given by advertising it in the manner prescribed by law for the sale of land for State and county taxes; and the sale shall be made at the south door of the Lafayette County Court Louse in Oxford, KisQissippi, and be subject to all REGULAR MEETING, OCTOBER 3, 1939

harangue, or through or by means of minstrels, exihibitions, attractions, show, or amusements in any form $25.00

(b) Upon each transient vendor, or dealer of patent, proprietary, secret, or trade marked medicines or nostpums, and ordinary househ9ld remedies, cosmetics, flavoring extracts and spices when sold in the manner usual to the trades $12.50

(d) Upon each transient vendor, or dealer of cigarettes, cigars, or other tobaccos $25.00

(e) Upon each transient vendor, or dealer of bread, rolls, cakes, pies and other bakery products $25.00

(f) Upon each transient vendor, or dealer of gasoline, kerosene, lubricating oil, and other petroleum products 412.50

(g) Upon each transient vendor, or dealer of fish, oysters, and other sea- foods (Except fisherman selling his own catch) $5.00

(h) Upon each transient vendor, or dealer of coffee, tea, flavoring extracts And speices 412.50

(i) Upon each transient vendor, or dealer of radios, phonograpsh, and pianos $10.00

(J) Upon each transient vendor, or dealer of fruits, tegetables and other produce $100.00

rovided, however, the provisions of this section shall not apply to whole- ,' sale dealers in perishable fruits and vegetables who sell only at wholesale to retailers, and who maintain within this state a warehouse and built-in refrigeration plant, which entire plant and built-in refrigeration has an assessed value of $5000.00, or more, on the realty assessment rolls of the county, or city in which the same is located.

(k) Upon each transient vendor, or dealer of groceries, milk products, (not including raw or pasteurized milk or butter milk), or other food products not otherwise specifically taxes $50.00

provided, that when milk or dairy products are sold from a plant or manufacturing establishment in this state, upon which a proper tax has been paid, the tax imposed upon a transient vendor of such products shall be $10.00

(1) Upon each transient vendor, or dealer of dry geode, including ready to wear clothers, bed spreads, table cloths, etc, small rugs, and other small articles of furniture $12.50

(m) Upon each transient vendor, or dealer of household and kitchen utensils, pots, pans, dishes, knives, forks, spoons, and other small hardware, rakes, hoes, and other garden tools $12.50

(n) Upon each transient vendor, or dealer in anthracite or butuminous clal or coke $25.00

(o) Upon each transient vendor or dealer of any goods, wares, and merchandise usually carried for sale in a general merchandise store, upon each truck operated, whereon general merchandise not exceeding 4200.00 in value is carried $25.00

Upon each truck operated whereon general merchandise of value in excess of $200.00, but which does not excees $500.00 $25.00

Upon each truck operated whereon more than $500.00 in value is carried....$37.50

Provided, that a transient vendor or dealer travkling on folt shall pay one-fifth of the amount set out in the above schedule.

rrovided, that the provisions of this section shall not apply to transient vendors, or their agents, or representatives, in the sale or delivery of gasoline, oil or similiar products when drawn, conveyed, and distributed from a stock maintained at a warehouse, oil depot, distribution station, or established place of business in this state, upon which has been paid all privileges taxes required, and when the same is sold, conveyed, or distributed to another station owned, leased, contracted, or commissioned by the owner of said depot, warehouse, r 276 REGULAR MEETING, OCTOBER 3, 1939

distribution station, or established place of business.

(p) Upon all checking agents in the business of checking the affairs of business concerns for pe r sons, corporations, or joint stock corporations engagod in business of disseminating information for commercial purposes $25.00

(q) -erovided, however, that where any person subject to the payment of the tax imposed by this section, makes use of more than one vehicle in carrying such business, the tax herein imposed shall be paid for vehicle used in carrying on such business.

rovided, further, that no part of this section shall be construed so as to impose any tax, or require any duty of travelling salesmen representing manufactur- ering of pottery, washboards, well buckets, wooden toys, wooden toy furniture, and similiar articles selling to dealers only, where not more than $3000.00 is invested in the plant manufacturing such articles, and the owner of such plant shall, procure from the sheriff of the county where the plant is located a certificate to that effect, and each skid travelling salesman shall at all times carry such certificate when making sales, and shall exhibit the same to any proper officer upon request.

DEFINITIONS OF TRANSIENT VENDOR OR DEALER

When used in this section, the words "transient vendor or dealer" shall be held to include any person who shall be embraced in and of the following classifications:

(1) all persons commonly and generally termed "peddlers" and falling within the usual dnd commonly understood definition of "peddlers", or

(2)All persons acting for themselves, or as agent, employee, salesman, or in any capacity for another, whether es owner, bailee, or other custodian of goods, wares, and merchandise, and going from person to person, dealer to dealer, house to house, or place to Place, and selling or offering to sell at retail, or wholesale, goods, wares, and merchandise, or

(3)All persons who do not keep a regular place of business open at all times in regular business hours, and-at the same place, who shall sell or offer for sale goods, wares, and merchandise, or

(4)All persons who keep a regular place of business open at all times in regular business hours, and at the same place, who shall, elsewhere than at Such regular place of business sell or offer for sale, at the time of such sale, or offering for sale, deliver goods, wares, and merchandise, or

(5)All such persons who go from person to person, or house to house, or place to place or dealer to dealer, and sell, or offer for sale, the goods, wares, and merchandise which carry with them, and who deliver the same at the time of, or immediately after the sales, or without returning to the place of business operations ( a permanent place of business) between the taking of the orders and the delivery of the goods, wares, and merchandise, or

(6)All persons who go from person to person, house to house, place to place, dealer to dealer, soliciting orders by exhibiting samples, or taking orders, rind thereafter making delivery of the goods, or filling the order without carrying or sending the order to the permanent place of business, and thereafter making delivery of the goods pursuant to the terms of the order, or

(7)All persons who go from person to person, place to place, house to house, dealer to dealer, carrying samples and selling goods from samples and thereafter making delivery without taking and sending an order therefor to a permanent place of business for the filling of the order and delivery of the goode, or the exchange of merchandise having become damaged or unsalable, or the purchase by merchandise of advertising space, or

(8)All persons who have in their possession, or under their conerol, any tangible property offered, or to be offered for sale, or to be delivered, unless the sale or delivery thereof is to be made in pursuance of a bona fide order for goods to be sold cr delivered, said order to be evidenced by an invoice or enmorandum. 277 REGULAR MEETING, OCTOBER 3, 1939

ORDER DEFINED.

An order is, defined as being an agreement in writing between the seller to deliver,

and the buyer to accept merchandise I to be- s611,40and delivered at the prices and in the quantities agreed upon; and said order shall be evidenced b, a memorandum or invoice, accompanying the goods on the day on which the same are to be delivered specifically dewignating and speoifiring the name and address of the seller and the buyer, and the items purchased, sold, and to be delivered, and theprice of each, and the aggregate thereof. The agreement to buy, or accept for delivery, must be entered into before the goods are placed in transit, or delivered, and must be transmitted from the place at which taken to the regular and fixed place of business, before being filled and the goods delivered.

