PCBP2 monoclonal antibody (M07), clone 5F12

Catalog # : H00005094-M07 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: PCBP2.

Immunogen: PCBP2 (AAH01155, 1 a.a. ~ 362 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE GNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVV enlarge PASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSII Western Blot (Transfected ECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP lysate) HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMT HGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAK INEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGG MGSS

Host: Mouse enlarge Reactivity: Human Western Blot (Recombinant Isotype: IgG2a Kappa protein)

Quality Control Antibody Reactive Against Recombinant Protein. Immunofluorescence Testing:

enlarge

Immunohistochemistry (Formalin/PFA-fixed paraffin- embedded sections)

Western Blot detection against Immunogen (65.56 KDa) .

Storage Buffer: In 1x PBS, pH 7.4 enlarge Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: Sandwich ELISA (Recombinant protein) MSDS: Download

Interspecies Mouse (100); Rat (99) Antigen Sequence: enlarge Datasheet: Download ELISA

Publication Reference RNAi Knockdown (Antibody validated) 1. PCBP2 Is Downregulated in Degenerating Neurons and Rarely Observed in TDP-43- Page 1 of 5 2021/6/19 Positive Inclusions in Sporadic Amyotrophic Lateral Sclerosis. Motoi Yoshimura, Hiroyuki Honda, Naokazu Sasagasako, Shinichiro Mori, Hideomi Hamasaki, Satoshi O Suzuki, Takashi Ishii, Toshiharu Ninomiya, Jun-Ichi Kira, Toru Iwaki.J Neuropathol Exp Neurol. 2021 Feb 22;80(3):220-228. doi: 10.1093/jnen/nlaa148. 2. A Network of RNA-binding Proteins Controls Translation Efficiency to Activate Anaerobic Metabolism. enlarge J J David Ho, Nathan C Balukoff, Phaedra R Theodoridis, Miling Wang, Jonathan R Krieger, Jonathan H Schatz, Stephen Lee.Nat Commun. 2020 May 29;11(1):2677. doi: 10.1038/s41467-020-16504-1. 3. Flavivirus Infection Uncouples Translation Suppression from Cellular Stress Responses. Roth H, Magg V, Uch F, Mutz P, Klein P, Haneke K, Lohmann V, Bartenschlager R, Fackler OT, Locker N, Stoecklin G, Ruggieri A.MBio. 2017 Jan 10;8(1). pii: e02150-16. doi: 10.1128/mBio.02150-16. 4. Iron Export through the Transporter Ferroportin 1 Is Modulated by the Iron Chaperone PCBP2. Yanatori I, Richardson DR, Imada K, Kishi F.J Biol Chem. 2016 Aug 12;291(33):17303- 18. 5. Poly(rC)-Binding Protein 2 Regulates Hippo Signaling To Control Growth in Breast Epithelial Cells. Li F, Bullough KZ, Vashisht AA, Wohlschlegel JA, Philpott CC.Mol Cell Biol. 2016 Jul 29;36(16):2121-31. doi: 10.1128/MCB.00104-16. Print 2016 Aug 15. Epub 2016 May 23. 6. hnRNP L and NF90 interact with hepatitis C virus 5' terminal untranslated RNA and promote efficient replication. Li Y, Masaki T, Shimakami T, Lemon SMJ Virol. 2014 Apr 9. 7. Selenite targets eIF4E-binding protein-1 to inhibit translation initiation and induce the assembly of non-canonical stress granules. Fujimura K, Sasaki AT, Anderson P.Nucleic Acids Res. 2012 Jun 20. 8. Poly(C)-binding protein 2 Interacts with sequences Required for Viral Replication in HCV 5' UTR and Directs HCV RNA Replication through Circularizing the Viral Genome. Wang L, Jeng KS, Lai MM.J Virol. 2011 Jun 1. [Epub ahead of print] 9. Identification of RNA Helicase A (RHA) as a New Host Factor in the Replication Cycle of Foot-and-Mouth Disease Virus. Lawrence P, Rieder E.J Virol. 2009 Nov;83(21):11356-66. Epub 2009 Aug 26. 10.Selective localization of PCBP2 to cytoplasmic processing bodies. Fujimura K, Katahira J, Kano F, Yoneda Y, Murata M.Biochim Biophys Acta. 2009 May;1793(5):878-87. Epub 2009 Feb 20. 11.Rapid Changes of mRNA-binding Protein Levels following Glucose and 3-Isobutyl-1- methylxanthine Stimulation of Insulinoma INS-1 Cells Sus C, Czupalla C, Winter C, Pursche T, Knoch KP, Schroeder M, Hoflack B, Solimena M.Mol Cell Proteomics. 2009 Mar;8(3):393-408. Epub 2008 Oct 14. 12.A link between SIN1 (MAPKAP1) and poly(rC) binding protein 2 (PCBP2) in counteracting environmental stress. Ghosh D, Srivastava GP, Xu D, Schulz LC, Roberts RM.Proc Natl Acad Sci U S A. 2008 Aug 19;105(33):11673-8. Epub 2008 Aug 7. 13.Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules and processing bodies. Fujimura K, Kano F, Murata M.RNA. 2008 Mar;14(3):425-31. Epub 2008 Jan 3.

Applications

Western Blot (Cell lysate)

Page 2 of 5 2021/6/19 PCBP2 monoclonal antibody (M07), clone 5F12 Western Blot analysis of PCBP2 expression in K-562 ( Cat # L009V1 ). Protocol Download

Western Blot (Transfected lysate)

Western Blot analysis of PCBP2 expression in transfected 293T cell line by PCBP2 monoclonal antibody (M07), clone 5F12.

Lane 1: PCBP2 transfected lysate(38.7 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Immunofluorescence

enlarge this image Immunofluorescence of monoclonal antibody to PCBP2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Page 3 of 5 2021/6/19 enlarge this image Immunoperoxidase of monoclonal antibody to PCBP2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] Protocol Download

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged PCBP2 is approximately 0.1ng/ml as a capture antibody. Protocol Download

ELISA

RNAi Knockdown (Antibody validated)

Western blot analysis of PCBP2 over-expressed 293 cell line, cotransfected with PCBP2 Validated Chimera RNAi ( Cat # H00005094-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCBP2 monoclonal antibody (M07), clone 5F12 (Cat # H00005094-M07 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. Protocol Download

Gene Information

Entrez GeneID: 5094

GeneBank BC001155 Accession#:

Protein AAH01155 Accession#:

Gene Name: PCBP2 Page 4 of 5 2021/6/19 Gene Alias: HNRPE2,MGC110998,hnRNP-E2

Gene poly(rC) binding protein 2 Description:

Omim ID: 601210

Gene Ontology: Hyperlink

Gene Summary: The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other alpha-CP2,heterogenous nuclear ribonucleoprotein E2 Designations:

服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2021 亞諾法生技股份有限公司 Abnova Corporation. 版權所有.

Page 5 of 5 2021/6/19