TABLE OF CONTENTS INTRO Defensive Records ...... 100 Quick Facts ...... 2 Bulldog Stadium Records ...... 101-102 Team Information ...... 3 Year-By-Year Results ...... 103-111 Bulldog Stadium ...... 4-5 Bulldogs in Overtime Games ...... 112 Season Outlook ...... 6-9 Year-by-Year Mountain West Standings ...... 113 Roster ...... 10-11 Bulldogs in the Top 25/vs. Top 25...... 114 Coaching Staff ...... 11 All-Time Series Records ...... 115-118 Pronunciation Guide ...... 11 Other Series Records ...... 118-119 Geographical Roster ...... 12 Coaching Records ...... 120-121 Preseason Depth Chart ...... 13 All-Time Assistant Coaches...... 121 2017 Schedule/Future Schedules ...... 14 Conference Titles ...... 121 All-Time Letterwinners ...... 122-125 COACHES AND STAFF Retired Numbers ...... 126-127 Head Coach Jeff Tedford ...... 15-18 All-Americans ...... 128 Offensive Coordinator Kalen DeBoer ...... 19 Postseason All-Star Games ...... 129 Defensive Coordinator Orlondo Steinauer ...... 20 Honors & Awards ...... 130 Assistant Coaches/Support ...... 21-30 All-Conference Selections ...... 131-133 Academic Awards ...... 134 PLAYERS Bulldogs in the NFL Draft ...... 135 Returning Players ...... 31-53 Bulldogs in the NFL ...... 136-138 Newcomers ...... 54-60 Bulldogs in the Super Bowl ...... 139 National TV Appearances ...... 140 2016 REVIEW Fresno State Bowl Games ...... 141-164 2016 Statistics ...... 61-69 Bowl Game Records ...... 165-166 2016 Game Recaps ...... 70-75 OUTRO RECORDS & HISTORY 2017 Opponents ...... 167-169 Team Records ...... 76-77 Media Information ...... 170-171 Annual Statistic Leaders ...... 78-80 Administration ...... 172 Chronological Lists ...... 81-85 Mountain West...... 173-176 Select Circles ...... 86-87 2017 Mountain West Bowl Games ...... 176 Rushing Records ...... 88-89 Top 50 Single-Game Rushing Bests ...... 89 CREDITS 1,000-Yard Rushers ...... 90-91 The 2017 Fresno State football media guide is a product of the Top 50 Single-Game Passing Bests ...... 92 )UHVQR 6WDWH $WKOHWLF &RPPXQLFDWLRQV RIÀFH :ULWWHQ HGLWHG DQG Passing Records ...... 92-93 designed by Matt Burkholder and Josh Mitchell. Front and back 3,000-Yard Passers ...... 94 covers by Todd Graves; front and back inside covers by Keith Receiving Records ...... 95-96 Kountz. Additional editorial assistance from Travis Blanshan. Photos Top 50 Single-Game Receiving Bests ...... 96 by Keith Kountz, Rick Dodd, Cary Edmondson, Jeremy Cloud, Kiel 1,000-Yard Receiving Records...... 97 Maddox, David Menendian, the Associated Press, USA TODAY Total Offense & All-Purpose Records ...... 98 Sports and the Fresno State archives. Printing by the Fresno State Individual Scoring & Special Teams Records ...... 99 Campus Print Shop.
BULLDOG SPORTS NETWORK “V” is for Valley Fresno State prides itself on being the “Valley’s team.” 940 AM ESPN Radio is the home of the Bulldog This pride can be seen in the form of a large green Sports Network. Fresno State football games V on the back of the Bulldog helmets, as a symbol to are broadcast live on ESPN’s 50,000-watt signal, the agricultural community of the Central Valley of California. The San Joaquin Valley is the world’s richest allowing fans from all over the Valley to listen to agricultural area in export dollars. Fresno State football games. )UHVQR6WDWH,GHQWLÀFDWLRQ 3DXO /RHIÁHU LV WKH 9RLFH RI %XOOGRJ IRRWEDOO The University’s formal name is Fresno State, not Cal and will be joined in 2017 by former Bulldog State University, Fresno and not Fresno State University. 3DXO/RHIÁHU head coach Pat Hill (analyst) and former NFL and Fresno St. is the acceptable shorter, less formal name for Bulldog defensive back Cameron Worrell (sideline WKH8QLYHUVLW\DQGLVDFFHSWDEOHDVDÀUVWWH[WUHIHUHQFH reporter) for all Bulldog football games. as well as subsequent references.
Station Frequency The University prefers to never be referenced as just Fresno, only Fresno State or ESPN Radio 940 AM Fresno St. For graphics or abbreviations, we ask that you please use FS - not FSU, ESPN Deportes 1600 AM CSUF or Fresno. Another acceptable abbreviation is Fresno St. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 1 FRESNO STATE AT A GLANCE... 2017 QUICK FACTS GENERAL INFORMATION: COACHING STAFF: Location ...... Fresno, Calif. +HDG&RDFK Founded ...... 1911 Jeff Tedford (Fresno State, 1992) Enrollment ...... 24,500 Career Record (Years) ...... 82-57 (11) President ...... Dr. Joseph I. Castro Record at Fresno State (Years) ...... First Year Director of Athletics ...... Jim Bartko Offensive Coordinator Faculty Athletic Rep(s) ...... Dr. Dawn Lewis Kalen DeBoer (Sioux Falls, 1998) ...... Dr. Juan Carlos Gonzalez Defensive Coordinator Senior Woman Administrator ...... Carrie Coll Orlondo Steinauer (Western Washington, 1996) Colors ...... Red and Blue Defensive Line Nickname ...... Bulldogs Jamar Cain (New Mexico State, 2002) Conference ...... Mountain West 5XQQLQJ%DFNV6SHFLDO7HDPV&RRUGLQDWRU Jamie Christian (Central Washington, 1999) TEAM HISTORY: Offensive Line First Year of Football ...... 1921 Ryan Grubb (Buena Vista, 1999) Seasons ...... 95 :LGH5HFHLYHUV All-Time Record ...... 588-419-27 (.569) Kirby Moore (Boise State, 2012) All-Time Home Record ...... 369-173-14 (.664) 7LJKW(QGV All-Time Away Record ...... 208-229-13 (.462) Scott Thompson (Fresno State, 2010) All-Time Neutral Record (not including bowl games) ...... 0-2 (.000) /LQHEDFNHUV All-Time Bowl Record ...... 11-15 (.423) Bert Watts (California, 2003) 'HIHQVLYH%DFNV All-Time Mountain West Games Only ...... 21-19 (.525) J.D. Williams (Fresno State, 1997) Conference Championships ...... 27 Offensive Analyst Last Conference Championship ...... 2013-Mountain West Brad Vonnahme (Utah State, 2011) 6SHFLDO7HDPV4XDOLW\&RQWURO$VVLVWDQW Bowl Appearances...... 26 Lucus Gingold (California, 2014) Last Bowl ...... 2014-Hawai‘i Bowl Graduate Assistants (Offense) All-America Selections ...... 117 D.J. Harper (Boise State, 2012)| Dylan Chmura (Michigan State, 2017) First-Team All-Americans...... 18 Graduate Assistants (Defense) Matt Lea (UNLV, 2016) | C.J. McGorisk (Michigan, 2016) STADIUM INFORMATION: +HDG6WUHQJWK &RQGLWLRQLQJ&RDFK)RRWEDOO Name ...... Bulldog Stadium (41,031) Andy Ward (Cal State Stanislaus, 2009) Surface ...... FieldTurf 'LUHFWRURI )RRWEDOO2SHUDWLRQV Completed ...... 1980 (Beginning 37th Full Season) Brian Wilkinson (California Coast University, 2016) First Game ...... Nov. 25, 1980 vs. Montana State 'LUHFWRURI 3OD\HU3HUVRQQHO Record in Stadium ...... 168-54-2 (.750) Spencer Harris (Washington, 2015) Largest Crowd ...... 42,881 (5x in 2001) $VVLVWDQW'LUHFWRURI 3OD\HU3HUVRQQHO Number of 40,000-plus crowds ...... 33 Quinn Tedford (California, 2015) Last 40,000-plus crowd ...... 9/13/14 vs. Nebraska (41,031) 'LUHFWRURI 2Q&DPSXV5HFUXLWLQJ Press Box Phone ...... (559) 278-5959 Josh Harper (Fresno State, 2014)
TEAM INFORMATION: ATHLETIC COMMUNICATIONS: 2016 Overall Record ...... 1-11 Director of Communications/FB Contact ...... Matt Burkholder 2016 Mountain West Record (Finish) ...... 0-8 (6th, west division) Email ...... [email protected] 2016 Bowl ...... Did not qualify Mobile ...... 559-862-3771 2IÀFH ...... 559-278-6186 2016 Final Ranking ...... Unranked Address ...... 5305 N. Campus Drive NG 27 Starters Returning/Lost ...... 18/7 ...... Fresno, CA 93740 Offense: 10/1 | Defense: 6/5 | Special Teams: 2/1 Website ...... gobulldogs.com Lettermen Returning/Lost ...... 39/19 Offense: 18/6 | Defense: 18/11 | Special Teams: 3/2 IMPORTANT PHONE NUMBERS: Base Offense ...... Pro-Style Athletic Department Phone ...... 559-278-2643 Base Defense ...... 4-3 7LFNHW2IÀFH ...... 559-278-3647 )RRWEDOO2IÀFHV ...... 559-278-3015 SOCIAL MEDIA: FOOTBALL OFFICE ADDRESS: Twitter ...... @FresnoStateFB Address ...... 1620 E. Bulldog Lane Instagram ...... @Fresno_State_Football ...... Fresno, CA 93740 Facebook ...... facebook.com/fresnostateathletics Snapchat ...... fsathletics
2 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE FRESNO STATE AT A GLANCE...
STARTERS RETURNING (18) STARTERS LOST (7) Active Career Starts Leaders (Offense) OFFENSE (10) OFFENSE (1) Career ’16 Consec. Chason Virgil, QB, 6-1, 190, So. Aaron Peck, WR Aaron Mitchell 24 12 24 Christian Cronk, LT, 6-4, 300, Jr. KeeSean Johnson 22 12 20 Jamire Jordan 20 9 9 Logan Hughes, LG, 6-3, 270, Jr. DEFENSE (5) Micah St. Andrew 17 12 15 Aaron Mitchell, C, 6-2, 307, Sr. Nick Kristofors, DE David Patterson 12 12 12 Micah St. Andrew, RG, 6-3, 350, Jr. Jeff Camilli, ILB Christian Cronk 12 12 12 Chason Virgil 11 10 - David Patterson, RT, 6-5, 295, Sr. Jamal Ellis, CB Dontel James 10 10 - Dontel James, RB, 6-0, 222, Sr. Stratton Brown, S Da’Mari Scott 10 - - KeeSean Johnson, WR, 6-1, 204, Jr. Tyquwan Glass, CB Delvon Hardaway 9 2 - Jamire Jordan, WR, 5-10, 170, Jr. Kyle Riddering 9 9 - Logan Hughes 6 6 6 Kyle Riddering, TE, 6-5, 240, Jr. SPECIAL TEAMS (1) Kyle Hendrickson 1 - - Justin Verrell, LS Josh Hokit 1 1 1 DEFENSE (6) Nathan Madsen, DL, 6-4, 300, Sr. Active Career Starts Leaders (Defense) Malik Forrester, DL, 6-1, 315, Sr. Career ’16 Consec. James Bailey, LB, 6-1, 225, Jr. Nathan Madsen 26 11 - James Bailey 15 12 12 Robert Stanley, LB, 6-3, 250, Sr. DeShawn Potts 13 11 - Tobenna Okeke, DL, 6-2, 250, Sr. Tobenna Okeke 12 7 6 DeShawn Potts, DB, 5-11, 202, Jr. Malik Forrester 11 11 10 Robert Stanley 10 9 4 SPECIAL TEAMS (2) Nela Otukolo 5 4 - Mike Bell 1 1 1 Kody Kroening, K, 5-11, 180, Jr. Tank Kelly 1 1 1 Blake Cusick, P, 6-1, 191, So. Justin Rice 1 1 -
LETTERMEN RETURNING (39) DIVISION I TRANSFERS (0) OFFENSE (18): Justin Allen, Christian Cronk, Frank Dalena, Delvon Hardaway, Kyle Hendrickson, Josh Hokit, Logan Hughes, Dontel James, KeeSean Johnson, Jamire Jordan, Aaron Mitchell, David Patterson, Ryan JUNIOR COLLEGE TRANSFERS (7) Popolizio, Jared Rice, Kyle Riddering, Micah St. Andrew, David Tangipa, OFFENSE (4): Derrion Grim, Gunner Javernick, Jorge Reyna, Chason Virgil Quireo Woodley
DEFENSE (18): Jeffrey Allison, James Bailey, Mike Bell, Patrick Belony, DEFENSE (3): Matt Boateng, Sherman Coleman, Jr., Emeka Ndoh Jaron Bryant, Malik Forrester, Justin Green, George Helmuth, Juju Hughes, Tank Kelly, Nathan Madsen, Tobenna Okeke, Nela Otukolo, DeShawn Potts, SPECIAL TEAMS (0): Justin Rice, Trent Soechting, Robert Stanley, Stephen Van Hook
SPECIAL TEAMS (3): Jimmy Camacho, Blake Cusick, Kody Kroening SIGNED HIGH SCHOOL RECRUITS (16) OFFENSE (9): Marc-David Bien-Aime, Dontae Bull, Daniel Moraga, Patrick Jeune, Jordan Mims, Zane Pope, Ronnie Rivers, Syrus Tuitele, REDSHIRTS RETURNING (18) Zelan Tupuola OFFENSE (8): Donte Coleman, Shane Gama, Saevion Johnson, Netane Muti, Kevin Parker, Deonte Perry, Da’Mari Scott, Matt Smith DEFENSE (7): Richard Cage, Chris Coleman, Alex Cruz, Damien DeGruy, Wylan Free, Talalemotu Mauga, Arron Mosby DEFENSE (7): Kevin Atkins, Tainoa Foster, Kevin Jeanniton, Ka’Lonn Milton, Tanner Rice, Messiah Tyler, Andrew Wright SPECIAL TEAMS (0):
SPECIAL TEAMS (3): Nathan De Jager, Jacob Westberry, Patrick Williams Jr.. LETTERMEN LOST (19) OFFENSE (6): Darrell Fuery, Treyvon Green, Zach Kline, Michael 27+(5648$'0(15(7851,1* Martens, Aaron Peck, Jacob Vazquez OFFENSE (4): Nick Aibuedefe, Anthony Grayson, Dejonte O’Neal, Christian Rossi DEFENSE (11): Stratton Brown, Jeff Camilli, Jamal Ellis, Tyquwan Glass, Brandon Hughes, Dalen Jones, Nick Kristofors, Wyatt McBee, Elijah Piper, DEFENSE (2): Jackson Finch, Jasad Haynes Austin Vaimili, Alan Wright
SPECIAL TEAMS (0): SPECIAL TEAMS (2): Justin Verrell, Nick Van Valkenburg
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 3 WHERE THE ‘DOGS CALL HOME BULLDOG STADIUM
Bulldog Stadium has been the home of the Fresno State football team of the stadium, a new press box and added suite tower on the west side, VLQFHLWÀUVWRSHQHGLQ(QWHULQJLWVWKIXOOVHDVRQKRVWLQJWKH a new south end zone facility for the football program and south end football team in 2017, the 41,031-seat facility has established itself as one zone video board. Already executed from that same vision was a new RI WKHPRVWGLIÀFXOWSODFHVWRSOD\IRUYLVLWLQJWHDPV KLJKGHÀQLWLRQYLGHRDQGULEERQERDUGWKDWZHUHLQVWDOOHGLQWKHQRUWK end zone before the start of the 2015 season and new fencing before the Fresno State has found great success in its home facility, owning a record start of the 2016 season. of 168-54-2, a winning percentage of 75 percent. Since the turn of the century, the ‘Dogs have posted a 70-30 record. On Oct. 14, 2016, the vision that Bartko revealed for a new Bulldog Stadium in the summer of 2015 took a big step toward reality as Some of the monumental home victories at Bulldog Stadium include AECOM was selected as the project architect. AECOM’s work spans ZLQQLQJEDFNWREDFN0RXQWDLQ:HVW&KDPSLRQVKLSVRQLWVKRPHÀHOG from master planning the London and Rio Olympics, to designing the in 2012 and 2013. The 2013 edition was the inaugural Mountain West ÀUVWHYHU/(('3ODWLQXPDUHQDIRUWKH6DFUDPHQWR.LQJVWRFDPSXV Championship game, led by quarterback Derek Carr and the ‘Dogs over planning, stadium renovation and enhancement for dozens of collegiate Utah State. programs across the country.