A commonly termed "blanket order" shall not satisfy the conditions cf this definition when such "blanket order" is merely an agreement between the buyer and seller, whereby, the buyer shall take Such quantity of goods as the seller may deliver to his home, his place of business, or to any other place, within a certain period of time. A "blanket order" to satisfy the conditions of this definition must be an agreement in writing, and must recite that the buyer agrees to accept from the seller definite quantities of goods at agree prices, or at prevailing market prices at the time of the delivery of same; and such agreement shall not be subject to change or can- :.("D cellation before its termination, without damages to either of the parties entering into it, and it shall not be a condition of such agreement that goods, delivered in accordance therewith must be paid for on delivery.

EXEMPTION:

rrovided, that this section shall not apply to a natural person, or to any member of his immediate household, going from place to place person, to person, house to house, or dealer to dealer, as aforesaid, and selling or offering to sell dairy, poultry, orchard or farm products raised, producted, or grown in the State of Mississippi, o products preserved, bottled, or canned by himself, or the immediate members of his household; nor to transient vendors, or dealers of bakery products as set out in paragraph (e) of this section, when sold or distributed from a bakery which has paid the privilege tan inposed by this act, to dealers for resale.

provided that no part of this section shall be construed so as to impose any tax or require any duty of travelling salesmen representing jobbers or wholesalers, and who do not carry with them goods for sale, but only take orders for boods and deliver said orders to their employer at a store, or permanent place of business to be filed in the manner usual to the jobbingand wholesale trade.

SECTION 3. Any person violating any of the provisions of this ordinance shall be guilty of a misdemeanor and on conviction shall be fined not more than $100.00 or imprisoned in the county jail for not exceeding 30 days, or by both such fine and imprisonment. Any person failing to pay the privilege taxes imposed by the ordinance, and to obtain a license as herein required, but pursuing the business without procuring such license, may be proceeded against by suit, in addition to being dealt with crim- inally; and the officer required to collect the tax may seize and sell any property of such person liable for such tax and or penalty in the same manner as he may distrain and sell property of other tax payers delinquent for the payment of ad valoreum taxes due on personal property.

SECTION 4. -rill persons liable for privilege taxes who shall fail to procure the license therefor before beginning the business for which a privilege tax is required by this ordinance or who shall fail to renew, during the month in which it is due, the license on a business for which he has theretofore procured a privilege license, shall in each or either of such instance be liable for double the amount of the tax required for such business, and it is hereby made the duty of the collector, whose duty it is to collect the tax and penalty, issue a separate license for the tax, and for the penalty, and to endorse across the face of the license issued as a pentalty the words "collected as Damages"; and eh shall account for all such penalties, as he is required to account for other privilege taxes.

SECTION 5. For goodx and sufficient reasons, the phhlic welfare demanding it, this ordinance be in force and effect from and after its pasage.

The above Ordinance having been first reduced to writing was introduced by Alderman Elliott at the Regular Meeting of the Mayor and Board of Alderemn of the City of Oxford, the same being at 7:30 P.M. in the Mayor and Board of Aldermen Chamber in the City Hall of Oxford, Mississippi, on October 3rd, 1939, and was read and considered by sections and voted on by "yea" and "nay" vote and was then considered as a whole and the following aldermen voting "yea" on each and every section and the ordinance as * whole: Alderman Btanham Hume 278

REGULAR MEETING OCTOBER 3, 1939

Alderman T.E. Avent Alderman W.T. Chandler Alderman B.O. e-lliott Aldegnan SAM

Thbse voting "nay". None.

Having received ixottunanimottsirote of `the Board in favor of said ordinance it was declared duly adopted. * * * * * * * * * * * * * * *

the tax collector brought to the Mayor gnd Boards attention the following Homestead Exemption Tax losses, as reported by G.C. Scutt, Chief of the Homestead Exemption Division of the State Tax Commission; as per their audit made of our Assessment roll for the year 1938:

Errors in totals on pages 1 and 2, showing differences of minus #2100.00, pages 15, plus $1000.00, net decrease of $1100.00 or total tax loss of $12.10.

Branham Hume, page 10, line 5, N.E. Fr. Lot 47, 28-8-3, value $1800.00, tax 14 loss of $19.80, with the following exveption taken to this entry, that, there is no egence dndorsed on the application for homestead exemption on this property that any action was taken by the Board afid Aidermene

Helen Jones, portion Lot 68, (Otford Corp.) 21-8-3, page 13, line 10, exception noted. "No application for Homestead exemption cf thtt property on file", value $250.00, tax loss $2.75.

Jesse and Anderson Barris, Vet. lot 64, (Oxford Corp.)- 21-8-3, value $700.00, tax loss $7.70, exception noted "no application for homestead exemption of this property on file". (entered on tax took page lom line 31.

In the ease of Jesse and Anderson Cook, Fr. not 64, 21-8-3, page 10, line 21, value $700.00, tax loss $7.70, the Board takes objection to the auditor's report in this case, on the grounds that there is on file an application covering the homestead Exemption on this piece of property, properly approved and instructs the Tax 'collector to file objection to report, furnishing an exact copy of the homestead Exemption application as it appears :en the files of the Tax tollector .

In the case of Inelen Jones, the Bot f.d has considered this report, and accepts the notice of adjustment.

In the ease of the notice of adjustment in the errors in the totals in roll on pages Nos. 1, 2 and 15, the Board accepts this report.

In the matter of the application of Brqnham dome, dated October 26, 1938, for Homestead Exemption, on which the Mate Tax Commiecion, Homestead Exemption Division, have taken exception to this entry on the grounds. that there is no evidence endorsed on the application for iiomsestead exemption on this rpoperty that any action was taken by the Board of kldermen I the Mayor and Board of Aldermen of Oxford, .iississippi, finds and adjudicates that said application was at the time required by law, duly approved, but through error same was not so marked, therefore, the same is hereby approved as of the time it was duly and legally approved, and the record wouldhave so shown had it not been for the error before mentioned.

Came on and for consideratien "fire Erevention Week" presented to the. Board by Mr. Harrison, Firechief. After some discussien as to whtt action the Board should take, it was decided to let the matter entirely in the hands of Mr. Harrison.

* I * 47 . *Ifit * 7 7 7

• 281

RECESSED REGUL?R MEETING

OCTOBER 9th, 1939 OXFORD MISSISSIPPI •

The Mayor and Board of Aldermen met pursuant to a Recess Order of October 5th, 1939, at 7:30 P.M. when and where the following were present:

Mayor R.X..Williams, Presiding

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

W.I. Chandler, Alderman -lard 2

B.O. Elliott, Alderman Ward 3

4‘ * * * lc 4 * fi * * * *

C.E. Harrison, Supt. Light and hater Plant L.C. Andrews, Attorney, CG n. C. Bell, Deputy City L'lerk Cit * * * *

After the meeting had been opened according to law, the following business was transacted, to-wit:

4 r. Marvin .-ooley, Jr., appeared before the Board with reference to renting the south half of the Dunn Building to be used for food product manufacture, and in connection with same stated he would require the use of the drive on the south side of building for truck entrance to the building. It was the opinion of the Board that before considering the rental of this build- frig to Dooley, that he ascertain from Mr. Dunn if agreeable with him to rent for the purpose to be used as well as the use of the drive for truck entrance and running truck into said building, and that the Mayor report back to the Board.

