HOXD1 antibody - C-terminal region (ARP32644_P050) Data Sheet
Product Number ARP32644_P050 Product Name HOXD1 antibody - C-terminal region (ARP32644_P050) Size 50ug Gene Symbol HOXD1 Alias Symbols HOX4; HOX4G; Hox-4.7 Nucleotide Accession# NM_024501 Protein Size (# AA) 328 amino acids Molecular Weight 34kDa Product Format Lyophilized powder NCBI Gene Id 3231 Host Rabbit Clonality Polyclonal Official Gene Full Name Homeobox D1 Gene Family HOXL This is a rabbit polyclonal antibody against HOXD1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ Target Reference Kosaki,K., (2002) Teratology 65 (2), 50-62 HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior- posterior (a-p) limb axis.This gene is a member of the Antp homeobox family and encodes a protein with a Description of Target homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. Partner Proteins MAFF, MAFG, MEIS1, MAF, MAFB, MAFF, MAFG, MAFK Reconstitution and Add 50 ul of distilled water. Final anti-HOXD1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-HOXD1 antibody is Catalog # AAP32644 (Previous Catalog # AAPP03654) Immunogen The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the C terminal of human HOXD1 Swissprot Id Q9GZZ0 Protein Name Homeobox protein Hox-D1 Protein Accession # NP_078777 Purification Affinity Purified Species Reactivity Rat, Dog, Mouse, Human, Rabbit, Guinea pig, Horse, Zebrafish, Bovine Application WB Predicted Homology Based on Immunogen Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 90%; Bovine: 90%; Zebrafish: 90% Sequence
Human Liver WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver
Image 1
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.