Other notable games include a 44-24 win over No. 10 Oregon State - the highest ever ranked opponent to come to Fresno at that time - in 2001, DIRECTIONS TO BULLDOG STADIUM a 17-3 win over Cal in 2000 and a 28-14 win over Cincinnati in 2010. In 2011, No. 5 Boise State became the highest-ranked opponent to ever FROM THE NORTH: play in Bulldog Stadium. 7DNH6WDWH5RXWHVRXWKWRWKH6KDZ$YHH[LW7XUQOHIWRQ6KDZ$YH 7UDYHOHDVWRQ6KDZWR&HGDU$YH DSSUR[PLOHV Fresno State has been able to bring in some of the nation’s top teams 7XUQOHIWRQ&HGDUWKHQOHIWRQ%XOOGRJ/DQH3URFHHGOHVVWKDQRQHEORFNWR to Bulldog Stadium over the years. Included in that list are Baylor, BYU, *DWH Cal, Cincinnati, Colorado, Illinois, Kansas State, Nebraska, Ole Miss, Oregon, Oregon State (twice), Rutgers and Wisconsin. FROM THE SOUTH: 7DNH6WDWH5RXWHQRUWKWR)UHHZD\ QRUWKWKH\PHUJHMXVWSDVW-HQVHQ The Red Wave has packed Bulldog Stadium to its limit countless times $YH 3URFHHGWRWKH6KDZ$YHH[LWDQGWUDYHOHDVWRQ6KDZWR&HGDU$YH DSSUR[ over the years. In 2000, the Bulldogs set a new single-season attendance PLOHV record when they averaged 42,410 fans, the 22nd-best mark in the 7XUQOHIWRQ&HGDUWKHQ nation. The following season, in which Fresno State achieved a program- OHIWRQ%XOOGRJ/DQH record national ranking of No. 8, was even better. The Bulldogs set a 3URFHHGOHVVWKDQRQHEORFN new record by averaging 42,802 fans, including stadium single-game WR*DWH UHFRUGVRI LQHDFKRI WKHODVWÀYHFRQWHVWVRI WKDW\HDU,QDOO Bulldog Stadium Fresno State has played 33 games in the stadium with 40,000 or more FROM THE FRESNO AIR Barstow Avenue TERMINAL: fans in the stands. Bulldog Ln. ([LWWKHDLUSRUWSDUNLQJORW WXUQLQJULJKWDWWKHVLJQDO Shaw Avenue In the summer of 2011, Bulldog Stadium received a face-lift when )ROORZWKHFXUYH &OLQWRQ Clinton Avenue FieldTurf was installed as the new playing surface. The $1.2 million $YH WR&HGDU$YH project was funded completely by private donations. 7XUQULJKWRQ&HGDU Fresno State now has bigger plans for the future of Bulldog Stadium, 3URFHHGDSSUR[LPDWHO\¿YH a plan that was initially rolled out in the summer of 2015 by athletic PLOHVWR%XOOGRJ/DQH7XUQ director Jim Bartko. A vision for improved accessibility and amenities OHIWDQGSURFHHGOHVVWKDQ Cedar Avenue for every fan who will enter the stadium, updated suites on the east side RQHEORFNWR*DWH
4 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE WHERE THE ‘DOGS CALL HOME BULLDOG STADIUM Original construction of Bulldog Stadium began in June of 1979, following BULLDOG STADIUM QUICK FACTS what was then the most successful capital fundraising project ever undertaken in the San Joaquin Valley. Local residents raised in excess of $7 million for the First Game: ...... 11/25/80 project. No state tax dollars or student fees were used to build the stadium...... vs. Montana St. W, 21-14 %XLOWSDUWLDOO\EHORZJURXQGOHYHOZLWKWKHSOD\LQJÀHOGIHHWEHORZJUDGH Capacity: ...... 41,031 WKHERZOIHDWXUHVDORZSURÀOHDSSHDUDQFH$XQLTXHFDQWLOHYHUHGOLJKWLQJ All-Time Record: ...... 168-54-2 (.750) V\VWHPH[WHQGVWRZDUGWKHÀHOGDQGLVGLUHFWHGGRZQZDUGWRFRQFHQWUDWH ...... 36 Full Seasons (37 seasons total) lighting on the playing surface. Surface: ...... FieldTurf Bulldog Stadium underwent a two-phase expansion project in 1991, which Highest Attended Game: ...... 42,881 (5x) included the addition of more than 10,000 seats -- increasing the stadium’s capacity from 30,000 to 41,031 -- and the construction of 22 sky suites. 40,000+ Games ...... 33 Other improvements included additional restrooms and concession facilities. Last 40,000+ Game ...... Sept. 13, 2014 ...... 41,031 vs. No. 21 Nebraska 7KH ÀUVW SKDVH HQWDLOHG ÀOOLQJ LQ WKH SDQHOV EH\RQG WKH QRUWK DQG VRXWK HQG]RQHVZLWKEHQFKVHDWLQJDQGWKHUHFRQÀJXUDWLRQRI WKHVHDWLQJRQWKH BULLDOG STADIUM RECORD stadium’s east side. The second phase, completed prior to the 1992 season, featured the addition of 22 sky suites, each of which includes seating for 20, Year Record (bowl) Avg. Attendance among other amenities. 1980 1-0 25,684 1981 2-3 21,458 At its present state, chair seating is available for more than 5,000 spectators on the west side of the stadium between the 18-yard lines to accommodate 1982 7-0 (1-0) 24,861 the contributors of the $7 million. There are also 4,240 chair-back seats on 1983 3-4 26,414 the east side and the rest of the stadium seating is on aluminum benches. 1984 4-2 29,223 )UHVQR6WDWHGHIHDWHG0RQWDQD6WDWHRQ1RYLQWKHÀUVW 1985 5-0-1 (1-0) 31,992 JDPHSOD\HGLQWKHVWDGLXP7KHÀUVWÀOOVHDVRQEHJDQLQVWDUWLQJZLWK 1986 8-0 33,573 a 23-16 win over Oregon on Sept. 5 led by then-quarterback and now-head 1987 5-1 33,568 coach Jeff Tedford. 1988 5-0 (1-0) 33,371 Bulldog Stadium was also home to the California Raisin Bowl from 1981- 1989 7-0 (1-0) 33,788 )UHVQR 6WDWH SOD\HG LQ WKH JDPH ÀYH WLPHV ZLQQLQJ WKH WLWOH RQ IRXU 1990 6-0-1 32,881 occasions. In 1994, the Stadium hosted friendly matches prior to the FIFA 1991 6-0 (0-1) 34,039 World Cup. 1992 5-1 35,225 RANKED TEAMS TO ENTER BULLDOG STADIUM 1993 6-0 39,536 Date Opponent Result 1994 3-4 36,171 Oct. 8, 1994 No. 22 BYU BYU 32, Fresno St. 30 1995 4-2 33,499 Nov. 19, 1994 No. 10 Colorado St. Colorado St. 44, Fresno St. 42 1996 3-3 37,373 Sept. 2, 2001 No. 10 Oregon St. Fresno St. 44, Oregon St. 24 1997 4-2 34,262 Nov. 21, 2003 No. 20 Boise St. Boise St. 31, Fresno St. 17 1998 4-1 37,102 Sept. 9, 2006 No. 20 Oregon Oregon 31, Fresno St. 24 1999 6-0 37,231 Sept. 13, 2008 No. 10 Wisconsin Wisconsin 13, Fresno St. 10 2000 5-0 41,369 Sept. 18, 2009 No. 8 Boise St. Boise St. 51, Fresno St. 34 2001 5-1 42,802 Nov. 14, 2010 No. 21 Nevada Nevada 35, Fresno St. 34 2002 5-1 39,133 Oct. 7, 2011 No. 5 Boise St. Boise St. 57, Fresno St. 7 2003 5-1 38,603 Sept. 13, 2014 No. 21 Nebraska Nebraska 55, Fresno St. 19 2004 4-1 39,777 Sept. 19, 2015 No. 21 Utah Utah 45, Fresno St. 24 2005 5-1 39,306 2006 3-3 38,552 HIGHEST ATTENDED GAMES at BULLDOG STADIUM 2007 5-1 36,290 Date Opponent Result Attendance 2008 2-3 37,864 Dec. 1, 2001 Utah State W, 70-21 42,881 2009 4-1 33,578 Nov. 23, 2001 San Jose State W, 40-21 42,881 2010 5-2 34,120 Nov. 3, 2001 Rice W, 52-24 42,881 2011 2-4 29,298 Oct. 19, 2001 Boise State L, 35-30 42,881 2012 6-0 30,915 Sept. 29, 2001 Louisiana Tech W, 38-28 42,881 2013 7-0 36,917 Nov. 10, 2005 Boise State W, 27-7 42,701 2014 4-2 34,876 Oct. 15, 2005 Utah State W, 53-21 42,701 2015 2-4 29,036 Sept. 19, 2004 Portland State W, 27-17 42,662 2016 1-5 25,493 Sept. 2, 2001 No. 10 Oregon State W, 44-24 42,410 Totals 168-54-2 (.750) 34,083 Avg. Sept. 13, 2008 No. 10 Wisconsin L, 13-10 42,387 37 Years 224 games (7,634,774 total)
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 5 2017 SEASON OUTLOOK
OFFENSIVE OUTLOOK Starters Returning/Lost: 10/1 Letterwinners Returning/Lost: 18/6 Redshirts Returning: 8 Other Squadmen Returning: 4 Newcomers: 17
Starters Returning (10) Chason Virgil, QB, 6-1, 192, So. Fourth in MW in passing in 2016 at 202.1 ypg Christian Cronk, OL, 6-5, 305, Jr. Started all 12 games at LT as a sophomore Logan Hughes, OL, 6-4, 285, Jr. Made 5 starts in 2016 at LG Aaron Mitchell, OL, 6-2, 305, Sr. Made 12 starts in 2016; 8 at Center, 4 at Guard Micah St. Andrew, OL, 6-3, 343, Jr. Junior KeeSean Johnson Started all 12 games at LG as a sophomore David Patterson, OL, 6-5, 302, Sr. Started all 12 games at RT as a junior PAST MEETS PRESENT FOR BULLDOG FOOTBALL Dontel James, RB, 6-0, 225, Sr. An outlook leading into the 2017 Fresno State fooball season Team-leading 697 rush yards in 2016 The Fresno State football program will have a the staff in 1992. Tight ends coach Scott KeeSean Johnson, WR, 6-2, 202, Jr. revamped look in 2017, blending its past with Thompson reunites with his former offensive Third in MW in receptions per game (5.5) the future as former Bulldog quarterback coordinator where he played under Tedford Jamire Jordan, WR, 5-11, 171, Jr. and assistant coach Jeff Tedford was hired from 1995-97. Led team with 1,049 all-purpose yards on Nov. 10, 2016 to take over the reins at his alma mater 20 years after last departing the Also joining the Bulldogs on the offensive Kyle Riddering, TE, 6-6, 240, Jr. Central Valley. side of the ball is DeBoer’s former offensive Made nine starts in 2016 coordinator at the University of Sioux With 40 lettermen returning, including 25 Falls and offensive line coach at Eastern Starters Lost (1) starters, 10 on the offensive side the ball, Michigan, Ryan Grubb. Former Boise State Aaron Peck, WR Tedford and Co. will have the pieces to help wide receiver Kirby Moore takes over as the guide Fresno State back to where it had team’s wide receivers coach after spending 1,211 receiving yards in 34 career games RQFHEHHQ 7KHH[SHULHQFHRQ WKHÀHOGZLOO last season as an offensive graduate assistant combine with a new-look coaching staff that at Washington where Tedford served as an Notable Returnees is hungry for success and revitalize the Red offensive consultant. Wave. WR, Delvon Hardaway (6-1, 195, Sr.) Along with Steinauer and Williams, Jamar Owns 42 career receptions and 489 career rec. yds. Calling plays for Tedford is a three-time Cain takes over as the team’s defensive line WR, Da’Mari Scott (6-1, 210, RSr.) NAIA champion head coach in Kalen coach after working in the same capacity with Redshirted 2016 season; 597 career rec yards DeBoer who comes to Fresno State after North Dakota State, helping the Bison win three years as the offensive coordinator at FCS championships in 2014 and 2015. Bert RB, Josh Hokit (6-1, 220, So.) Eastern Michigan where he turned around Watts, a former safety under Tedford at Cal, Made two starts in 2016; 130 rush yards the Eagles offense, helping the team to a rejoins his former coach as the Bulldogs’ RB, Dejonte O’Neal (5-7, 170, Jr.) VL[ZLQLPSURYHPHQWDQGWKHSURJUDP·VÀUVW linebacker coach after serving as the defensive bowl appearance since 1987. On the defensive coordinator at UC Davis the last four seasons. 316 all-purpose yards in four games in 2016 side, Orlondo Steinauer will lead the Bulldogs after a successful seven-year run as a coach in OFFENSE the Canadian Football League, most recently Active Career Starts Leaders (Offense) being the assistant head coach and defensive The Bulldogs’ offense returns 10 starters Career ’16 Consec. coordinator for the Hamilton Tiger-Cats. from last season, with the lone loss coming Aaron Mitchell 24 12 24 from wide receiver Aaron Peck. Despite the KeeSean Johnson 22 12 20 Returning to the program under Tedford departure of Peck, Fresno State’s strength Jamire Jordan 20 9 9 are three familiar faces who spent their fall once again remains on the outside as the team Micah St. Andrew 17 12 15 Saturdays competing in front of the Red welcomes back one of the Mountain West’s David Patterson 12 12 12 Wave. Defensive backs coach J.D. Williams top duos in KeeSean Johnson and Jamire Christian Cronk 12 12 12 was an All-American cornerback in late 80’s Jordan. The two combined for 1,486 yards Chason Virgil 11 10 - for the ‘Dogs before being drafted 16th receiving in 2016, with both ranking in the Dontel James 10 10 - overall in the 1990 NFL Draft by the Buffalo top 10 in the conference in receiving yards, Da’Mari Scott 10 - - Bills and playing in the Super Bowl in four receiving yards per game and receptions per Delvon Hardaway 9 2 - consecutive seasons (1991-94). Running game. Jordan, who had a breakout freshman Kyle Riddering 9 9 - backs coach and special teams coordinator season in 2015 remained a reliable target in Logan Hughes 6 6 6 Jamie Christian, who came over from UNLV 2016, while Johnson’s production more than Kyle Hendrickson 1 1 - with Williams during the offseason, began doubled from his sophomore campaign as he Josh Hokit 1 1 1 his collegiate career with the Bulldogs as a led the team in receptions (66), yards (773) fullback in the early 90’s when Tedford joined and touchdowns (6). 