Came on and for consideration the adoption of an ordinance to regulate "Milk Production, etc. ", Dr. 3.h. Armstrong, and his assistant "T. l'eith Smith, of the county health Unit, were present and explained to the Board the necessity and rules and regulations of such an Ordinance, answering all questions asked by the Mayor and Board of Aldermen

AN ORDINANCE TO REGULATE THE PRODUCTION, RRANSPaRTATION, PROCESSING, HANDLING, SAMPLING, EXAMINATION, GRADING, LABELING, REGRADING, AND SALE OF MILK AND MILK PRODUCTS: Ti-E INSPECTION OF DAIRY HERDS, DAIRIES, AND MILK PLANT: THE ISSUING AND REVOCATION OF PERMITS TO MILK PRODUCERS AND DISTRI- BUTORS: THE PLACARDING OF RESTAURANTS AND OTHER ESTABLISHMENTS SERVING MILK OR MILK PRODUCTS: AND THE FIXING OF PENALTIES.

Be it ordained by the Mayor and Board of Aldermen of the City of Oxford, Mississippi as follows:

SECTION 1. The production, transportation, processing, handling, sampling, examination, grading, labeling, regarding and sale of all milk and milk products sold for ultimate consumption within the City of Oxford, Mississippi, or its police jurisdiction, the inspection of dairy herds, dairies, and milk plant, the issuing and revocation of permits to milk producers and distri- butors, the placarding of restaurants and other establishments serving milk or milk products, and the fixing of penalties, shall be regulated in accordance with the terms of the 1939 edition of the United States Public 'ealth Service Milk Ordinance, a certified copy of which shall be on file in the office of the city clerk; rrovided, that the blank spaces following the words "city of" in said Public health Service Milk Ordinance shall be understood to refer to the City of Oxford, Mississippi; Provided further, that in Section 7, Item 1-r, of said Public Health Service Milk Ordinance the abortion testing requirements shall be effective within three years after the adoption of this prdinance; rrovided further, that Sections 8, 16 and17 of public "ealth Service Milk Ordinance shall be replaced, respectively, by Sections 2, 3 and

282 RECESSED REGUIAR ivrEETING

OCTOBER 9th, 1939 0:4FORD, MISSISSIPPI

4 below.

SECTION 2. From and after eighteen months from the date on which this ordinance takes effect no milk or milk products shall be sold to the final consulder, or to restaurants, soda fountains, grocery store, or similar establishments except GRADE "A" RAW AIM GRADE "A" PASTEURIZED MILK. This section shall not be construed as forbidding the sale of lower grades of milk and milk products during temporary periods of degrading not exceeding thirty days, or in emergencies such longer period as the health officer may deem necessary.

SECTION 3. Any person, firm, or corporation violating any provision of this ordinance shall upon conviction be punished by a fine not more that. 4100.00 or by imprisonment in the county jail not more than 30 days, or by both such fine and imprisonment.

SECTION 4. All ordinances and parts of ordinances in conflict with this ordinance are hereby repealed; and this ordinance shall take effect frcm and after its adoption and publication.

The above ordinance having been fire+ -educed to writing was introduced by Alderman Hume at the recess meeting of the -Regular Meeting of the Mayor and ' Board of Aldermen of the City of °xford, Mississippi, the same being at 7:30 P.M. in the Mayor and Board of Aldermen Chamber in the City hall of Oxford, Mississippi, on October 9th, 1939, and was read and considered by sections and voted on by "yea" and "ay" vote and was then considered as a whole and the following aldermen present voting "yea" on each and every section and the ordinance as a whole. Alderman Branham Hume Alderman T.E. Avent Alderman B.O. Elliott

Those voting "nay" Alderman W.I. Chandler

having received a majority vote of the Board present in favor of said ordinance it was delcared duly adopted.

Came on and for consideration the matter :f putting on an Argentine Ant Campaign this fall. After the matter had been diecussed, on motion duly made by Alderman Av ent and seconded by Alderman Hume City of Oxford sponsor said campaign through the State Plant Board of iassissippi, the city paying the expense of the poison and cups. Above motion passel.

4, * * F 4 fi

came on and for consideration the matter of putting on a Rat Campaign this fall. After the matter had been considered at some length, on motion duly male by Alder- man Hume and seconded by Alderman Elliott that the city put on said campatkn under the direction of the Bureau of Biologieul Survey, State College, Mississippi. Those voting "yea" on said motion were Aldermen B.O. Elliott, I.E. Avent and Branham Hume. Those voting "nay" were Alderman W.T. Chard&er. Said metier, having received a majority of the votes of the Aldermen present was declared passed.

+ 4 * 4 .7

Came an end for eorsideration e statement, in writing, from 're. W.A. Stinebeck, that on Lc+ 2l-F-3, on -which she was assessed fur the year 1938 with three houses located on said let, that he only had one house on said lot, and asked relief from the Beard en the assessment on the two houses. mcti on duly made by Alderman Avent and Seconded by Alderman Elliott that on account of error in making said assessment that Tax Collector be anthori sod to cancel said assessment. raised.

4. 4 * 4, 283 RECESSED REGULAR MEETIM

OCTOBER 9th, 1939 OXFORD'? MISSISSIPPI

In the matter of deed from "Irs. Minnie Sively conveying to the City the streets in the new "Siveley Sue-Division" and"latdott on said plat, on motion duly made by Alderman Avent and seconded by Alderman Elliott, that the city accept deed to said streets as outlined in said deed same being recorded in the Chancery Clerk's office of Lafayette County, Book #112, page 465.

Came on and for consideration letter from "r. R.H. Gillespie, Supt. of L'xford City Schools, and Board of Trustees, asking that the Mayor and Board of Aldermen consider traffic regulations on the street in front of the Grammar School between the lienry Hotel end the City hall. After some discussion on this matter, on motion duly made by Alderman Avent and seconded by Alderman Elliott that the Board. request the School Board and dr. Gillespie to make some specific recommendations to the Mayor and Board of Aldermen, through the Mayor. Motion carried. krj * * * * * r r * * * * r * * * * * * * *

Came on anfd for consideration request from A.D. Wiley, Principal of Oxford Training School, that the city have installed on pole in rear of said school building a street light, for the protection of the school building at night, etc. Uri motion duly made by Alderman Avent and seconded by Alderman • Chandler that Mr. Harrison be instructed to install said light as promptly as possible. Motion passed.