6 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 SEASON OUTLOOK Along with senior Delvon Hardaway, who seventh in passing yards per game among all has played in 33 career games with nine FBS freshman with 202.1 and ranked fourth OFFENSE AT A GLANCE... starts, senior Da’Mari Scott will return after in the Mountain West in passing yards per redshirting the 2016 season. Scott provides game and sixth in the league in total offense QUARTERBACKS another big-play threat to Fresno State’s per game (214.3) Lettermen Returning/Lost: 1/1 receiving corps as he averages 17.6 yards per reception in 35 career games. Against Air Force on Oct. 28, Virgil threw Seniors: Christian Rossi for a career-high 303 yards and a career-high Juniors: Jorge Reyna* Overall, the Bulldogs return 1,734 of their three touchdowns. With big-play threats Sophomores: Chason Virgil 2,557 yards (67.8 percent) gained during surrounding him, the Bulldog quarterback Freshmen: None the 2016 season from their returning pass recorded the second and third-longest pass catchers and 10 of their 13 touchdowns (76.9 completions of the season in the Mountain percent) scored through the air. Jordan enters West with an 85-yard connection to Jordan RUNNING BACKS 2017 with the most career receiving yards on Sept. 17 vs. Toledo and an 80-yard Lettermen Returning/Lost: 2/1 with 1,253 along with nine total scores. completion to Peck on Oct. 1 at UNLV – the 85-yard completion made Virgil the ninth Seniors: Dontel James Kyle Riddering and Jared Rice return at the Bulldog quarterback in Fresno State history Juniors: Dejonte O’Neal tight end position for Fresno State. Utilized to complete a pass of more than 85 yards: Sophomores: Josh Hokit primarily as a blocker, Riddering started nine joining Derek Carr (4), Paul Pinegar, Kevin Freshmen: Saevion Johnson#, Jordan Mims*, games, while Rice and his 6-foot-5 frame was Sweeney, Ryan Colburn, Michael Ross, Mark Deonte Perry#, Ronnie Rivers* used as a red zone threat as he caught two Barsotti, Dave Telford and Jeff Tedford. scores in 2016 in limited action. Virgil completed six passes for 50 yards or more, four of which were touchdowns. WIDE RECEIVERS With a plethora of options to throw to, third- Lettermen Returning/Lost: 5/3 year sophomore quarterback Chason Virgil The offensive line will be stocked this season heads into fall camp with the most experience ZLWKUHWXUQHUVDVWKHWHDPKDVDOOÀYHVWDUWHUV Seniors: Delvon Hardaway, Da’Mari Scott# under center at Fresno State. Also battling for back from the 2016 team – senior Christian Juniors: Justin Allen, Anthony Grayson, reps this seasons under center is Jorge Reyna, Cronk (left tackle), junior Logan Hughes KeeSean Johnson, Jamire Jordan, a junior college transfer who joined the fold (left guard), senior Aaron Mitchell (center), Namani Parker* during the spring out of West Los Angeles junior Micah St. Andrew (right guard) and Sophomores: Frank Dalena, College. The Bulldogs’ newest quarterback led senior David Patterson (right tackle). Cronk, the California Community College Athletic Patterson and St. Andrew started all 12 games Derrion Grim* Association in completions (316), completion at their positions, while Mitchell opened the Freshmen: Patrick Jeune*, Kevin Parker#, percentage (70.5 percent) and passing yards season with four starts at left guard before Zane Pope* (3,646) in 2016. Senior Christian Rossi, also VKLIWLQJWR FHQWHU ZKHUHKH VWDUWHGWKHÀQDO a CCCAA product, joined Bulldogs’ roster eight games of the season. Hughes made six in 2016 after transferring from Fresno City VWDUWVDVDÀUVW\HDU%XOOGRJDVHDVRQDJR TIGHT ENDS College will seek reps entering his senior Lettermen Returning/Lost: 4/0 season. Looking to push for spots across the line this Seniors: None season are redshirt freshman Netane Muti, Juniors: Kyle Hendrickson, Gunner Javernick*, The leader coming out of spring camp though who made a strong statement for a starting Kyle Riddering, David Tangipa was Virgil, an 11-game starter over the last two SRVLWLRQLQVSULQJEDOOKHPLVVHGKLVÀUVW\HDU seasons. He was a one-game starter as a true due to an injury prior to fall camp. Newcomer Sophomores: Jared Rice freshman in 2015 due to injury - he obtained Quireo Woodley and 6-foot-7 senior Ryan Freshmen: Donte Coleman#, a medical redshirt - and came back for year Popolizo will also be working their was into Daniel Moraga* two and threw for 2,021 yards on 166-of-322 the conversation moving into fall camp as passing as a redshirt freshman season in 10 well as a handful of fall newcomers. starts. The Mesquite, Texas native became the OFFENSIVE LINE third freshman quarterback in Fresno State The ‘Dogs will look to increase its production Lettermen Returning/Lost: 6/1 history to throw for more than 2,000 yards in from the running game this year after rushing Seniors: Aaron Mitchell, David Patterson, a single season, joining Paul Pinegar (2,929) for just 116.2 yards per game in 2016. Dontel Ryan Popolizio and Kevin Sweeney (2,359), and was one of James, the team’s leading running back in nine freshmen in FBS football to throw for 2016 returns after compiling 697 yards on Juniors: Christian Cronk, Shane Gama, more than 2,000 yards in 2016. Virgil ranked the ground as a junior. The versatile Josh Logan Hughes, Micah St. Andrew Sophomores: Nick Aibuedefe Freshmen: Marc-David Bien-Aime*, RETURNING OFFENSIVE LEADERS FROM 2016 Donte Bull*, Netane Muti#, Matt Smith#, Passing GP/GS C-A Pct. Yds. TD/Int Lg Avg/g Syrus Tuitele*, Zelan Tupuola*, VIRGIL, Chason 10/10 166-322 51.6 2,021 13/10 85 202.1 Quiero Woodley*
Rushing GP/GS Att. Yds. Avg. TD Lg Yds/G bold - returning letterman JAMES, Dontel 11/10 208 697 3.4 5 34 63.4 * newcomer | # utilized redshirt in 2016 HOKIT, Josh 12/2 27 130 4.8 0 18 10.8 O’NEAL, Dejonte 4/0 16 57 3.6 1 17 14.2
Receiving GP/GS Rec. Yds. Avg. TD Lg Avg/g JOHNSON, KeeSean 12/12 66 773 11.7 6 53 64.4 JORDAN, Jamire 12/9 45 713 15.8 2 85 59.4 HARDAWAY, Delvon 10/2 10 122 12.2 0 23 12.2 RIDDERING, Kyle 12/9 7 33 4.7 0 12 2.8
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 7 2017 SEASON OUTLOOK +RNLW ZLOO UHWXUQ WR WKH %XOOGRJV EDFNÀHOG making 12 starts during the last two years and DEFENSIVE OUTLOOK after racking up 130 yards on the ground is coming off of a career-high 52 tackles and Starters Returning/Lost: 6/5 LQ WKH ÀQDO WZR JDPHV RI WKH VHDVRQ 7KH 2.5 sacks. Letterwinners Returning/Lost: 18/11 sophomore who played linebacker, fullback, Redshirts Returning: 7 and on special teams, has made the shift Steinauer’s strength this season appears to running back full time after earning the to be in the middle with two starters and Other Squadmen Returning: 2 VWDUWLQJ QRG LQ WKH ÀQDO JDPH RI WKH WZR VLJQLÀFDQW FRQWULEXWRUV UHWXUQLQJ DW Newcomers: 13 season. Local product Dejonte O’Neal will linebacker. One of the biggest losses from bring his versatility on offense and special last season though was the departure of Jeff Starters Returning (6) WHDPVEDFNZKHUHKHZDVÀIWKLQDOOSXUSRVH Camilli, who recorded 184 tackles in his past James Bailey, SAM, (6-1, 225, Jr.) yards with 316 playing in just four games a two seasons and was as staple in the middle year ago before his season was cut short due of the Bulldogs’ defense. With 15 combined Leading returning tackler with 59 stops, 32 solo to injury. Also in the mix after redshirting last VWDUWVDQGVLJQLÀFDQWWLPHRQWKHÀHOGLQVLGH Malik Forrester, DT, (6-1, 295, Sr.) year is Saevion Johnson, along with incoming linebackers Robert Stanley and Nela Otukolo Led defensive lineman with 38 tackles in 2016 freshman Ronnie Rivers and Jordan Mims. ZLOOORRNWRÀOOWKHYRLGOHIWE\&DPLOOL7KH Nathan Madsen, DT, (6-4, 298, Sr.) two former Bishop Gorman players who DEFENSE left the high school two years apart are the Started 11 games at DE in 2016 WKLUGDQGÀIWKOHDGLQJUHWXUQLQJWDFNOHUVIURP Tobenna Okeke, DL, (6-3, 245, Sr.) With Orlondo Steinauer taking over as the the 2016 squad. Adding depth behind them Moved to defensive end during the spring new defensive coordinator, the defense is junior Trent Soechting who recorded 36 DeShawn Potts, DB, (6-0, 200, Jr.) will look much different than in previous WDFNOHVLQKLVÀUVW\HDUDVD%XOOGRJ years as it returns to the 4-3 defense. With Leading returning tackler with 59 stops WKUHH RI WKH GHIHQVH·V ÀYH VWDUWHUV ORVW GXH On the outside as the SAM linebacker, junior Robert Stanley, ILB, (6-3, 245, Sr.) to graduation coming from the secondary, James Bailey is one of the most experienced Recorded 54 tackles in 2016 defensive pressure from the front four could players for the Bulldogs having played in SOD\DVLJQLÀFDQWUROHLQDVWKH%XOOGRJV DOO JDPHV GXULQJ KLV ÀUVW WZR VHDVRQV LQ totaled just 14 sacks a season ago with 3.5 of Fresno while making 15 starts, including three Starters Lost (5) those coming from its three-down lineman. as a true freshman in 2015. With 59 stops in DB, Stratton Brown 2016, he enters this season tied for the team 115 tackles, 5.5 TFLs, 1 INT in 2016 After featuring at defensive end and nose lead in tackles by a returner. His 47 tackles the OLB, Jeff Camilli guard the past two seasons, Nathan Madsen previous year were the most by any Bulldog shifted to the interior of the front four last true freshmen since linebacker Kevin Adams 13th in NCAA in tackles per game (9.8) in 2016 spring, and will presumably slide inside next also posted 47 stops in 1995. DB, Jamal Ellis to senior Malik Forrester. The two combined 38 career starts; 202 career tackles for 60 tackles with 6.5 for a loss last season. While the secondary was littered with DB, Tyquwan Glass Madsen is the most experienced player on the experience last year, the team lost a combined defensive side of the ball for the Bulldogs, 77 starts between Stratton Brown, Jamal Ellis, 199 tackles and 6 INTs in in two seasons entering the season with 26 career starts while Tyquawn Glass, Dalen Jones and Alan Wright. DE, Nick Kristofors Forrester saw 11 in year one after transferring Junior Tank Kelly and sophomores Jaron 36 career tackles and 1 sack in two seasons from L.A. Pierce College. Depth inside will Bryant and Juju Hughes all saw time with the be provided from junior Patrick Belony (295 ones during the spring. Kelly has seen time lbs.), sophomore Jasad Haynes (275 lbs.) in 16 games during his career, earning a start Notable Returnees and redshirt freshman Kevin Atkins (297 at Utah State last season. Bryant and Hughes DB, Juju Hughes (5-11, 180, So.) lbs.). Three outside linebackers from last primarily saw time on the special teams unit, Played in all 12 games as a freshman in 2016 season – Justin Green, Tobenna Okeke, and while Hughes broke through at corner during DB, Mike Bell (6-3, 205, So.) Stephen Van Hook – have made the switch to the latter half the season, recording 13 of his defensive end with the formation change to WDFNOHVGXULQJWKHÀQDOIRXUJDPHVRI WKH 35 tackles and 2.5 TFLs in first season help bolster the position. While all three are season. Also in the mix is redshirt sophomore ILB, Nela Otukolo (5-11, 240, Jr.) seasoned veterans, Okeke has seen the most Ka’Lonn Milton, who joined the Bulldogs 73 tackles and 9 TFLs in 18 career games WLPH RQ WKH ÀHOG GXULQJ KLV WKUHH VHDVRQV in 2016 after a year at Fresno City College, ILB, Trent Soechting (6-3, 220, Jr.) 36 tackles in first season
Active Career Starts Leaders (Defense) Career ’16 Consec. Nathan Madsen 26 11 - James Bailey 15 12 12 DeShawn Potts 13 11 - Tobenna Okeke 12 7 6 Malik Forrester 11 11 10 Robert Stanley 10 9 4 Nela Otukolo 5 4 - Mike Bell 1 1 1 Tank Kelly 1 1 1 Justin Rice 1 1 -