'4r. Harrison made a report to the Mayor and Board of Aldermen with reference to the cost of installing a water line and sewer line under the Illinois Central Railroad Company's tracks to take care of sewera ge and water from the Stone Property, present residence and the house they have recently moved and remodeling, west of the Illinois Central tracks. On motion duly made by Alderman Avent and seconded by Alderman Chandler that it be recommended that the city make this installation when a WPA rroject could be secured to furnish the labor on said project. Those voting "yea" on said motion were Aldermen T.E. Avent, Branham flume and Alderman W.T. Chandler. Those voting "nay" Alderman hlliott. The majority of Aldermen present 17ving - s voted rt." said motion was declared passed. * * * * * * * * * *

Came on and for consideration request by Dr. E.S. Bramlett that the city install. light line to h: _:(1.6e Iropnrty on the east side of the city where he is building a new barn. "r. harrison's estimate on the cost to the city to run the line south of the cemetery property to the line of said Bramlett property would be approximately $79.00 and the cost to Dr. Bramlett approximately 4;30.00. On motion duly made by Alderman Chandler and seconded by Alderman Hume, that when Br. Btamlett had torn down and removed the old barn located on Washington Avenue end north 11th street, that the city make the necessary installation of light line to his property where the new barn is located. Motion passed.

Came on and for consideration of the side walk located on Mill Street, on motion duly made by alderman hume and seconded by Alderman Elliott, that Mr. Spears be instructed to make temporary repairs on said side walk, without any t extra heavy expense, and if necessary, remove plank that wer dangerous, putting said walk in such shape that it might be used safely until the side walk project had been passed and a concrete walk put down. Motion passed.

284 REGULkh ALEIING

OCTOBila 9th, 1070 uki0AD,

the 7.?t + C.17 the Assessment 0:7 thr Ella Lwsey lot being fraction -ot 0.7, 21-8-3, of 4450.0C for the year 1939, on motion d1y made ly rmar Avent end secor,'ed by 4---'de man .c.me, that or, cur. the real ace havin7 1; , :r red down Cr said. lot some year:, ago, and this only b21.: .1g a vacant lot, that said assessmento be reduced. from 4450.00 to 4100.00 and that the aseessment of 4100.00 he made. to apply on this lot from the year 1932 to 1938 inclusive. ,Libove motion paJsod.

r4 4 r

in the matter of tl- e Z'ora i1oy lot heinr, ir. of P7, 21-9-3., Culdwell';-, parcel sold in tl.c 1334 and :933 taxes, said sale teinr void on account description, and assessed at 490.00 for the years 1935 to 1537 and 4' 1 0.00 for the year 1938 , same hei-c- a vacant ” r 4 that 4- he assessment for the year 1938 be r ,- duced to ,;.100.o3 end r.t said lct also, be back assessed fo- the years 1934, 1935 and 1936 at 4100.0c. On motion duly mado by 1,11era'an Avcnt and seconded by --1,dermar -;-ume that the abelre chan:es be made or. the 1Flore iley act. l'asned.

On motion duly made by 2-ilderman a..d seconded by muon o that the Tax Collector is hereby ihstructed to accept and Iss u e recepts for e'l delinjuent taxes upon payment of all legal fces, damages, interest and taxes due on said property. l'assed.

•

Came on and for consideration the matter of water-light accounts on the colored churches, maeonic ball, end other building-s, used for achool purposes during the time of building of new school building. Cs r.atcn duly made by Aldermen hume and seconded by Aldermn blliett that they begin paying far the l ight and water used n of ...eptembe -r. 1st, 1939(making all bills due October 1st) and that these accounts be handled follcdng the regular prodedure for collect - inc.! accounts and discountiruira7 the service for non-payment of accounts. l'ass;od.

44.4rt rf** ' r

Upon motion. duly made, seconded and passed, it was c , 7-dered that this Board do now recess until oVednesday, October 11th, 1939, at 7:30 .e•I• RECESSED REGULAR MEETIM

OCTOBER llth, 439 OxF ORD? MISSISSIPPI.

The Mayor and Board of Aldermen met pursuant to a Recess Order of October 9th, 1939, at 7:30 P.M. when and where the following were present:

Mayor R.X. Williams, presiding

Branham Hume, 'iderman at large

T.E. Avent, .L1derman Ward 1

fl.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 4 * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk

After the meeting had been opened according to law, the following business was transacted, to-wit:

Motion made by Alderman Hume and seconded by Alderman Elliott that H.C. Bell shall be the clerk of the police court of the city of Oxford, Mississippi, and that Miss Lillian Jones shall be the deputy clerk of the Police court of the City of Oxford, Mississippi, as provided in Section 2538, Mississippi Code of 1930, Above motion unanimously passed. * * * * * * * * * * *

The balance of meeting was devoted to the approval of the assessment roll.

Upon motion duly made, seconded and passed it was ordered that this Board do now recess until October 13th, 1939 at 7 o'clock 1).M.

RECEB6ED MEETING

OCTOBER 13, 1(2)3,3 OXFORI),.

The i.aycr and Board of Aldermen met pursuant to a recess order of October 11th, 1939, at 7 o'clock when and where the following were present.

Mayor R.. Will e, Iresiding

..T. Ohandlor, Alderman 'ard 2

B.O. Elliott, illderman ':iard 3 "aney, Alderman Werd 4

* Ts. 7 77 T, * 4 4t *

H.O. Bell, Leputy Clerk

After the meeting had been opened according to low the folloiLins business was transacted. to-wit:

R.B. Mahaffey of the Commercial 4pea1 of "'emphis appeared before. the Board with reference to the Mayor and Board of Alderman subscribtnsr to a half page advertisement of the Cantenial Edition of Commerical opeal, January 1st, 1940, explaining that he had conoultd Chancellor Lu'ts of the University who agreed to subocribe 0.0C, also, Junior Chamber of Commerce, $50.0C end the Rotary Club 45C.00, provided the city would subscribe $100.30 to make total of 4250.00 for half page advertisement.

On motion duly made by alderman "aney and seconded t, Alderman Chandler that the City of xford subscribed the sum of 47(q...,Of the others mnde their subscription, and further said motion walvet by Llderman Avent and Hume who were not present, makin7 same unanimous. 1,1'70, motion paf.ssed.

4- 4 * 4.4 1 4. • 1 ^ .*••1 Brown and mr. howery appeared before the Board I.Jith reference to the placing of the Cumberland i'resbyterian manse on the tax rolls on account of same not beinr used as a manse, but as rental property. Mr. Brcniin explained to the 2 oard that some years ago the 1*or and Board of Aldermen had taken this property off the tax roll on accont cf the rental ha7ing been applied on the preachers salary and oxperses. r. Lr7wn stated thit this preperty inc 7 uding the chnrch property was not ;.ow used for church puroses, and wel!ll he subject to to taxati on. lnc , stating that they had not had a preacher since April .1;39, and that they had lizeentinued the ue of the ohurch durinir 4 the yc—rC i definite action beine. t', kene this meeting. The Mayor =77estinj that •—me he referred to the altv atterne7 for 1n:%,7

T t I'

Camp and for consideration appeof of 4 h% 4 the City of Oxford d-ed to him t .!-' c' 4 eal being that part of u 4 h l!th ,Ctreat lying east of the I\.E. uarto of Lc 17, in NE4 of NW 4- of section 2?-9-3 commencing et 1-larce street, and riinnin,q. 105' south, said street hsi 5[2.: 30 ' E. Cr. motion duly made by A7dermPn Chandler end by Alderman Ellictt that said dead street be deeded to .6ir. J...z . ork77,.ns, as he already ov:ned thot pnrt of the otreet lyin7 sc.)th ts :1.chanon Avenue. Moticn paced. + 7 ' 4' 77 , t t " meetin7 devoted to tax es.Less-:ent roll for current year 1539. * * - 4 ° 4 .44 ' 1

U:on motion duly made, :c eoe d"d and it :d' red thi Loard do recez T.17. 47 -11 Octo'oer 1(th,!::.t 7;3C 287 RECESSED REGULAR MEETING

OCTOBER 16th, 1939, 7 o'clock P.M.

The ayor and Board of Aldermen met pursuant to a recess order of October 13th, 1939, at 7 o'clock P.M. when and where the following were present:

R.X. Williams, Mayor "residing

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

W.T. Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3

* * * * * * * * * * * * * * * * * *

H.C. Bell, Deputy Clerk

CI After the meeting had been opened according to law, the following business r was had to-wit:

Mr.J.R. Simms, representing the Farmers Warehbuse Company, appeared before the aoard with reference to their Contraet on hay rights on the air-port. Requesting that the Board grant them an additional ten days to cut the hay account of the hay not ripe enough to thresh the seed. The hay not having been cut off the run ways and expected planes in here the latter part of the week for the Ole-Miss Homecoming, it was the opinion that this should be done in order to make it safe for the use of the field. Mr. Simms wanted the 1"eyor and Boare to make a concession in the contract price from $25.00 to $12.50, if he were to cut the hay off the run ways on account of so doing he would lose the seed on that part cut. After considerable discussion there was no action taken by the Board. * * * * * * * * * * 4 * 4 * * *

Came on and for consideration the expiration of the contract for gas, oils, etc for the water and Light and garbage trucks which expires Nov. 1st, 1939. On motion duly made and seconded it was ordered that the city advertise for bids on gas oil and greases for a period of six months.

* * * * * * * * • * * 4 *

Came on and for consideration the matter of installing an additional n street light on South 11th Street near O.D. Courtney's residence. On motion L duly made by Alderman Hume and seconded by Alderman Elliott that an additional street light be installed at this point. Above motion passed. * * * * * * * *

On motion by Alderman iiume and seconded by Alderman Avent, that an ordinance covering street tax on all male person elligible between the ages of 21 years and 50 years be passed. Attorney L.C. kindrews to prepare the ordinance. Motion passed. * * * * * * fi * Balance of meeting devoted to approval of the assessment. 4011. On account of not being able to complete the roll, on motion duly made and seconded and passed, it was ordered. that this Board to now recess until October 17th, 1979, at 7.o'clock P.M. * * * * * * * * * * * * * * *

•;• i 4. F7•y. !Irp 77r, 0; 4 7) -;.urico

•ITcs. aq; L771'.7 o; OACi :;r1f,1 2Thaa .;e) 37:

pcq z:;v: zIcJ. 2 7.13:;;

.4; 4+ 4 k 4,

4 4 4, * - 4-

4- - 4 LJ1177 ":7'1")

2 i"-i ( 44'7'ITT 7 'n'^

•

c Gt4M7t

1.1,7nTAT ' F TM

L '1.14.91 daci,o;o jo aapao :3700.: 7 04 4.uTulcunrT ....zauxaapil.r JO p..i.no7 aQS , az

T-T-T 7-7 -''Tc7 c'TT" Jo Yo L W7CTO nO

'7 77.7' 777 11 77r,c7n77

SSZ

RECESSED REGULAR NEETINa

OCTOBER 18th, 1933 OXFORD, N1361361221

The i.gyor and Board of Aldermen met pursuant to a recess order of °etcher 17th ) 1070 at 7 o'clock when and where the following were present:

R.X. .N:ayor rresiding

Branham Hume, Alderman at large

T.E. Avent, Alderman Ward 1

L.O. Elliott, Alderman "Ward 3

g.6. haney, Aldermar Ward 4

*, * 1 4 fi fi. * ,4

E.C. Bell, Deputy Clerk

Le"J After the meeting had been opened accordin to law, the following business was C"■./ had to-wit:

The Board proceeded to check and approve the assessment roll from where they had stopped the previous night.

4 4 * 4 4 4 t * * 1, *

Came on and for consideration the assessment of the Ritz theater and the Lyric Theater,(i4r. R.X. Williams). After some discussion on thee assessment on motion duly made by Ilderman Avent and seconded by Alderman Elliott that the assessment of 47000.00 against the Ritz Theater be reduced to 46500.00 and that the assessment of 45350.00 against the Lyric Theater(R.X. Williams) be raised to 46530.00. Those votin5! "yea" were Alderman Avent, Elliott and Haney. Those voting "nay" were Alderman Eume. The vote being three to one for,the-=tion, same was passed.

4 4 4 * 4 4 *

Came on and for consideration the personal assessments against the Ritz Theater and Lyric Theater(R.X. Williams). On motion duly made by Alderman Taney and seconded by tlderman Llliott that the assessment of 41000.00 against the Ritz Theater remain the same, and that the assessment of 4550.00 agairst the Lyric Theater(R.X. Williams 1 be raised to 41000.00.

Those voting "yea" were Aldermen Elliott and "aney. Those voting "nay" were Alderman Lume and Avent. The vote being tied at two each, the deciding vote was cast by mayor "rolem W.T. Chandler. his vote being in the negative, the motion failed to carry. * * *

On motion duly made and seconded it was ordered that the assessment on "TS. J.O. Ramey's home be reduced from 44500.00 to 43500.00, and that the marvel Flower Shop be added to her assessment at 41000.00. Above motion carried. * * * 4 * * * 4 *. 4 *

On motion duly made and seconded it was ordered that Fr. Lot 157 be assessed %to Robert Redding at $200.00. Above motion passed. * * * * * * * 4 * * *

Mayor R.X. Williams arrived at this time and Mayor Pro Tem W.T. Chandler ceded the chair to Mayor Williams. * * * * * * * * * * * * * * *

Came on and for consideration the decorations of the city for the Ole-Miss vs Mississippi State Football game on November 25th, 1939. On motion duly made by Alderman Avent and seconded by Alderman hume that the city ask the Junior Chamber of Commerce to appoint a committee to look after the decorations; having Bill Harmon RECESSEL REGULAR iu'ILETiNG

OOIBBER Oth, 1939 OXr Ohl', AtLaoIsSiari

to supervise tha pork; they to ascertain what crepe paper would be needed end the city of Oxford to pay the experses and furnish what labor needed. jaotion uaanimously carried.