Junior James Bailey enters 2017 as the active career leader in tackles with 106 8 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 SEASON OUTLOOK RETURNING DEFENSIVE LEADERS FROM 2016 DEFENSE/SPECIAL TEAMS AT A GLANCE... DEFENSIVE LEADERS GP Solo Ast Total TFL/Yds Sacks/Yds Int-Yds DEFENSIVE LINE BAILEY, James 12 32 27 59 5.0/11 - - Lettermen Returning/Lost: 6/4 POTTS, Deshawn 12 29 30 59 1.0/1 - - Seniors: Malik Forrester, Justin Green, STANLEY, Robert 10 29 25 54 3.0/4 - - Nathan Madsen, Tobenna Okeke, OKEKE, Tobenna 12 22 30 52 2.5/17 2.5/17 - Stephen Van Hook OTUKOLO, Nela 10 27 21 48 5.5/10 1.5/3 - Juniors: Patrick Belony, Emeka Ndoh* FORRESTER, Malik 11 21 17 38 5.0/12 1.0/6 - Sophomores: Jasad Haynes SOECHTING, Trent 12 17 19 36 2.0/9 - - Freshmen: Kevin Atkins#, Richard Cage*, BELL, Mike 12 17 18 35 2.5/4 - - Damien DeGruy*, Kevin Jeanniton#, MADSEN, Nathan 12 11 11 22 1.5/11 1.5/11 - Talalemotu Mauga* ALLISON, Jeffrey 12 8 13 21 - - HUGHES, Juju 12 8 10 18 1.5/7 - - LINEBACKERS and junior college transfer Matt Boetang who THE SCHEDULE Lettermen Returning/Lost: 6/2 joined the team during the spring. Seniors: Trent Soechting, Robert Stanley In 2017, Fresno State will open the season Juniors: James Bailey, George Helmuth, The back-end of the secondary will be at Bulldog Stadium for the fourth time since anchored by junior DeShawn Potts, who 2012, hosting Incarnate Word (Southland- Nela Otukolo made 11 of his 13 career starts in 2016, and FCS) on Sept. 2. The Bulldogs will then leave Sophomores: Jeffrey Allison sophomore Mike Bell. Along with Bailey, California to face a pair of 2016 College Freshmen: Alex Cruz*, Tainoa Foster#, Potts is the team’s leading returning tackler Football Playoff teams in back-to-back weeks Tanner Rice#, Andrew Wright# ZLWKWRJRZLWKÀYHSDVVEUHDNXSV/LNH with Alabama on Sept. 9 and Washington on Potts, who came on late during his freshman Sept. 16. The matchup in Tuscaloosa, Ala., year to solidify his starting spot, the 6-foot-3 ZLOOEHWKHÀUVWHYHUPHHWLQJEHWZHHQWKHWZR DEFENSIVE BACKS Bell did the same after making the transition sides and will air on ESPN2. Fresno State’s Lettermen Returning/Lost: 6/5 IURP FRUQHU VWULQJLQJ WRJHWKHU D ÀYHJDPH WULSWR6HDWWOH:DVKZLOOPDUNLWVÀUVWVLQFH Seniors: Jackson Finch stretch during the second-half of the season the 2006 season and second since the turn of in which he compiled 26 of his 37 tackles the century. Juniors: Matt Boetang*, Sherman Coleman, Jr.*, DQGHDUQHGKLVÀUVWFDUHHUVWDUWLQWKHVHDVRQ Tank Kelly, Ka’Lonn Milton#, DeShawn Potts ÀQDOH $GGLQJ FRPSHWLWLRQ WR WKH PL[ LV Following games against the two Power 5 Sophomores: Mike Bell, Jaron Bryant, sophomore Justin Rice who made the move opponents, the ‘Dogs will have their bye week Juju Hughes, Justin Rice from running back to safety during spring. prior to starting Mountain West play. The Freshmen: Chris Coleman*, Wylan Free*, 2017 conference schedule pairs Fresno State SPECIALISTS with its West Division foes (Hawai’i, Nevada, Arron Mosby* San Jose State, San Diego State) along with Fresno State returns 2016 Lou Groza games against Boise State, New Mexico and VHPLÀQDOLVW .RG\ .URHQLQJ DQG WKH WHDP·V Wyoming from the Mountain Division. top scorer from a year ago. The senior SPECIALISTS spent much of last season as one of the The Bulldogs will kick-off its MW slate on Lettermen Returning/Lost: 3/2 country’s most accurate kickers, converting Sept. 30, hosting Nevada after the bye. The Seniors: Jimmy Camacho, Kody Kroening RQ VWUDLJKW ÀHOG JRDOV DIWHU PLVVLQJ KLV tilt with the Wolf Pack begins a stretch of Juniors: None ÀUVW DWWHPSW RI WKH \HDU $V WKH %XOOGRJV· IRXU:HVW'LYLVLRQRSSRQHQWVLQÀYHZHHNV leading scorer in 2016, compiling 68 points, Sophomores: Blake Cusick, KHFRQQHFWHGRQRIÀHOGJRDODWWHPSWV It also starts a run where the ‘Dogs do not Patrick Williams Jr. and was a perfect 23-of-23 on PATs. Of his leave the state of California from their return Freshmen: Nathan DeJager# , 17 attempts, he was 6-of-7 on kicks beyond from Washington before the bye, until the Jacob Westberry# 40 yards, including a career-long of 49. Jimmy second week of November. Camacho, who was 2-of-4 on kicks in 2015, spent last season splitting kickoff duties, The ‘Dogs will see just one division opponent bold - returning letterman averaging 60.8 yards per kick. after October (at Hawai’i, Nov. 11). Fresno * newcomer | # utilized redshirt in 2016 6WDWHZLOOKRVWLWVÀUVWQRQGLYLVLRQDOFRQWHVW 6RSKRPRUH %ODNH &XVLFN VROLGLÀHG KLV MRE against New Mexico on Homecoming on DV WKH WHDP·V ÀUVWVWULQJ SXQWHU ODVW \HDU Oct. 14. punting 78 times for a 38.3 average. After UHGVKLUWLQJ KLV ÀUVW \HDU KH GLG QRW DOORZ D 1RYHPEHU EHJLQV ZLWK WKH %XOOGRJV· ÀQDO team to return a punt for positive yards until nonconference game of the season when the ninth game of the season. Fresno State %<8FRPHVWR)UHVQRIRUWKHÀUVWWLPHVLQFH ended the season 28th in punt return defense, 1998. Fresno State is 3-2 at home in the series, allowing 10 returns for a 5.2 yard average. winning the last contest 31-21. After traveling With the departure of Justin Verrell, the to Hawai’i, the Bulldogs head to Wyoming for ORQJVQDSSHUSRVLWLRQZLOOQHHGWREHÀOOHG WKHÀUVWWLPHVLQFHZKHQWKH\GHIHDWHG Redshirt freshmen Patrick Williams Jr., and the Cowboys 48-10 at War Memorial Stadium. Jacob Westberry will vie for the spot in the The ‘Dogs close the season with Boise State fall. on Senior Day, hosting the Broncos at Bulldog 6WDGLXP IRU WKH ÀUVW WLPH VLQFH GHIHDWLQJ them in 2013, 41-40.
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 9 2017 ROSTER INFORMATION
ALPHABETICAL ROSTER 1XPHULFDO5RVWHU 79 Nick Aibuedefe OL 1R 1DPH 3RV +W :W &O ([S +RPHWRZQ +LJK6FKRRO3UHYLRXV6FKRRO 1 Damien DeGruy DL 6-3 245 Fr. 1st New Orleans, La. (McDonogh) 13 Justin Allen WR 1 Jamire Jordan WR 5-11 171 Jr. 4th Lancaster, Calif. (Highland) 24 Jeffrey Allison ILB 2 Patrick Jeune WR 6-0 187 Fr, 1st Inglewood, Calif. (Morningside) 90 Kevin Atkins DT 2 DeShawn Potts DB 6-0 200 Jr. 4th Monrovia, Calif. (Monrovia) 19 Brent Bailey QB &KULV&ROHPDQ '% )U VW %DNHUVÀHOG&DOLI *DUFHV0HPRULDO 7 James Bailey SAM 3 KeeSean Johnson WR 6-2 202 Jr. 4th Palo Alto, Calif. (Palo Alto) 4 Mike Bell DB 6-3 205 So. 3rd Moreno Valley, Calif. (Citrus Hill) 4 Mike Bell DB 4 Deonte Perry RB 6-0 185 RFr. 2nd Canoga Park, Calif. (Canoga Park) 94 Patrick Belony DT 5 Emeka Ndoh DL 6-0 252 Jr. 3rd Reedley, Calif. (Immanuel/De Anza College) 71 Marc-David Bien-Aime OL 5 Chason Virgil QB 6-1 192 So. 3rd Mesquite, Texas (West Mesquite) 26 Matt Boateng DB 6 Delvon Hardaway WR 6-1 195 Sr. 5th Los Angeles, Calif. (Dorsey) 13 Jaron Bryant DB 6 Tank Kelly DB 5-10 185 Jr. 4th Galena Park, Texas (Galena Park) 7 James Bailey SAM 6-1 225 Jr 3rd Austin, Texas (Lake Travis) 72 Dontae Bull OL 7 Derrion Grim WR 6-1 186 So. 2nd Stockton, Calif. (McNair/Delta JC/Nebraska) 36 Jimmy Camacho K 8 Wylan Free DB 6-2 172 Fr. 1st Compton, Calif. (Lynwood) 42 Richard Cage DL 8 Da’Mari Scott WR 6-1 210 RSr. 5th Muskegon Heights, Mich. (Cathedral [L.A.]) 3 Chris Coleman DB 10 Nela Otukolo ILB 5-11 240 Jr 3rd Las Vegas, Nev. (Bishop Gorman) 82 Donte Coleman TE 10 Jorge Reyna QB 6-0 210 Jr. 3rd Downey, Calif. (Pasadena/West LA College) 11 Aaron Mosby DB 6-4 210 Fr. 1st Sanger, Calif. (Sanger) 25 Sherman Coleman, Jr. DB 11 Dejonte O’Neal RB 5-7 170 Jr. 3rd Fresno, Calif. (Bullard) 58 Christian Cronk OL 13 Justin Allen WR 5-11 188 Jr. 4th Los Angeles, Calif. (Mater Dei) 51 Alex Cruz ILB 13 Jaron Bryant DB 6-1 183 So. 2nd Fort Worth, Texas (Duncanville) 47 Blake Cusick P 15 Chris Gaston DB 6-1 183 Fr. 1st La Puente, Calif. (Bishop Amat) 19 Frank Dalena WR 'DQLHO0RUDJD 7( )U VW 2[QDUG&DOLI 3DFLÀFD 16 Kyle Lindquist QB 6-4 212 Fr. 1st Chico, Calif. (Pleasant Valley) 45 Nathan De Jager P 16 Jared Rice TE 6-5 228 So. 3rd Modesto, Calif. (Central Catholic) 1 Damien DeGruy DL 17 Christian Rossi QB 6-1 208 Sr. 5th Fresno, Calif. (Clovis North/Fresno City College) 18 Jackson Finch DB 18 Jackson Finch DB 6-1 200 Sr. 4th Modesto, Calif. (Central Catholic/Contra Costa College) 97 Malik Forrester DT 18 Zane Pope WR 6-2 187 Fr, 1st Moorpark, Calif. (Moorpark) 50 Tainoa Foster ILB 19 Brent Bailey QB 6-0 212 Fr. 1st Fresno, Calif. (Clovis North) 19 Frank Dalena WR 5-8 158 So. 3rd Fresno, Calif. (San Joaquin Memorial) 8 Wylan Free DB 20 Ronnie Rivers RB 5-8 175 Fr. 1st Brentwood, Calif. (Freedom) 37 Asa Fuller K 22 Jordan Mims RB 5-11 190 Fr. 1st East Palo Alto, Calif. (Menlo-Atherton) 76 Shane Gama OL 22 Trent Soechting ILB 6-3 220 Jr. 4th Katy, Texas (Cinco Ranch/Blinn College) 15 Chris Gaston DB 23 Juju Hughes DB 5-11 180 So. 2nd Hanford, Calif. (Hanford) 84 Anthony Grayson WR 23 Kevin Parker WR 5-6 150 RFr. 2nd Oakland, Calif. (Skyline) 24 Saevion Johnson RB 6-0 194 RFr. 2nd Pearland, Texas (Pearland Dawson) 40 Justin Green DE 24 Jeffrey Allison ILB 6-0 250 So. 2nd Miami, Fla. (Langston Hughes [Ga.]) 7 Derrion Grim WR 25 Sherman Coleman, Jr. DB 5-9 165 Jr. 3rd Houston, Texas (Westside/Cisco College) 6 Delvon Hardaway WR 26 Matt Boateng DB 6-0 175 Jr. 4th Toronto, Canada (Arizona Western College/IMG Academy) 93 Jasad Haynes DT 27 Ka’Lonn Milton DB 6-0 185 RSo. 3rd Fresno, Calif. (Buchanan/Fresno City College) 34 George Helmuth ILB 28 Dontel James RB 6-0 225 Sr. 5th Fontana, Calif. (Summit/Riverside CC) 29 Justin Rice DB 6-2 210 So. 2nd Modesto, Calif. (Central Catholic) 86 Kyle Hendrickson TE 30 Messiah Tyler SAM 5-8 228 RSo. 3rd Murrieta, Calif. (Vista Murrieta/University of La Verne) 33 Josh Hokit RB 31 Andrew Wright SAM 6-2 210 RFr. 2nd Buena Park, Calif. (Buena Park) 23 Juju Hughes DB 32 Robert Stanley ILB 6-3 245 Sr. 5th Las Vegas, Nev. (Bishop Gorman) 62 Logan Hughes OL 33 Josh Hokit RB 6-1 220 So. 2nd Clovis, Calif. (Clovis) 28 Dontel James RB 34 George Helmuth ILB 6-1 220 Jr. 4th Fresno, Calif. (Clovis North) 36 Jimmy Camacho K 5-10 180 Sr. 4th Perris, Calif. (Citrus Hill/Riverside CC) 80 Gunner Javernick TE 37 Asa Fuller K 6-2 235 Fr, 1st Fountain Valley. Calif. (Servite) 96 Kevin Jeanniton DE 40 Justin Green DE 6-4 210 Sr. 4th Oak Park, Calif. (Oak Park) 2 Patrick Jeune WR 41 Ronnie Manning DB 5-10 188 Sr. 4th Fresno, Calif. (Edison/Northern Arizona) 3 KeeSean Johnson WR 42 Richard Cage DL 6-1 215 Fr. 1st Corona, Calif. (Eleanor Roosevelt) 24 Saevion Johnson RB 44 Stephen Van Hook DE 6-2 245 Sr. 5th Perris, Calif. (Citrus Hill) 1DWKDQ'H-DJHU 3 5)U QG %DNHUVÀHOG&DOLI %DNHUVÀHOG&KULVWLDQ 1 Jamire Jordan WR 47 Blake Cusick P 6-2 185 So. 3rd Monrovia, Calif. (Monrovia) 6 Tank Kelly DB 48 Kody Kroening K 5-11 180 Sr. 4th San Jose, Calif. (Valley Christian) 48 Kody Kroening K 48 Tanner Rice ILB 5-11 230 RFr. 2nd Clovis, Calif. (Clovis) 16 Kyle Lindquist QB 50 Tainoa Foster ILB 6-2 200 RFr. 2nd Honolulu, Hawai’i (Kamehameha) 91 Nathan Madsen DE 51 Alex Cruz ILB 6-2 242 Fr. 1st Concord, Calif. (Concord) 52 Netane Muti OL 6-3 310 RFr. 2nd Wahiawa, Hawai’i (Leilehua) 41 Ronnie Manning DB 53 Jacob Westberry LS 6-3 235 RFr. 2nd Bradenton, Fla. (Saint Stephen’s Episcopal) 99 Talalemotu Mauga DL 54 Patrick Williams Jr. LS 6-3 205 RFr. 2nd Vacaville, Calif. (Vacaville) 27 Ka’Lonn Milton DB 56 Tobenna Okeke DE 6-3 245 Sr. 4th Missouri City, Texas (Elkins) 22 Jordan Mims RB 0\NDO:DONHU ,/% -U UG 9DFDYLOOH&DOLI 9DFDYLOOH$]XVD3DFLÀF 77 Aaron Mitchell OL 58 Christian Cronk OL 6-5 305 Jr. 3rd Oceanside, Calif. (Oceanside/Riverside CC) 59 Matt Smith OL 5-11 280 RFr. 2nd Long Beach, Calif. (St. John Bosco) 15 Daniel Moraga TE 62 Logan Hughes OL 6-4 285 Jr. 3rd Las Vegas, Nev. (Green Valley/Victor Valley College) 11 Aaron Mosby DB 65 Syrus Tuitele OL 6-6 298 Fr. 1st Chico, Calif. (Pleasant Valley) 10 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 ROSTER INFORMATION