=1,

Came or and far doneideratioa complaints of citizens abo t the shrubbery along side walk in front the Oxford. Floral ±lace of business on ''effeaaaa Avenue. On motion duly mode by -1derman Avant and seconded by Alderman Elliott that the Seputy Clerk be instructed to write —r. Smith of the Oxfa-d "lorel Company requesting that he properly prune or trim this shrubberty to where

it will be satisfactory to + !- 0 aer0ral public. Carri0d.

* 4'

Came on and for conaideratiaa letter of "T. "eary Faser with re4aaat that the 1939 assessment on the Sultan 1-eme on ::orth Lamar Avenue be reduced in accordance with price they had offered to take for the entire property, same being in the neighborhood of $7000.30. Cr. motion duly made by Alddrman 1-ume and seconded by Alderman. Elliott that said assessment be lowered from 47200.30 the 193P aaseeament, to 46000.00 for the year 1939, said assessment to include same property as assessed in 1938 and take into consideration that portion sold off during the year 1939 to AT. A.E. Avant, came having been sold after January let, 1939. Motion passed. *

"T. Earrison, through Alderman Hume, brought to the attention of the Board the reported advances to take effect shortly on electric equiptment, and asking the Board whether advisable to purchase supplies needed now and in the immediate future. On motion duly made by Alderman Hume and seconded by Alderman Elliott that i4r. Harrison be instructed tc purchase three transformers and whatever wire in his estimation the city needed to protect against any advance in prices. Motion carried.

Balance of the time was spent in completing and approving the assessments for the year 1939. *

Upon motion duly made, seconded and passed, it was ordered that this Board do now recess until :Monday, October 30 .LT, 1939, et 7:30

4 291 SPECIAL MEETING

OCTOBER 23, 1939 OXFORD, MISS.

TO THE MAYOR A= BOARD OF ALDERMEN OF TOE CITY OF OXFORD, MISSISSIPPI:

Notice is hereby given that a Special Meeting of the Mayor end Boaa of Aldermen of the City of Oxford, Mississtppi, willwill be held in the Mayor and Board of Aldermen Chamber of the City of be said state, at 5 o'clock P.M. on the 23rd day of October, A.D., 1939, for the purpose of adopting an order finding that the tax assessor of the municipality of oxford, Mississippi, has completed the assessment of the personal and real property of said municipality for the year 1939, and said assessment rolls were filed and completed on September 1st, 1939, and that same be approved, with corrections, subject to the rights of parties in interest to be heard on all objections hereafter made by them, and subject to further changes and corrections to be made by the mayor and Board of Aldermen of said municipality as authorized by law, and that said rolls have been equalized as required by law by the Mayor and Board of Aldermen of said municipality, fixing a date for the filing of objections by parties in inetuest to the action of said municipal authorities, and the giving of*Rptice as . reqUired law for the hearing of such objections, this notice to lie given in the manner and for the time required by law, and doing any and alll other things pertaining thereto as required by law.

Dated this the 31st day of Qctober, A.D., 1939 Williams, Mayor, Oxford, Miss.

We Vile undersigend being _all the members of the Bo rd of Aldermen of the City of xford, "issisftppi, -Mereby accept service of the foregoing notice, waiving any and all irregularities in such service and such notice, and consent and agree that said Board of 'ayor and Aldermen shall meet at the time and place therein named, and for the purpose therein stated.

Signed W.T. Chandler, C.S. 'aney T.E. Avent Elliott Branham flume * * * * * * * * * *

ANA ayor Williams being out of the city and 'ayor rro Tem -.T. Chandler not being present, mo meeting was held.

292

24th, 133(2

...L. 4.* a. J. J.11 tJAI J.JU

1,he, . 4Lycr nr-,1 Nctice:ishereby that h A.erti:„c Cir9I isSIjpi,Wt:.1 --card of kil ,,,errr.en cf 0 4 47." Cr cf the City I1of tho •-ayc- r. -1 2 ,-,Lcl of 1.1;3, stLte or. thr- dLy uf -cto:17Fr, that thr., ao'7ecGrof thc fr,7 riri,L„e of arlb.c or 4' 4 ;eroora: f hs, azoecarr.e.1,1 4- : ' 1; real i.iroi,,erty scj ciptIlity for ;,he yr.:' 1;3; , z ,), aL 4 -a7r. r...- 2.1s were c.om,le.t?d ..-_,e1.-,1-77-1cr lot, 133 riFto of i)n-t'os 1L+^^est L.,,,;roved, with the7, TPct f'zrthe,r I o, he 1 , r9 , al' oh 4 te7 1-11-lormer. :.. 4‘ raid CJ' , C t e Ly tl.e :cf us al -,.+ 1; ,- 7“,z,r.-4 1-,y , that osi-1 rsI - ave :f zu 4, ty, or ly law the ...1yLr a Loa-1 „f toro:„ -tc th.7, siatts fcr tho 11--. -

4", CS Ci'itki'Vt.rt/Ear, et 0. 6 fettr:,,:vrit Iff'= t hi not 1.e to 1.5 the y f`r7 tari of UC PC+.1CS5 , :`-.r'r nr.fl f'7 7.1' required by„14.i., '

the 24+' of c-^ -- l- er- • •

hay,17, ay„r -ro City

L ' :%e.r.-..ro: of "th of .,,.1.er71(7,:, ., of th(T. of tfo.7 City of ' jxfo---", 1.1crelo: orvir rc47?e, wsivisr Ls'' aLl =7t. Lod ..-7‘ that. 7:1 LJL. ,f .":..1!4,!7!7"7:Pr there! for the thor-ir.

Avnnt

' '''T* "` ar.oh_c t imp 2 , t r f % •,..-jTe -b- - 2,1 t t

A - 07' '"t , L C

-1- 4 1- * "

11,e -a;:or 1.4;a_.Y.',. of 44.1or::..c:., 1; -„ ..00:,t to th.7, at„,Te of

.yrcocr.t:.

'6.1. CI .a. 111'",

After the metia.7 t :

'7,oy caL.c to o h.; C :ooard of tho, ,,:attor the. of th~ "of 1")?i aaoeco=t aL,77. no-al .„,:.,1..crty for iLi„ -ayor of li..11cr. 41- L4 K 293

SPECIAL METING, OCTOBER 24th, 1939

Tax Collector or assessor of said municipality has completed the assessment of the personal and real property for said year; that the said tax collector or assessor filed the said rolls with said mayor and Board of Aldermen or. the 1st day of September, A.D., 1939, as provided by law, and that said tax collector or assessor made an:affidavit and appended same to said rolls; that said affidavit showed that he had faithfully endeavored to ascertain and assess all persons and property in said municipality of Oxford, Lafayette County, said state; that he did not omit any person or property and did not place upon or accept an undervaluation of any property through fear, favor or partiality; that said assessor or tax collector required every tax payer to make the oath required to be taken by persons render- -ing a list of his taxable prcperty4 wherever possible; that the said tax collector or assessor filed with the rolls under oath a list showing the names of every tax payer, who failed or refused to make oath to hih tax list; that this Mayor and Board of Aldermen immediately at a recess meetinf of :ts regular October, 1939, meeting, proceeded to equalize the said rolls, and have completed such equalization at least 10 days before the time hereinafter set for hearing objections; that the tax collector or assessor attended all meetings, rendering what assistance he could to said Mayor end Board of Aldermen in the performance of their duties, and that he did all the law required of him as such officer; It is, therefore, ordered by the Mayor and Board of Aldermen of City of Oxford, said county and state, that said assessment rolls, and thea e and they.are,hereby. approved, with correctio es in interest ;o be heard on all objections *e t to further changes and corrections by thisliae:y thorized by law.

'tP It is further Orueired by thiS mayor and Board of Aldermen that a notice be posted at the court house of LafaYette County, said state, in L'xford, said county and state, and be published in Oxfo_d Eagle, a newspaper published in Oxford, Mississippi, notifying the public and the tax payers of said municipality:

1. That the said assessment rolls so equalized are ready for inspection and examination.

2. This Mayor and Board of Aldermen will be in session for the purpose of hearing objections to the said aseesanents which may be filed, at the City Hall, in the Mayor and Board of Aldermen's chamber thereof, on the 7th day of November, 1939, at 7:30 P.M., same to be filed on or before said date, and this Mayor and Board of Aldermen will remain in session from day to day until all objections, alwfully filed, shall have been disposed of, and all proper corrections are made in the said rolls. It is further ordered that the notice shall be given to the public and the tax payarsm of said Oxford, said County and state, in thef following form to-wit:

TO THE PUBLIC AND TO THE TAX PAYERS OF OXFORD, lAFAYETTE COUNTY, MISS. You are hereby hotified that the personal property assessment roll, and the real property assessment roll of the above named Oxford, for the year 1939, have been equalized according to law, and that said rolls are ready for inspection and examination, and that any objections to said rolls, or any assessment therein contained, shall be made in writing and filed with the Clerk of the Mayor and Board of Aldermen of Oxford, Lafayette County, 'Mississippi, on or before the 7th day ',of November, A.D., 1939, at his office in the City Hall of Lixford, county and state aforesaid, and that all assessments to which no objections are then and there made, will be finally approved by said "ayor and Board of Aldermen, and that all assessments to which objections are made, and which may be corrected and properly determined by said Mayor and Board of Aldermen, will be made final by said Mayor and Board of Aldermen, and that said rolls and assessments contained therein will be approved by said Mayor and Board of Aldermen; and that, 1. This Mayor and Board of Aldermen will be in session, for the purpose of hearing objections to the said assessments which may be filed, at the City 411, in the "Jayor and Board of Aldermen's Chamber therein, in the City of' Oxford, county and state aforesaid, at 7 ;30 P.A. on the 7th day of November, A.D. 1939, and,

2. This 'Ivor and Board of Aldermen will remain in session from day to day until all objections, alwfully filed, shall have been disposed of and all proper corrections made in the said rolls.

Witness the signature of said Mayor and Board of Aldermen this the 25th day of October, A.D., 1939. 294

SPECIAL MEETING, OCTOBER 24th, 1939

The i4ayor and Board of aldermen of the City of Oxford, "lssissipppi

By R.X. William:: Mayor

B.O. Elliott, Clerk ri.C. Bell, Deputy Clerk

Upon motion duly made, seconded and passed, it was ordered that this Board do now adjourn sine die.

w:e,449:44.1.1, Mayor, city of Oxford, Miss. Clerk, City of Oxford, "iss. 295

ED REGULAR =TIM 0Ofeber 30, 1939 OXFORD, MISS.

The Mayor and Board of Aldermen met pursuant to a Recess Order of October 18th, 1939, at 7:30 o'clock P.M., when and where the following were present:

Mayor R.x. ailliams Presiding Branham Hume, Alderman at large T.B. Arent, alderman Ward 1 W.T.Chandler, Alderman Ward 2 B.O. Elliott, Alderman Ward 3 C.S. Haney, Aldermen Ward 4 * * * * * * * * * * * * * * * * * * * * * *

trJ A.G. Bell, Deputy Clerk L1-4 L.G. Andrews, Attorney

After tb Meeting had been opened according to law, the following business was had to-wit: In respOnae to the advertisement appearing in the Oxford Eagle under dates of October 5th, 1, 19th and 26th, asking for bids on materials to be furnished the City of oxford, the following'bids were received, opened and read to the Mayor and Board of Aldermen: J.M. Fuller, Abbeville, Miss. RFD 2, lumber Porter Hardware Company, Oxford, Miss, on lumber Berl Thrweatt, Water valley, Miss., on lumber Eugene L. Fair, Oxford, Miss., on lumber J.B. Hartley a:T.D. MaMeely, Oxford, Miss., on lumber H.W.:Metts, Oxford, Miss. on lumber Hughes Hardware Company, Oxford, Miss on cement & nails. Patton-Courtney Hardware Go.,Co., xford, on cement, nails and oakum Cokumbus Brick. Company, Mississippi, brick and cement Southern Brick Company, Pontotoc, Miss., brick R.E. Fudge, Oxford, Miss., sand and gravel Fischer Lime and Cement Company, %aphis, Tenn. manhole rings & Covers. Mississippi Foundry do hachine Co., Jackson, Miss., Manhole rings & covers. The bid of the Southern Brick COmpany, Pontotoc, Mississippi of 4410.130per M delivered by truck direct to job, if reasonable ingress and egress is provided, being the lowest bid, on motion duly made by Alderman Arent and seconded by Alder- man Elliott that the southern Brickompany of Pontotoc, Mississippi, be given the order for the 80,000 brick as aft rtised. The above Motion was passed. (le The bid of the Patton-Courtney Hardware Company on Portland Cement i ciplapea rd sacks, F.O.B. cars, Oxford, miss., pit, per barrel and Masonry cement in paper sacks, F.O.B. care-Oxford, Miss., #1. per barrel, All bids are net payable in 30 days from date of invoice. For payment within 15 days from date of invoice we will allow a discount of ($110) ten cents per barrel, as this is the manufacturers discount ho us; said bid being the lcrest bid received, on motion duly made by Alderman Hums and seconded.by Alderman Haney that the Patton-Courtney Hardware Company be awarded the contract on th Portland cement, the use of any of the Masonry cement being subject to the approval of the Building Inspector, Mr. C.B. Ha rrison. Above motion was unanimous iy passed. * * * * * * * * * * * * * * * * * * *

The bid of the Patton-Courtney Hardware Company on the five kegs of nails at $3.75 per keg, being the lowest bid received, on motion duly made by Alderman Hume and seconded by Alderman Elliott that the contract be awarded to the Patton- Courtney Hardware Company. Above motion unanimously' passed. RECESSED REGULAR MEETING