52 Netane Muti OL 66 Quireo Woodley OL 6-4 300 So. 2nd Murrieta, Calif. (Murrieta Valley) 67 Chantz Russell OL 6-6 245 Fr. 1st Petaluma, Calif. (Marin Catholic) 5 Emeka Ndoh DL 71 Marc-David Bien-Aime OL 6-5 365 Fr. 1st Montreal, Canada (Montmorency College) 11 Dejonte O’Neal RB 72 Dontae Bull OL 6-7 305 Fr. 1st Victoria, Canada (Belmont Secondary) 56 Tobenna Okeke DE 73 Micah St. Andrew OL 6-3 343 Jr. 4th Rialto, Calif. (Eisenhower) 10 Nela Otukolo ILB 74 Ryan Popolizio OL 6-7 311 Sr. 4th Fremont, Calif. (St. Francis/San Mateo College) 23 Kevin Parker WR 75 Zelan Tupuola OL 6-2 310 Fr. 1st Carson, Calif. (JSerra Catholic) 76 Shane Gama OL 6-4 302 RJr. 4th Chino, Calif. (Orange Lutheran/Southwestern College) 87 Namani Parker WR 77 Aaron Mitchell OL 6-2 305 Sr. 4th San Diego, Calif. (Cathedral Catholic) 78 David Patterson OL 78 David Patterson OL 6-5 302 Sr. 5th Irvine, Calif. (Woodbridge) 4 Deonte Perry RB 79 Nick Aibuedefe OL 6-4 270 So. 3rd Sacramento, Calif. (Capital Christian) 18 Zane Pope WR 80 Gunner Javernick TE 6-6 270 Jr. 4th Canon City, Colo. (Canon City/Ventura Junior College) 74 Ryan Popolizio OL 82 Donte Coleman TE 6-3 235 RFr. 2nd Mesquite, Texas (West Mesquite) 84 Anthony Grayson WR 6-1 168 Jr. 4th Redlands, Calif. (Redlands East Valley) 2 DeShawn Potts DB 86 Kyle Hendrickson TE 6-4 255 Jr. 4th Escondido, Calif. (San Pasqual) 10 Jorge Reyna QB 87 Namani Parker WR 6-4 198 Jr. 4th Roseville, Calif. (American River/Oakmont) 16 Jared Rice TE 88 David Tangipa TE 6-5 240 Jr. 4th Sacramento, Calif. (Foothill) 29 Justin Rice DB 89 Kyle Riddering TE 6-6 240 Jr. 4th Fresno, Calif. (Clovis North) 48 Tanner Rice ILB 90 Kevin Atkins DT 6-2 297 RFr. 2nd Murrieta, Calif. (Vista Murrieta) 91 Nathan Madsen DT 6-4 298 Sr. 5th Eureka, Calif. (Eureka) 89 Kyle Riddering TE 93 Jasad Haynes DT 6-1 275 So. 3rd Fresno, Calif. (Clovis North) 20 Ronnie Rivers RB 94 Patrick Belony DT 6-1 295 Jr. 4th N. Miami Beach, Fla. (N. Miami Beach/Antelope Valley College) 17 Christian Rossi QB 96 Kevin Jeanniton DE 6-2 250 RFr. 2nd Fresno, Calif. (Edison) 67 Chantz Russell OL 97 Malik Forrester DT 6-1 295 Sr. 4th Annapolis, Md. (Glen Burnie/LA Pierce College) 8 Da’Mari Scott WR 99 Talalemotu Mauga DL 6-3 282 Fr. 1st Fallon, Nev. (Churchill County) 59 Matt Smith OL &RDFKLQJ6WDII 22 Trent Soechting ILB Jeff Tedford - Head Coach 73 Micah St. Andrew OL Kalen Deboer - Offensive Coordinator 32 Robert Stanley ILB Orlondo Steinauer - Defensive Coordinator 88 David Tangipa TE Jamar Cain - Assistant Coach (Defensive Line) Jamie Christian - Assistant Coach (Running Backs/Special Teams Coordinator) 65 Syrus Tuitele OL Ryan Grubb - Assistant Coach (Offensive Line/Run Game Coordinator) 75 Zelan Tupuola OL Kirby Moore - Assistant Coach (Wide Receivers) 30 Messiah Tyler SAM Scott Thompson - Assistant Coach (Tight Ends) 44 Stephen Van Hook DE Bert Watts - Assistant Coach (Linebackers) 5 Chason Virgil QB J.D. Williams - Assistant Coach (Defensive Backs) Lucus Gingold - Special Teams Quality Control Assistant 57 Mykal Walker ILB Brad Vonnahme - Offensive Analyst 53 Jacob Westberry LS Andy Ward - Head Strength and Conditioning Coach, Football 54 Patrick Williams Jr. LS Dylan Chmura - Offensive Graduate Assistant 66 Quireo Woodley OL D.J. Harper - Offensive Graduate Assistant 31 Andrew Wright SAM Matt Lea - Defensive Graduate Assistant C.J. McGorisk - Defensive Graduate Assistant
3URQXQFLDWLRQ*XLGH Nick Aibuedefe ...... Ab-U-deaf-eh Deonte Perry...... Dee-On-teh Matt Boateng ...... Bo-Tang Ryan Popolizio ...... Pop-uh-Liz-E-oh Damien DeGruy ...... Da-Grew Trent Soechting ...... Sec-Ting Tainoa Foster ...... Tie-Noah David Tangipa...... Tong-E-Pa Wylen Free...... Way-lynn Syrus Tuitele ...... Two-tell-E Anthoula “Tank” Kelly ...... An-thu-la Zelan Tupuola ...... Zay-lin, Tu-Pu-Oh-La Josh Hokit ...... Ho-kit Quireo Woodley ...... Kerr-E-O Jamire Jordan ...... Jameer Patrick Jeune ...... June Talalemotu Mauga ...... Ta-La-Le-Motu, Ma-ooga Netane Muti ...... Nuh-tahn-E Moo-T Kalen DeBoer ...... K-lynn Emeka Ndoh...... en-doh Orlondo Steinuer ...... Stien-ow-er Tobenna Okeke ...... Tow-BEN-nuh, ohh-kay-kay Brad Vonnahme...... Va-Nom-E Nela Otukolo ...... Nel-uh, O-two-Co-low Dejonte O’Neal ...... Dijon-teh Namani Parker ...... Na-mann-E
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 11 2017 ROSTER INFORMATION GEOGRAPHICAL ROSTER
COLORADO (1) Canon City: Gunner Javernick
FLORIDA (3) Bradenton: Jacob Westberry Miami: Jeffrey Allison North Miami Beach: Patrick Belony
HAWAI’I (2) Honolulu: Tainoa Foster Wahiawa: Netane Muti
LOUISIANA (1) New Orleans: Damien DeGruy
MARYLAND (1) Annapolis: Malik Forrester
MICHIGAN (1) CALIFORNIA (69) Lancaster: Jamire Jordan Muskegon Heights: Da’Mari Scott Bakersfield: Chris Coleman Long Beach: Matt Smith Nathan DeJager Los Angeles: Justin Allen NEVADA (4) Brentwood: Ronnie Rivers Delvon Hardaway Fallon: Talaemotu Mauga Buena Park: Andrew Wright Modesto: Jackson Finch Las Vegas: Logan Hughes Canoga Park: Deonte Perry Jared Rice Nela Otukolo Carson: Zelan Tupuola Justin Rice Robert Stanley Chico: Kyle Lindquist Monrovia: Blake Cusick Syrus Tuitele DeShawn Potts TEXAS (9) Chino: Shane Gama Moorpark: Zane Pope Austin: James Bailey Clovis: Josh Hokit Moreno Valley: Mike Bell Fort Worth: Jaron Bryant Tanner Rice Murrieta: Kevin Atkins Galena Park: Tank Kelly Compton: Wylan Free Messiah Tyler Houston: Sherman Coleman, Jr. Concord: Alex Cruz Quireo Woodley Katy: Trent Soechting Corona: Richard Cage Oak Park: Justin Green Mesquite: Donte Coleman Downey: Jorge Reyna Oakland: Kevin Parker Chason Virgil East Palo Alto: Jordan Mims Oceanside: Christian Cronk Missouri City: Tobenna Okeke Escondido: Kyle Hendrickson Oxnard: Daniel Moraga Pearland: Saevion Johnson Eureka: Nathan Madsen Palo Alto: KeeSean Johnson Fontana: Dontel James Perris: Jimmy Camacho Fountain Valley: Asa Fuller Stephen Van Hook Fremont: Ryan Popolizio Petaluma: Chantz Russell Fresno: Brent Bailey Redlands: Anthony Grayson CANADA (3) Frank Dalena Reedley: Emeka Ndoh Toronto (Ontario): Matt Boateng Jasad Haynes Rialto: Micah St. Andrew Montreal (Quebec): Marc-David Bien-Aime George Helmuth Roseville: Namani Parker Victoria (B.C.): Dontae Bull Kevin Jeanniton Sacramento: Nick Aibuedefe Ronnie Manning David Tangipa Ka’Lonn Milton San Diego: Aaron Mitchell Dejonte O’Neal San Jose: Kody Kroening Kyle Riddering Sanger: Aaron Mosby Christian Rossi Stockton: Derrion Grim Hanford: Juju Hughes Vacaville: Mykal Walker Inglewood: Patrick Jeune Patrick Williams, Jr. Irvine: David Patterson La Puente: Chris Gaston
12 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 ROSTER INFORMATION 2017 PRESEASON DEPTH CHART OFFENSE DEFENSE SPECIAL TEAMS 4XDUWHUEDFN End 3ODFH.LFNHU &KDVRQ9LUJLO 6R -XVWLQ*UHHQ 6U .RG\.URHQLQJ 6U 10 Jorge Reyna (6-0, 210, Jr.) 56 Tobenna Okeke (6-3, 245, Sr.) 3 Jimmy Camacho (5-10, 180, Sr.) 5XQQLQJ%DFN 7DFNOH .LFNRIIV -RVK+RNLW 6R 0DOLN)RUUHVWHU 6U -LPP\&DPDFKR 6U 28 Dontel James (6-0, 225, Sr.) 91 Nathan Madsen (6-4, 298, Sr.) 48 Kody Kroening (5-11, 180, Sr.) or 11 Dejonte O’Neal (5-7, 170, Jr.) 7DFNOH Punter /HIW7DFNOH -DVDG+D\QHV 6R %ODNH&XVLFN 6R &KULVWLDQ&URQN -U 90 Kevin Atkins (6-2, 297, RFr.) 45 Nathan De Jager (6-0, 180, RFr.) 66 Quireo Woodley (6-4, 300, RFr.) End /RQJ6QDSSHU Left Guard 6WHSKHQ9DQ+RRN 6U -DFRE:HVWEHUU\ 5)U 1HWDQH0XWL 5)U 5 Emeka Ndoh (6-0, 252, Jr.) 54 Patrick Williams, Jr. (6-3, 205, RFr.) 59 Matt Smith (5-11, 280, RFr.) SAM Holder Center -DPHV%DLOH\ -U %ODNH&XVLFN 6R $DURQ0LWFKHOO 6U 31 Andrew Wright (6-2, 210, RFr.) 10 Jorge Reyna (6-0, 210, Jr.) 62 Logan Hughes (6-4, 285, Jr.) MIKE (Middle LB) .LFN5HWXUQHU 5LJKW*XDUG 5REHUW6WDQOH\ 6U 'D·0DUL6FRWW 56U 0LFDK6W$QGUHZ -U 10 Nela Otukolo (5-11, 240, Jr.) 3 KeeSean Johnson (6-2, 202, Jr.) 76 Shane Gama (6-4, 302, RJr.) WILL Punt Returner 5LJKW7DFNOH *HRUJH+HOPXWK -U 'D·0DUL6FRWW 56U 'DYLG3DWWHUVRQ 6U 22 Trent Soechting (6-3, 220, Jr.) 3 KeeSean Johnson (6-2, 202, Jr.) 74 Ryan Popolizio (6-7, 311, Sr.) &RUQHUEDFN WR (X) -XMX+XJKHV 6R .HH6HDQ-RKQVRQ -U 13 Jaron Bryant (6-0, 183, So.) 84 Anthony Grayson (6-1, 168, Jr.) Strong Safety WR (Z) -XVWLQ5LFH 6R 'HOYRQ+DUGDZD\ 6U 18 Jackson Finch (6-1, 200, Sr.) 8 Da’Mari Scott (6-1, 210, RSr.) Free Safety WR (H) 'H6KDZQ3RWWV -U -DPLUH-RUGDQ -U 4 Mike Bell (6-3, 205, So.) 13 Justin Allen (5-11, 188, Jr.) &RUQHUEDFN TE 7DQN.HOO\ -U .\OH5LGGHULQJ -U 26 Matt Boateng (6-0, 175, Jr.) 88 David Tangipa (6-5, 240, Jr.)
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 13 FRESNO STATE AT A GLANCE... SCHEDULE/FUTURES
2017 BULLDOG FOOTBALL SCHEDULE (ALL TIMES PACIFIC)
BULLDOG FOOTBALL 2 Incarnate Word TBA TBA CHANNEL FINDER... AT&T UVERSE 9 at Alabama 12:30 p.m. Big 10 Network: 650,1650 CBS Sports Network 643, 1643 16 at Washington 6:30 p.m. ESPN: 602, 1602 ESPN2: 606, 1606 30 Nevada* TBA TBA ESPNEWS: 604, 1604 ESPNU: 605, 1605 COMCAST (FRESNO MARKET) 7 at San Jose State* TBA TBA Big 10 Network: 403 CBS Sports Network: 418, 732 14 New Mexico*# TBA ESPN: 32, 724 ESPN2: 33, 725 21 at San Diego State* 7:30 p.m. ESPNEWS: 402, 726 ESPNU: 420, 788 28 UNLV* TBA DIRECTV Big 10 Network: 610 CBS Sports Network: 221 4 BYU TBA ESPN: 206 ESPN2: 209 11 at Hawai’i* TBA TBA ESPNEWS: 207 ESPNU: 208 18 at Wyoming* TBA DISH NETWORK Big 10 Network: 405, 410 25 Boise State* 12:30 p.m. CBS Sports Network: 158 November November October September ESPN: 140 Mountain West Network & ESPN3 are online streams, only. Indicators ESPN2: 144 t.8/FUXPSLDBOCFGPVOEWJB(P#VMMEPHTDPNPS-JWF4USFBNDPN * conference game ESPNEWS: 142 # homecoming t&41/DBOCFGPVOEWJB&41/DPNPSUIF&41/"QQ ESPNU: 141 t"55410354/FUXPSLJTOPUBWBJMBCMFJO$BMJGPSOJB
FUTURE BULLDOG FOOTBALL SCHEDULES 20182019 2020 Date2SSRQHQW /RFDWLRQ Date2SSRQHQW /RFDWLRQ Date2SSRQHQW /RFDWLRQ 2021 6 ,GDKR )UHVQR&$ A31 at USC Los Angeles, CA S12 at Colorado Boulder, CO Sept. 4 -- at Oregon S8 at Minnesota Minneapolis, MN 6 0LQQHVRWD )UHVQR&$ S26 at Texas A&M College Station, TX Sept. 18 -- at UCLA S15 at UCLA Los Angeles, CA 66DFUDPHQWR6WDWH )UHVQR&$ TBD TBD 2022 67ROHGR )UHVQR&$ TBD TBD TBD TBD Sept. 3 -- Sacramento State at Boise State* Boise, ID at Air Force* Colorado Springs, CO $LU)RUFH )UHVQR&$ Sept. 10 -- Oregon State +DZDL·L )UHVQR&$ &RORUDGR6WDWH )UHVQR&$ at Colorado State* Fort Collins, CO Sept. 17 -- at USC at Nevada* Reno, NV at Hawai’i* Honolulu, HI +DZDL·L )UHVQR&$ at New Mexico* Albuquerque, NM 1HYDGD )UHVQR&$ at Nevada* Reno, NV 2023 6DQ'LHJR6WDWH )UHVQR&$ at San Diego State* San Diego, CA 6DQ'LHJR6WDWH )UHVQR&$ Sept. 16 -- at Arizona State 6DQ-RVH6WDWH )UHVQR&$ at San Jose State* San Jose, CA 6DQ-RVH6WDWH )UHVQR&$ 2024 at UNLV* Las Vegas, NV 81/9 )UHVQR&$ at UNLV* Las Vegas, NV Aug. 31 -- at Oregon State :\RPLQJ )UHVQR&$ 8WDK6WDWH )UHVQR&$ at Utah State* Logun, UT Sept. 14 -- at UCLA
* = Mountain West game 2025 All future conference game dates are TBD Aug. 30 -- at USC
14 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF
Jeff Tedford Head Coach | 1st Season | Fresno State (1992)
Jeff Tedford, 55, was named the 19th head football coach in Fresno He returned to Fresno State in 1992 as the quarterbacks coach State history on Nov. 10, 2016 and was introduced to the Red Wave and served as the offensive coordinator for the Bulldogs over the by Director of Athletics Jim Bartko at a press conference on Nov. HQVXLQJÀYHVHDVRQV 11, 2016. Tedford held the same position at Oregon (1998-2001) before he Tedford, a former Bulldog quarterback and Fresno State assistant became the head coach at Cal. He was named the Pac-10 Coach coach, returned to the Valley after holding the position of offensive of the Year twice, led the Golden Bears to a school record seven consultant for the Washington Huskies – a 2016 College Football consecutive bowl games and to a conference title in 2006. Playoff team. Following Tedford’s stint at Cal, he moved on to the NFL in 2014 Tedford assumed the role of acting head coach on Nov. 27, as the Tampa Bay Buccaneers’ offensive coordinator. The stop did following the conclusion of the 2016 season as interim head coach not last long due to health issues during the preseason that evolved Eric Kiesau carried out his duties for the remaining two games LQWRDQLQGHÀQLWHOHDYHRI DEVHQFHZKLFKUHVXOWHGLQWKHWZRVLGHV following Tedford’s introduction. mutually agreeing to part ways.
Tedford, who is a proven winner on the West Coast, comes to the Tedford made his return to the CFL in 2015 as he was named the Valley with 11 years of head coaching experience at the Division head coach of the B.C. Lions. At the conclusion of the season, I level – having led the California Golden Bears to 82 wins from Tedford elected to exercise an option in his contract to resign and 2002-2012. He left as the school’s all-time winningest coach. pursue opportunities in college football.
Tedford’s ties to the Valley and Fresno State run deep. He played Tedford made his return to college football as an offensive quarterback at Fresno State in 1981-82 under Jim Sweeney and consultant for the Washington Huskies under head coach Chris coached at Fresno State under Sweeney from 1987-88 and 1992-96, Peterson in 2016. A relationship rekindled after their time together DQGXQGHUDWKHQÀUVW\HDUKHDGFRDFK3DW+LOOLQ as assistants at Oregon under then-coach Mike Belotti. Washington’s staff also included associate head coach Bob Gregory, who served Tedford’s coaching career started at Fresno State, volunteering as an as Tedford’s defensive coordinator at Cal for eight seasons. DVVLVWDQWIRUWKHVHDVRQVIURPWKHUHKHSLFNHGXSKLVÀUVW full-time position as an assistant for the Calgary Stampeders of the Tedford graduated from Warren High School in Downey, California Canadian Football League – a familiar league in which he played and attended Cerritos Junior College for two seasons before quarterback for six seasons after his collegiate career at Fresno becoming the Bulldogs’ quarterback in 1981. State. He and his wife Donna have two children, Taylor and Quinn.
2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 15 COACHES AND STAFF
Cal Football (Head Coach, 2002-2012):
$IWHUDFFHSWLQJKLVÀUVWKHDGFRDFKLQJSRVLWLRQLQ7HGIRUGVSHQWVHDVRQVDWWKHKHOPRI the Cal football team. Tedford left Cal as the winningest coach in program history with 82 wins; the Golden Bears posted a school-record run of seven straight bowl appearances from 2003-09 and ranked as high as No. 2 in the nation in 2007 - its highest ranking since 1951.
The Bears were 5-3 in the postseason under Tedford, including a school-record string of four consecutive bowl wins from 2005-08, making him the only Cal mentor with more than two postseason victories. The Bears also won enough games to be bowl eligible with a seven-victory VHDVRQLQKLVÀUVWFDPSDLJQLQEXWZHUHLQHOLJLEOHIRUDERZO,QDGGLWLRQ&DOSXWWRJHWKHUD school-record-tying eight consecutive winning campaigns from 2002-09 and added a ninth in 10 seasons in 2011. Cal twice posted a school record-tying 10 wins under Tedford, the sixth and seventh times in school history, in 2004 and 2006. Coaching Experience Fresno State (2016-2017) All of this at the head of a program that won just one game in 2001, the year prior to his arrival tHead Coach - making the renaissance of the Cal football program over that decade arguably one of the most Washington (2016) impressive turnarounds in college football history. t0ČFOTJWF$POTVMUBOU B.C. Lions (2015) The Bears had 40 players selected in the NFL Draft during the 11 drafts following seasons that have t)FBE$PBDI RFFXUUHGZKLOH7HGIRUGZDVWKHKHDGFRDFKDW&DOLQFOXGLQJHLJKWÀUVWURXQGSLFNV Tampa Bay Bucaneers (2014) t0ČFOTJWF$PPSEJOBUPS Tedford also has earned a reputation as a strong recruiter, with his last three classes in 2010, ’11 California (2002-12) and ’12 being ranked as high as No. 11, No. 13 and No. 15 nationally. Prior to the 2011 campaign, t)FBE$PBDI Sporting News bestowed the honor of the Pac-12’s best recruiter on him. Oregon (1998-2001) t0ČFOTJWF$PPSEJOBUPS %XW7HGIRUG·VWHDPVQRWRQO\JRWLWGRQHRQWKHÀHOGWKH\JRWLWGRQHLQWKHFODVVURRPLQ%HUNHOH\ Fresno State (1992-97) His players were recognized as conference All-Academic honorees 110 times in 11 seasons. t0ČFOTJWF$PPSEJOBUPS(1993-97) t2VBSUFSCBDLT$PBDI(1992) Tedford’s success with the Cal program also resulted in local devotion and national attention. Cal Calgary Stampeders (1989-91) averaged more than 57,000 fans per contest for seven consecutive seasons from 2004-10, before t0ČFOTJWF"TTJTUBOU moving to the 45,000-seat AT&T Park in 2011 while Memorial Stadium underwent an extensive Fresno State (1987-88) UHQRYDWLRQDQGUHWURÀWSULRUWRUHRSHQLQJIRUWKHWHDP·VKRPHFRQWHVWV7KHVHYHQ\HDUVWUHWFK t7PMVOUFFS"TTJTUBOU$PBDI included a string of 43 consecutive games in front of at least 50,000 fans at Memorial Stadium (Sept. 11, 2004 – Nov. 20, 2010). In 2006, the Bears set school records for average fans per home game Personal (64,318) and overall spectators (450,223). The following year in 2007, Cal established a school record Hometown with 41,366 season-ticket holders. t%PXOFZ $BMJG Education Nationally, Cal had multiple Heisman Trophy candidates under Tedford’s tutelage, with J.J. Arrington t'SFTOP4UBUF#" (2004), Marshawn Lynch (2006), DeSean Jackson (2007) and Jahvid Best (2009) among top candidates Playing Exp. IRUWKHSUHVWLJLRXVKRQRUDWVRPHSRLQWLQWKHVHDVRQ$UULQJWRQÀQLVKHGHLJKWKLQWKHÀQDOYRWLQJ t)BNJMUPO5JHFS$BUT t$BMHBSZ4UBNQFEFST Tedford has used his own signal-calling experience to build a reputation as a quarterback guru. During t4BTLBUDIFXBO3PHISJEFST his lengthy collegiate coaching career at Cal (2002-2012), Oregon (1998-2001) and Fresno State (1992- t8JOOJQFH#MVF#PNCFST 97), Tedford has been an integral piece in the development of six quarterbacks that became NFL t'SFTOP4UBUF 2# ÀUVWURXQGSLFNV².\OH%ROOHU'DYLG&DUU7UHQW'LOIHU-RH\+DUULQJWRQ$DURQ5RGJHUVDQG$NLOL t$FSSJUPT$PMMFHF 2# Smith. Tedford Year-by-Year College Head Coaching Record Family :FBS 4DIPPM 0WFSBMM $POGFSFODF 1PTUTFBTPO Rodgers, an under-the- t8JGF%POOB $BM 5UI t$IJMESFO5BZMPS 2VJOO $BM 5SE *OTJHIU radar junior college transfer $BM OE )PMJEBZ like Tedford, ranked No. 8 $BM 5UI -BT7FHBT QDWLRQDOO\LQSDVVHIÀFLHQF\ $BM 5TU )PMJEBZ in 2004 when he completed $BM 5UI "SNFE'PSDFT $BM UI &NFSBME 66.1 percent of his passes $BM 5UI 1PJOTFUUJB for 2,566 yards and 24 $BM UI touchdowns with only eight $BM UI/PSUI )PMJEBZ interceptions for the Bears. $BM UI/PSUI He put up similar numbers 5PUBMT :FBST #PXM"QQFBSBODFT the previous season when he 16 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF completed 61.6 percent of his passes for 2,903 yards and 19 WRXFKGRZQVZLWKRQO\ÀYHLQWHUFHSWLRQV$IWHUEHLQJGUDIWHG *DBOUUIJOLPGBCFUUFSQMBDFUPMFBEBHSPVQPGZPVOH E\WKH*UHHQ%D\3DFNHUVLQWKHÀUVWURXQGRI WKH1)/ “ Draft, Rodgers has become one of the top quarterbacks in NFOPOUPUIFGPPUCBMMĕFME$PNJOHUP'SFTOP4UBUFJT WKH1)/DQGIROORZHGKLVÀUVW3UR%RZOVHOHFWLRQLQE\ DPNJOHIPNFGPSNZTFMGBOENZGBNJMZ5PIBWFUIJT earning Super Bowl XLV MVP honors the following season TQFDJBMPQQPSUVOJUZUPSFUVSOUPNZDPBDIJOHSPPUTJT after leading the Packers to a victory over the Pittsburgh USVMZBESFBNDPNFUSVF0VSNJTTJPOXJMMCFUPHSPX Steelers. BOEEFWFMPQZPVOHQFPQMFUPSFBDIUIFJSGVMMQPUFOUJBMJO - In addition to his success with quarterbacks, Tedford’s teams BMMBSFBTBDBEFNJDBMMZ BUIMFUJDBMMZ TPDJBMMZBOETQJSJ have featured balanced attacks and became notorious for UVBMMZUPDPNQMFUFBUIJHIMFWFMTJOUIFDMBTTSPPNBOE WKHLUIHURFLW\RQWKHJURXQG,QQLQHRI KLVÀUVWVHDVRQVDW POUIFĕFMEXIJMFEPJOHTPXJUIHSFBUDIBSBDUFSBOEIJHI Cal, Tedford had at least one running back post a 1,000-yard JOUFHSJUZ rushing season, including a string of seven consecutive years ” Fresno State head coach Jeff Tedford with a 1,000-yard rusher from 2002-08 and then again in 2010 and 2011.
In 2004, Arrington broke Chuck Muncie’s single-season school record with 2,018 yards, which led the country (168.2 ypg) as Arrington UXVKHGIRUDWOHDVW\DUGVLQHDFKRI KLVFRQWHVWV,Q-XVWLQ)RUVHWW·VUXVKLQJ\DUGVZHUHEULHÁ\WKHVHFRQGEHVWLQ&DO KLVWRU\EXW%HVW·VIRXUJDPHÁRXULVK \DUGV DWWKHHQGRIJDYHKLPIRUWKH\HDUWRPRYHSDVW)RUVHWW/\QFKKDGEDFNWR back 1,000-yard seasons in 2005 and 2006, while Adimchinobe Echemandu (1,195 yards in 2003), Isi Sofele (1,322 yards in 2011), Shane Vereen (1,167 yards in 2010), and Joe Igber (1,075 yards in 2002) each reached the 1,000-yard milestone under Tedford as well.