OXFORD, MISS. OCTOBER 30, 1939

The bid of Earl Thrweattt Water Valley, Miss., on the oak lumber of $16.75 per M. feet, delivered oxford, miss. being the lowest; his bid, specifying that in the 1" lumber and-2" lumber, that 8' lengths and 8" widths would predominate be awarded the contract,providing his lumber came up to specifications, but if not that the contract be-awarded to B.W• Matta, Oxford, Miss., on his bed tit ,$1.850 per M.ft. the net lowest bid. Said motion being duly made by Alderman Avant and seconded by Alderman'Elliott4 Motion passed. ,/- Afierithelabova ibtafaithed beWpisited a diacdsdiOn'"came up as to what re-sale value the lumbet in 8' lengths would have after the city were through with it. It appearing that the lengths that would be furnished by Mr. Matta would run heavy to 16 feet, which would be the proper length for btidge lumber and more adaptable for other uses than the 8' lengths, thus giving the city a better chance realize more out of the lumber on a re-sale. On motion made by Alderman Avent and seconded by Alderman Elliott that their motion awarding the contract to Mr. Thrweatt be rescinded. Above motion passed. * * * * * * * * * * * * *. * * * * * *

On motion duly made by Alderman Arent and seconded by Aldermen Chandler that the contract on the oak lumber be awarded to H.W. Matta on his bid ofW,V)per M. feet delivered, Yxford, Mississippi, Above motion carried. * * * * * * * * * * * * * * * * * *

In the matter of using any of the Masonry Cement in the manhole construction, on motion duly made by Alderman Hume and seconded by Alderman Elliott that same be left to the approval of Building Inspector, C.E. Harrison. Motion passed. * * * * * * * * * * * * * * * * * *

The Patton-Courtney Hardware Company's bid on Plumbers Rope Oakum of $ 100# at412.50, being the only bid submitted on this item, on motion duly made by Alder- man Hume and secondea by Alderman Elliott that they be awarded the contract on some. Motion carried, * * * * * * * * * * * * * *

The FIscher Lime and Cement Company's bid of $9.80 each, F.O.B. Oxford, Miss., being the lowest bid received on the 46 sets of manhole rings and covers, on motion duly made by Alderman BUme and seconded by Alderman Haney that they be awarded the contract on same. Motion passed. * * * * * * * * * * * * *

Alderman Avant was called to his store at this time. * * * * * * * * * * * * *

Came on and for consideration the bids on sand and gravel. On-motion duly made by Alderman Chandler and seconded by Alderman Hume that the bid-on , same be left open until - a later date. Motion carried. * * * * * * * * * * * * * * *

Came on and for consideration the matter of• hamburger beef for the making Of the rat patron. On motion duly made by Alderman Hume and seconded by Alderman haney that same be purchased' from B.K. Collins Grocery Company at price of 13*¢ per pound. The required amount being 300#. Unanimously passed. r* * * * * * * * * * * * * * *

Mr. Avent returned at this time. * * * * * * * * * * * * * * 29'7 RECESSED REGULAR MEETING OXFORD,- lassissIPPi OCTOBER 30, 1939

Came on and for consideration l e amount of salary or wages to be paid the man in charge-of working prisoners n the streets. On motion duly made by Alderman Haney and seconded by Alderman Dime that this man be allowed $2.50 per day. Unanimously passed. * * * * *I * * * * * * * *

Came mend for consideration he matter of allowing prisoners working out fines a pert of their weeks wag s up to $2.00 per week where they had worked a full week, and did not stay in ja 1, also, the question of whether to allow thalami Who did stay in jail to dr any pairt of their weeks wages. After some discussion oh this subject, onnotion duly made by Alderman Him and seddieed by Alderman Avent that( noii. lowence be made; but the full amount timerWerkeCbe applied on thiser'fin s and that all nonworking out fines be confined II the county Sall unti their fines had been worked out or paid. Motion passed. * * * * * * * * * * * * * * Lt"D Came on and for consideration the matter of hiring an architect to prepare WPA project on airport. On motion duly made by Alderman Aventand seconded by Alderman Chandler that Mr. W.E. Hallett, Jr., of Jackson, Mississippi, be am. ployed as architect and engineer to ,prepare the WPA Project for the Oxford Airport at a-sum not to exceed $160400. Motion passed. * * * * * * *!* * * * *

On motion duly made by Alderman Avant and seconded by Alderman Hume that the Mayor and Deputy Clerk sign the agreement for the city of Oxford between said city and the Illinois Central Railroad Company, dated October 16th, 1939, for the construction and maintainance of a 4-inch cast iron sewer line and 1-inch water line.et-least 4 feet under their tracks at mile ,post 571, plue2747 felt, Oxfort,-HassiOsOPi, and all liability to be assumed-by the City of Oxford, Mississippi, Unanimously passed. * * * * * * * * * * * * * * * *

Cams on and for consideration matter of putting on duty extra or special police for the night of 31st, being Halloween night. On motion duly made by Alderman same and seco ed by Alderman Elliott that Mr. Noel, matahallw be instructed to employ extra men WtMie cessary to handle the situation. Jiotion passed. * * * * * * * * * * * * * * *

In the matter of unassessed and improperly assessed property, on motion duly made by Alderman Avent and seconded by Alderman Elliott that Mr. W.T. handler Imp employed by the City to Check up on these taxes and report to the Tax Collector. Motion passed. . * * * * * * * * * * * * * * * * * *

Onmotion.duly made, seconded and passed, it was ordered that this Board do now recess until 7:30 P.M. on NOvatber 7th, 1939, Ihusday. r

298

RECESSED REGULAR MEETING.

November 7, 1939 Oxford, Miss. The Mayor and Board of Aldermen met pursuant to a Recess Order of October 30th. 1939 at 7:30 o'clock P. M., when and where the following were present:

Mayor, R. X. Williams, Presiding/ Branham Hume, Alderman at Large' T.E.Avent, Alderman Ward 1./ W. T. Chandler,Alderman Ward 2. 1 B.O.Elliott, Alderman Ward 3. 1 C.S. Haney, Alderman Ward 4. 1 ******************************************

H. C. Bell, Deputy Clerk./ L.C. ANdrews, City Attorney/ Harrison, Supt. W&L Depti

After the meeting had been opened according to law, the following business was had to-wit:

The minutes of Regular meeting of October 3rd. Recessed Regular meetings. - of October 5th. Oct. 9th. Ott, 11th. Oct. 13th. Oct. 16th. Oct. 17th. and Oct. 18th 1939, werWead 1 0#################### and on motion and-bOth of Aldermen Hume and seconed by Alderman Haney that motion made under date of October 11th. 1939, being on page 285, Minute Book 10, making H. C. Bell, clerk and Miss. Lillian Tones, Deputy Clerk of the Police Court be rescinded until advised by the Attorney General as to the legality of making said appointments. Carried. On reotion duly made andseconded that the minutes be hereby approved and adopted. carried.

Upon mDtion duly made, seconded and passed, it was ordered that this Board do now adjourn sine die.

X Wait-to:f-f-i-c- Mayor