While offense has been Tedford’s forte, Cal’s defense toughened considerably during his reign as the Bears’ coach. His 2004 team ranked eighth nationally in scoring defense, allowing just 16.0 points per game. In 2005, the Bears led the Pac-10 in scoring defense, giving up only 21.2 points per contest. In 2008, Cal led the Pac-10 in the two key categories of red zone defense (68.2%) and takeaways (34). The Bears ZHUHVHFRQGLQWKHFRQIHUHQFHLQUXVKGHIHQVH \SJ LQ&DOWKHQKDGDVWHOODUVHDVRQRQGHIHQVHLQLQWKHLUÀUVW\HDUXQGHU former Super Bowl coordinator Clancy Pendergast, leading the league and ranking among the top 25 nationally in sacks (2.83 spg, No. 13 NCAA), total defense (319.08 ypg, No. 18 NCAA) and pass defense (187.0 ypg, No. 21 NCAA). In 2011, Cal again led the Pac-12 in total defense (332.92 ypg) and pass defense (204.23 ypg), ranking 25th and 37th nationally. Cal also continued to make big plays on defense in DVWKH3DF·VWRSWHDPLQWDFNOHVIRUORVV WÁSJ1R1&$$ ZKLOHUDQNLQJWKLUGLQWKHFRQIHUHQFHLQVDFNV VSJ1R 1&$$ ,QDGGLWLRQWKH%HDUVOHGWKH3DFLQRSSRQHQWV·ÀUVWGRZQVDOORZLQJRQO\SHUJDPH
Other national recognition that came the Bears way under Tedford was: Alex Mack picking up the 2008 Draddy Award (often referred to as the Academic Heisman), while Mike Mohamed was one of 16 players across the country in the National Football Foundation’s Scholar- $WKOHWH&ODVVRIDQGDÀQDOLVWIRUWKHSUHVWLJLRXVKRQRUZRQE\0DFNQRZNQRZQDVWKH:LOOLDP9&DPSEHOO7URSK\*LRUJLR 7DYHFFKLRZDVDVHPLÀQDOLVWIRUWKHVDPHKRQRULQ,QWKH Bears had a pair of players collect national awards. Jackson was the First Round NFL Quarterbacks Coached by Tedford recipient of the inaugural Randy Moss Award as the top returner in the t,ZMF#PMMFS $BM UIQJDL #BMUJNPSF country, while Daymeion Hughes earned The Lott IMPACT Trophy, $PBDIFEJO t%BWJE$BSS 'SFTOP4UBUF TUQJDL )PVTUPO given to the nation’s top defensive player to equally recognize his athletic $PBDIFEJO performance and personal character. t5SFOU%JMGFS 'SFTOP4UBUF UIQJDL 5BNQB#BZ $PBDIFEGSPN As an Assistant Coach: t+PFZ)BSSJOHUPO 0SFHPO SEQJDL %FUSPJU - $PBDIFEGSPN Prior to his arrival in Berkeley, Tedford was the offensive coordinator t"BSPO3PEHFST $BM UIQJDL (SFFO#BZ and quarterbacks coach at Oregon, serving in that role for four seasons, $PBDIFEGSPN LQFOXGLQJWKHFDPSDLJQZKHQWKH'XFNVÀQLVKHGZLWKD1R t"LJMJ4NJUI 0SFHPO SEQJDL $JODJOOBUJ national ranking. $PBDIFEJO
Tedford played an integral role in the rise of the Oregon program GXULQJKLVWHQXUHLQ(XJHQH²DSHULRGLQZKLFKWKH'XFNVSRVWHGWKH3DF·VEHVWUHFRUG ZKLOHÀQLVKLQJSURJUHVVLYHO\EHWWHUHDFK \HDU LQLQLQDQGLQ 'XULQJKLVÀUVWVHDVRQDVRIIHQVLYHFRRUGLQDWRULQ2UHJRQVHWVFKRRO records in passing yards, total offense and points scored. Tedford’s passing acumen was clearly evident in the rapid development of Smith, ZKRHDUQHG3DF2IIHQVLYH3OD\HURI WKH Duck quarterbacks A.J. Feeley and Joey Harrington combined to pass for 3,131 yards and 24 TDs on the Sun Bowl champion team that ranked 13th nationally in scoring in 1999, while the 2000 club tied for the Pac-10 crown and defeated Texas in the Holiday Bowl. Tedford’s last Oregon squad in 2001 showcased one of the nation’s premier quarterbacks in Harrington, who won Pac-10 Offensive Player of the 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 17 COACHES AND STAFF After departing Fresno State, Tedford played professionally in the Canadian Football League for six seasons with Hamilton, Calgary, Saskatchewan and Winnipeg. He appeared in the league’s championship game (Grey Cup) with Hamilton in 1984. 18 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF Kalen DeBoer 0ijijIJĻŀĶŃIJ$ļļĿıĶĻĮŁļĿ ƉŀŁ4IJĮŀļĻ]4ĶļłŅ'ĮĹĹŀ ƉƑƑƐ .DOHQ'H%RHU SURQRXQFHGGXK%25 EHJLQVKLVÀUVWVHDVRQDW seasons as the offensive coordinator at Southern Illinois (2010-13) Fresno State in the role of offensive coordinator, after spending the while also seeing over the wide receiver unit. previous three seasons at Eastern Michigan as the team’s offensive coordinator and quarterbacks coach. He was hired December 24, In 2013, the Saluki offense led the Missouri Valley Football 2016. Conference (FCS) with 231.8 passing yards per game, the fourth highest total in school history. SIU’s 25 passing touchdowns on the Prior to joining the Bulldogs’ staff, DeBoer helped guide EMU to season tied for the third highest total in school history. The offense LWVÀUVWERZOELGVLQFHIROORZLQJDUHJXODUVHDVRQ'HVSLWH was led by senior quarterback Kory Faulkner, who ranked 32nd dropping the Popeyes Bahamas Bowl 24-20 to Old Dominion, in the nation in passing yards per game. SIU also led the MVFC (DVWHUQ0LFKLJDQÀQLVKHGLWVÀUVWVHDVRQDERYHVLQFH LQÀUVWGRZQV JDPH DQGWKLUGGRZQFRQYHUVLRQV EMU tied the Football Bowl Subdivision mark for biggest 6,8WRWDOHGRYHU\DUGVRI RIIHQVHLQVL[RI LWVÀUVWVHYHQJDPHV turnarounds, improving on its win total from one win in 2015, to before Faulkner suffered an injury with a second-half lead against seven in 2016. As an offense, EMU ranked 35th in the FBS in total No. 1 North Dakota State. Under DeBoer’s tutelage, tight end Coaching Experience offense, posting 455.2 yards per game in 13 contests. The team also MyCole Pruitt was named to the 2013 American Football Coaches shattered the school record for total yards team offense with 5,917 Association (AFCA) FCS All-America team while John Lantz Fresno State (2017) yards, breaking the previous record of 5,010. developed into an All-MVFC receiver. t0ČFOTJWF$PPSEJOBUPS Total offense was not the only school record EMU bested in 2016 During the 2011 campaign, the Salukis ranked third in the nation Eastern Michigan (2014-16) as DeBoer’s offense set team season records for points scored ZLWKDQDYHUDJHRI UXVKLQJ\DUGVDFRQWHVWZKLOHÀQLVKLQJ SDVVLQJ \DUGV WRXFKGRZQ SDVVHV ÀUVW GRZQV third in the MVFC with 377.8 yards per game of total offense. t0ČFOTJWF$PPSEJOBUPS2#T (303), pass completions (309), plays (999) as well single-game plays Jewel Hampton rushed for 1,121 yards -- the second tailback at (2010-13) (99). His squad racked up the second-most touchdowns (47) and Southern Illinois SIU to surpass the 1,000-yard plateau in DeBoer’s offense. Bryan t0ČFOTJWF$PPSEJOBUPS83T rushing TDs (21) in a season and the second-most single-game Boemer also developed into the Rimington Award winner, which is WRXFKGRZQ DQGÀUVWGRZQV presented to the nation’s premier center. Sioux Falls (2000-09) Eastern was led by redshirt junior quarterback Brogan Roback, In 2010, the Saluki offense averaged 30.1 points and 378.2 yards of t)FBE$PBDI ZKRSXWXSWDOOQXPEHUVLQKLVDSSHDUDQFHVLQ+HÀQLVKHG total offense per game behind a balanced attack. SIU ran for 189.5 t0ČFOTJWF$PPSEJOBUPS with 219 completions for 2,694 yards and 18 touchdowns. He had yards per game and threw for 188.7. six 300-yard games and a season-high of 468 yards. The offense Washington HS (S.D.) (1998-99) got its start up front from an experienced offensive line, which had In total, the Salukis beat 10 Top 25 opponents during DeBoer’s t"TTJTUBOU$PBDI 166 combined starts under its belt. The group combined to allow tenure. the eighth fewest sacks in the nation, as well as the second fewest Sioux Falls (1997) tackles for a loss %HIRUHOHDGLQJ(DVWHUQ0LFKLJDQDQG6RXWKHUQ,OOLQRLVWRSUROLÀF t4UVEFOU"TTJTUBOU$PBDI 83T offensive numbers, DeBoer served as the head coach at the Other notable offensive highlights for the Eagles this past season University of Sioux Falls, where he led one of the most dominant include ranking 16th in the FBS in third down conversions, 26th in NAIA programs in the nation. Personal WKH)%6LQÀUVWGRZQRIIHQVHWKLQWKH)%6LQSDVVLQJRIIHQVH and 21st in the FBS in red zone offense. DeBoer was named a three-time NAIA National Coach of the Hometown Year and compiled an astonishing 67-3 (.957) record while guiding 'XULQJ WKH FDPSDLJQ (08 ÀQLVKHG WKH \HDU ZLWK 86)WRWKUHHQDWLRQDOFKDPSLRQVKLSVLQÀYHVHDVRQV'H%RHUZRQ t.JMCBOL 4% WRXFKGRZQVDPDUNWKDWLVWLHGIRUWKHÀIWKPRVWLQDVLQJOHVHDVRQ four Great Plains Athletic Conference Championships, 50-straight during the squad’s 124-year history, while its 4,560 yards of total KRPHJDPHVDQGVWUDLJKWJDPHVRYHUDOOLQKLVÀQDOWZRVHDVRQV Education RIIHQVHZDVDOVRWKHÀIWKPRVW2QWKHJURXQG(08FKXUQHGRXW He also boasted a 17-2 record in the playoffs. t4JPVY'BMMT the 14th-best single-season rushing total at 1,894 yards. Through the air, EMU quarterbacks combined for 2,666 yards passing, His teams won back-to-back NAIA National Championships in Playing Exp. ranking seventh in program single-season annals. EMU’s passing 2008 and 2009, and adding in his 2006 national championship, t4JPVY'BMMT 83 attack spread the wealth with seven different receivers having DeBoer had as many national championships as games lost during 20-or-more receptions, Eastern Michigan was one of just three KLVÀYH\HDUWHQXUHDV86)·VKHDGFRDFK Family schools nationally to accomplish that feat. Under his direction, the Cougars averaged 51.7 points per game t8JGF/JDPMF Individually, running back Darius Jackson turned in one of the in 2009 and scored no less than 25 points in all 15 games. USF ÀQHVW VHDVRQV LQ (DVWHUQ 0LFKLJDQ KLVWRU\ LQ VHWWLQJ WKH scored 40 or more points in 13-of-15 games and also put up 76 t$IJMESFO"MFYJT "WFSZ school’s single-season record with 16 touchdowns and was the 13th and 80 points in wins. Using a balanced attack, USF averaged 487.5 player in program history to break the 1,000-yard mark. \DUGVRI WRWDORIIHQVH UXVKLQJDQGSDVVLQJ LQKLVÀQDO season as head coach. ,Q 'H%RHU·V ÀUVW \HDU UXQQLQJ WKH (08 RIIHQVH KH KHOSHG redshirt-freshman quarterback Reginald Bell Jr. burst on to the During the 2009 season, USF racked up 775 points for the most national scene, as he was one of just seven quarterbacks nationally points ever scored in a single year at the NAIA level. The total also WROHDGKLVWHDPLQERWKSDVVLQJDQGUXVKLQJ\DUGDJH%HOOÀQLVKHG ranks third-most in college football history at any level. In addition, the year with 1,859 total yards offense, which included a 510-yard that squad ranked second in the NAIA at 487 yards per game as performance against Ball State – the second-most single-game it upset Football Championship Subdivision (FCS) foe North yardage by one individual in program history. Dakota, 28-13. Prior to his three-year stint at Eastern Michigan, DeBoer spent four DeBoer coached three NAIA National Players of the Year in quarterbacks Lorenzo Brown (2009), Chad Cavender (2007) and running back Nick Kortan (2002). $V D KHDG FRDFK 'H%RHU FRDFKHG ÀUVWWHDP $OO$PHULFDQV DQGÀUVWWHDPDOOFRQIHUHQFHKRQRUHHVDW86)+HDOVRKHOSHG develop seven student-athletes into All-Americans while acting as the offensive coordinator. A graduate of USF, DeBoer played for the Cougars from 1993-96, where he was an All-American wide receiver. He set school records for receptions (234), receiving yards (3,400) and touchdown catches (33). Following his playing days, he became a student assistant for Sioux Falls under coach Bob Young in 1997. From 2000-04, he served as USF’s offensive coordinator and succeeded Young as head coach in 2005. He and his wife, Nicole, have two daughters, Alexis and Avery. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 19 COACHES AND STAFF Orlondo Steinauer %IJijIJĻŀĶŃIJ$ļļĿıĶĻĮŁļĿ ƉŀŁ4IJĮŀļĻ]8IJŀŁIJĿĻ8ĮŀĵĶĻĴŁļĻ ƉƑƑƐ Orlondo Steinauer was named Fresno State’s defensive touchdowns was just one shy of the CFL record set by FRRUGLQDWRU RQ'HFHPEHU+HHQWHUVKLVÀUVW the Toronto Argonauts in 2006, a team that Steinauer season leading the Bulldogs’ defense after a seven-year played on. career as a coach in the Canadian Football League with his most recent stop as the assistant head coach and Hamilton’s defense also accounted for the league’s defensive coordinator for the Hamilton Tiger-Cats. most takeaways (52), points off turnovers (184), most interceptions (tie-26) and most turnovers on downs (15) in Steinauer began his CFL career as a player in 1996 and 2015, and generated the East Division’s Most Outstanding carried over a 13-year playing career into a coaching Defensive Player in linebacker Simoni Lawrence, as well career where he vaulted up the ranks. as four 2015 CFL All-Stars in Lawrence, defensive backs Coaching Experience Craig Butler and Emanuel Davis, and defensive tackle Ted Steinauer originally joined the Tiger-Cats as their Laurent. Fresno State (2017) defensive coordinator in 2013, and was elevated to t%FGFOTJWF$PPSEJOBUPS assistant head coach (and defensive coordinator) prior In 2014, Steinauer’s defense ranked at or near the top of Hamilton Tiger-Cats (2016) to his fourth season with the team after a near historic the league in numerous defensive categories, including t"TTJTUBOU)FBE$PBDI defensive performance by his group in 2015. fewest rushing yards per game (76.8, 1st), average yards %FGFOTJWF$PPSEJOBUPS allowed per rush (4.6, 1st) and fewest yards of net offense Hamilton Tiger-Cats (2013-15) In 2016, the Tiger-Cats owned the second-most (5656, 2nd). t%FGFOTJWF$PPSEJOBUPS interceptions (17) in the league and tied for the second- (2011) most fumble recoveries (19). They tied for third in Steinauer previously served as defensive backs coach Toronto Argonauts t%FGFOTJWF$PPSEJOBUPS JOUFSJN takeaways (44) and generated the second-most points off IRU WKH 7RURQWR $UJRQDXWV IURP DQG ÀOOHG LQ turnovers (131). Hamilton also accounted for 50 sacks DVGHIHQVLYHFRRUGLQDWRURQDQLQWHULPEDVLVIRUWKHÀQDO Toronto Argonauts (2010-12) last season, two short of the league-high. 12 weeks of the 2011 season. In 2012, Steinauer helped t"TTJTUBOU$PBDI %#T direct a stingy Argos defense that allowed opponents to Individually, Hamilton accounted for four of the 12 East complete just 58.8 percent of their passes – best in the Personal Division all-star positions on the defensive side of the ball CFL – while surrendering just 269 passing yards per game. Hometown in John Chick (DE), Ted Laurent (DT), Simoni Lawrence The Argos also registered the second-most interceptions (LB) and Emanuel Davis (DB). Chick recorded 14 sacks (24) and allowed the second-fewest touchdowns (27). t4FBUUMF 8BTI and four forced fumbles while Laurent posted eight sacks Education – the d-line duo accounted for 22 of the team’s 50 sacks. ,QWKUHHVHDVRQVXQGHU6WHLQDXHUWKH$UJRVSODFHGÀYH t8FTUFSO8BTIJOHUPO Lawrence had the league’s fourth-most tackles (89) and defensive backs on the East Division All-Star team Playing Exp. Davis had the league’s third-most interceptions (5). Chick DQG WZR RQ WKH &)/ $OO6WDU WHDP LQFOXGLQJ ÀUVW\HDU would later be named to the CFL All-Star team. cornerback Pat Watkins in 2012. t5PSPOUP"SHPOBVUT t)BNJMUPO5JHFS$BUT Two seasons ago, the Tiger-Cats scored eight touchdowns As a player, Steinauer captured two Grey Cup rings in 13 t0UUBXB3PVHI3JEFST on defense, including six interception returns and two seasons as a dominant defensive back. After beginning his t8FTUFSO8BTIJOHUPO %# fumble returns for touchdowns. The eight defensive career with the Ottawa Rough Riders in 1996, he would Family touchdowns were the second highest total in franchise spend four years with the Tiger-Cats and eight seasons t8JGF(JOB history (10 – 1971), and was exactly double the amount with the Argonauts. Renowned for his intelligence on the produced by the next closest CFL team in 2015, and ÀHOG6WHLQDXHU ZDVQDPHGDQ DOOVWDUDWWKUHHGLIIHUHQW t$IJMESFO,JBOB 3IFZOB nearly one quarter of the defensive touchdowns generated positions (cornerback, halfback and safety), earning six 5BFZB by the entire league. The unit’s six interception return (DVW$OO6WDUQRGVDQGÀYH&)/$OO6WDUKRQRUVLQWRWDO His 1,178 interception return yards are the second most in CFL history. Steinauer began his coaching career in earnest in 1996 when he worked as the defensive backs coach at Western Washington, his alma mater, during the off-season – a role he would continue until 1998. A native of Seattle, Washington, Steinauer joined Sportsnet as their CFL Insider in 2009 and established ‘The Ozone,’ a foundation focused on improving the quality of life for those less fortunate. 20 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF Jamar Cain %IJijIJĻŀĶŃIJ-ĶĻIJ ƉŀŁ4IJĮŀļĻ]/IJń.IJŅĶİļ4ŁĮŁIJ ƊƈƈƊ -DPDU&DLQHQWHUVKLVÀUVWVHDVRQDVWKH%XOOGRJV· Prior to NDSU, Cain was an assistant coach for assistant coach for the defensive line. He was hired defensive lines at Wyoming (2013), Cal Poly (2009- March 23, 2017. 12), and Missouri State (2006-08). While coaching for the Cowboys, Cain was elevated to interim Cain coached the last three seasons at North defensive coordinator under head coach Dave Dakota State. He was part of NDSU’s fourth Christensen eight games into the season. DQGÀIWKVWUDLJKW)&6QDWLRQDOFKDPSLRQVKLSVLQ 2014 and 2015, and the team’s sixth consecutive Cain was a defensive graduate assistant on Frank Missouri Valley Football Conference title in 2016. Solich’s staff at Ohio in 2005, and was the Coaching Experience defensive line coach and recruiting coordinator at Fresno State (2017) Cain helped in developing 2014 Buck Buchanan Sacramento City College in 2004. t"TTJTUBOU$PBDI %- Award winner (best defensive player in the FCS) North Dakota State (2014-16) and consensus All-American Kyle Emanuel, who Cain graduated from New Mexico State in 2002 t"TTJTUBOU$PBDI %& had 19.5 sacks and 32.5 tackles for a loss his senior with a bachelor’s degree in family consumer Wyoming (2013) \HDUDQGZDVDÀIWKURXQG1)/GUDIWSLFN+HDOVR sciences. He and his wife, DeCarla, have two t"TTJTUBOU$PBDI %- coached All-American Greg Menard, a nominee children, Cosby and Cali. %FGFOTJWF$PPSEJOBUPS JOUFSJN for the 2016 Buck Buchanan Award. Cal Poly (2009-12) t"TTJTUBOU$PBDI %- Missouri State (2006-08) t"TTJTUBOU$PBDI %- Ohio (2005) t%FGFOTJWF(SBEVBUF"TTJTUBOU Sacramento City College (2014) t"TTJTUBOU$PBDI %- 3FDVJUJOH$PPSEOBUPS Personal Hometown t4BDSBNFOUP $BMJG Education t/FX.FYJDP4UBUF Playing Exp. t/FX.FYJDP4UBUF %& Family t8JGF%F$BSMB t$IJMESFO$PTCZ $BMJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 21 COACHES AND STAFF Jamie Christian 3łĻĻĶĻĴ#Įİĸŀ4ĽIJİĶĮĹŁIJĮĺŀ$ļļĿıĶĻĮŁļĿ ƉŀŁ4IJĮŀļĻ]$IJĻŁĿĮĹ8ĮŀĵĶĻĴŁļĻ ƉƑƑƑ -DPLH &KULVWLDQ HQWHUV KLV ÀUVW VHDVRQ DW )UHVQR three honors from the American Athletic State as an assistant coach for running backs as Conference as freshman Demarcus Ayers was well as serving as the Bulldogs’ special teams named the league’s Co-Special Teams Player of coordinator. He was hired on December 6, 2016. WKH 22 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF Ryan Grubb 0ijijIJĻŀĶŃIJ-ĶĻIJ3łĻ(ĮĺIJ$ļļĿıĶĻĮŁļĿ ƉŀŁ4IJĮŀļĻ]#łIJĻĮ7ĶŀŁĮ ƉƑƑƑ 5\DQ*UXEEHQWHUVKLVÀUVW\HDUDW)UHVQR6WDWHIROORZLQJWKUHH attack was extremely potent, racking up 2,705 yards on the ground seasons at Eastern Michigan. Grubb will serve as the Bulldogs’ and 31 touchdowns. That number ranked 18th in Division II and offensive line coach and run game coordinator. He was hired on was an increase of more than 1,300 yards from the previous season December 24, 2016. Grubb’s 2012 quick-strike offense played a vital role in USF’s As the offensive line coach at EMU, he guided an experienced unit inaugural NCAA success (Division II). Nationally, the Cougar in 2016: a line that had 166 combined starts under its belt. The RIIHQVHUDQNHGWKLQSDVVLQJHIÀFLHQF\ WKLQSDVVLQJ group combined to allow the eighth-fewest sacks in the nation by offense (253.50) and 49th in scoring (31.3 ppg). Within the allowing a program record-low of 13 sacks, as well as the second- conference, USF ranked sixth in passing offense. His high-powered fewest tackles for a loss in the nation. unit scored 40 points or more on four occasions, including a 54-point explosion against Upper Iowa University, while tallying an Grubb’s line produced two postseason All-MAC linemen in Cole impressive 60 plays of 25 yards or more, 15 of which resulted in Gardner and Andrew Wylie at seasons end. DWRXFKGRZQ*UXEEPHQWRUHGÀYHDOOFRQIHUHQFHVHOHFWLRQVDQG two Don Hansen All-Region honorees in 2012. Coaching Experience Eastern Michigan ranked 35th in the FBS in total offense, posting Fresno State (2017) 455.2 yards per game in 13 contests. The team also shattered In 2011, Grubb’s youthful offense posted 347 total yards per game t"TTJTUBOU$PBDI 0-3($ the school record for total yards team offense with 5,917 yards, en route to 31.2 points per contest. The Cougar scoring attack was breaking the previous record of 5,010. HVSHFLDOO\HIÀFLHQWLQWKHUHG]RQHZKHUHWKH\FRQYHUWHGSHUFHQW Eastern Michigan (2014-16) of their chances, 66 percent of which resulted in a touchdown. t"TTJTUBOU$PBDI 0- Total offense was not the only school record EMU bested in 2016 as the Eastern Michigan offense set team season records for points 7KH&RXJDURIIHQVHWKULYHGLQLWVÀUVW\HDUXQGHUWKHFRPPDQGRI Sioux Falls (2007-13) VFRUHG SDVVLQJ \DUGV WRXFKGRZQ SDVVHV ÀUVW Grubb. During the 2010 season, the USF offense led the GPAC in t0ČFOTJWF$PPSEJOBUPS downs (303), pass completions (309), plays (999) as well single- SDVVRIIHQVH \GVJP VFRULQJRIIHQVH SWVJP DQG game plays (99). The squad racked up the second-most touchdowns total offense (432.6). In the NAIA, USF’s offense ranked third in t"TTJTUBOU$PBDI 0-3($ (47) and rushing TDs (21) in a season and the second-most single- scoring offense (577 pts) and fourth in pass offense (3,821 yds). (2005-06) JDPHWRXFKGRZQ DQGÀUVWGRZQV Under Grubb, senior receiver Jon Ryan was named the NAIA South Dakota State Football Player of the Year and the GPAC Offensive Player of t"TTJTUBOU$PBDI 833# On the ground, the team produced the seventh-most yards rushing the Year. Coach Grubb saw 15 offensive players grab GPAC All- Kingsley-Pierson HS in program history (2,068). &RQIHUHQFHKRQRUVWKUHHRI ZKLFKZHUHKRQRUHGRQWKHÀUVWWHDP (Iowa) (2003-04) 'XULQJ WKH FDPSDLJQ (08 ÀQLVKHG WKH \HDU ZLWK Entering the 2010 season, the USF offense had the tough task t0ČFOTJWF$PPSEJOBUPS WRXFKGRZQVDPDUNWKDWWLHGIRUWKHÀIWKPRVWLQDVLQJOHVHDVRQ of replacing seven starters from the previous season, including in program history, while its 4,560 yards of total offense was also the quarterback position. Transfer Jon Eastman stepped into the WKHÀIWKPRVW2QWKHJURXQG(08FKXUQHGRXWWKHWKEHVW TXDUWHUEDFNSRVLWLRQDQGÀOOHGWKHYRLGH[FHSWLRQDOO\'XULQJWKH Personal single-season rushing total at 1,894 yards. 2010 season, he connected with Jon Ryan for 24 touchdowns, setting a school and NAIA record for touchdown receptions in a Hometown ,Q KLV ÀUVW VHDVRQ DW (08 *UXEE·V RIIHQVLYH OLQH KHOSHG WKH season. Eastman made his mark in the USF record books by taking offense racked up 1,654 yards on the ground and 1,821 yards over the sixth spot in career touchdowns with 45 touchdown tosses t,JOHTMFZ *PXB through the air. in just one season. Education Before arriving to Eastern Michigan, Grubb spent seven seasons The 2009 offensive line provided spectacular blocking for both t#VFOB7JTUB #" DW WKH 8QLYHUVLW\ RI 6LRX[ )DOOV WKH ÀUVW WKUHH DV WKH UXQ JDPH USF’s running backs and NAIA Player of the Year quarterback t4PVUI%BLPUB4UBUF ." coordinator and offensive line coach followed by four seasons as Lorenzo Brown on the way to the program’s fourth national title. the offensive coordinator. Grubb shared the same sideline with The Cougar offense set school records for points in a game (80), Playing Exp. current Bulldog offensive coordinator Kalen DeBoer from 2007- points per game (51.6), points in a season (775), total offense (7,313 09 at USF and took over DeBoer’s OC duties upon his departure. yards), rush offense (3,842) – and the most rushing yards by a team t#VFOB7JTUB 3#83 LQWKH1$,$6HQLRUV7-:HQGWDQG.\OH6WDXGWHDUQHGÀUVWWHDP During Grubb’s time at Sioux Falls, the team posted an astonishing All-GPAC honors, while the Cougars other three starting offensive Family 75-13 (.852) record, as Grubb helped guide USF to two national linemen, Travis Beaver, Kyle Wasson and Casey Peters, found t8JGF4UFQIBOJF championships and four Great Plains Athletic Conference themselves on either the second-team or honorable mention list championships. for the conference. The unit only gave up 14 sacks in 15 games. During the 2013 campaign, the Cougars’ offense averaged 33.0 In 2008, the offensive line paved the way to the sixth-ranked points and 467.9 yards of total offense per game. The USF rushing rushing attack (235.6 yards per game) and 10th-best scoring attack (36.5) in the country, while only giving up 10 sacks in 14 games. Shawn Flanagan, Kyle Staudt and TJ Wendt earned all-conference UHFRJQLWLRQ ZKLOH :HQGW ZDV QDPHG D ÀUVWWHDP $OO$PHULFDQ and Flanagan was named second-team All-American. Grubb also served as the strength and conditioning coordinator for the USF football program and was named American Football Monthly’s NAIA National Strength and Conditioning Coach of the Year for the 2008 season. Prior to coaching at USF, Grubb coached wide receivers and running backs at South Dakota State University in 2005 and 2006, earning four team rushing records, four All-Great West selections, an ESPN All-American and one Hula Bowl selection while tutoring wide receiver JaRon Harris, who went on to play for the Green Bay Packers. Prior to coaching at SDSU, Grubb was the offensive coordinator at Kingsley-Pierson High School in Iowa, producing six all-state selections and was named the 2004 Class 1A Assistant Coach of the Year. Grubb, who’s hometown is Kingsley, Iowa, is a 1999 graduate of Buena Vista University where he was a four-year starter and team captain. Grubb earned his master’s in sports administration at South Dakota State University in 2006. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 23 COACHES AND STAFF Kirby Moore 8ĶıIJ3IJİIJĶŃIJĿŀ ƉŀŁ4IJĮŀļĻ]#ļĶŀIJ4ŁĮŁIJ ƊƈƉƊ .LUE\ 0RRUH MRLQV )UHVQR 6WDWH DV D ÀUVW\HDU In 2014, Moore’s season in between his playing wide receivers coach following two years as a days at Boise State and serving as a graduate graduate assistant at Washington. He was hired on assistant at Washington, he coached the wide December 6, 2016. receivers at the College of Idaho. Moore, a former wide receiver at Boise State, As a senior in 2013, Moore caught 36 passes for reunited with college coach Chris Petersen at 280 yards despite missing six games due to injury. Washington, and was alongside Jeff Tedford while In 2012, he was the team’s second-leading receiver he was an offensive consultant for the Huskies in with 36 catches for 368 yards. Following the 2013 Coaching Experience 2016. season, he earned Academic All-District VII and Fresno State (2017) Academic All-Mountain West Conference honors. t"TTJTUBOU$PBDI 83 The Boise State grad earned four varsity letters Washington (2015-16) as a Bronco (2009, 2011-13), lettering on a 14-0 As a freshman, united with older brother and t0ČFOTJWF(SBEVBUF"TTJTUBOU team as a true freshman in 2009. After redshirting current NFL quarterback, Kellen Moore, the two College of Idaho (2014) the 2010 season, he helped Boise State compile a were a part of the Broncos’ 2010 Fiesta Bowl win t"TTJTUBOU$PBDI 83 UHFRUGRI RYHUKLVÀQDOWKUHHVHDVRQV over TCU. Both brothers attended Prosser High in Washington, where Kirby set a national record Personal As a G.A. who worked with Washington’s wide with 95 career touchdown receptions. Playing receivers corps, Huskies’ wideouts John Ross IRUKLVIDWKHU7RP0RRUHKHZDVÀUVWWHDPDOO Hometown and Dante Pettis led the nation in touchdown state as a junior and senior and was named the t1SPTTFS 8BTI receptions as a duo with 32 in 2016. Ross was Washington 2A Player of the Year as a senior, Education QDPHG D ÀUVWWHDP $OO3DF VHOHFWLRQ 7KH when he had 131 receptions for 2,126 yards and t#PJTF4UBUF Huskies won the Pac-12 Championship and 34 TDs. Playing Exp. DGYDQFHGWRLWVÀUVW&ROOHJH)RRWEDOO3OD\RII EHUWK t#PJTF4UBUF 83 to cap a standout season. 24 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF Scott Thompson 5ĶĴĵŁ&Ļıŀ ƉŀŁ4IJĮŀļĻ]'ĿIJŀĻļ4ŁĮŁIJ ƊƈƉƈ Scott Thompson, a Fresno State alum, enters his Prior to joining the college ranks, Thompson ÀUVWVHDVRQFRDFKLQJWKH%XOOGRJWLJKWHQGV+H coached at Crespi High School (CA) from 2004- was hired on December 6, 2016. 2009. He was the offensive coordinator while also focusing on quarterbacks and tight ends. Thompson spent the previous seven seasons at Southern California, holding positions of Thompson, a former Fresno State tight end, director of player personnel (2010-14), director lettered from 1995-98, and was coached by then- RI VFRXWLQJKLJKVFKRROUHODWLRQV DQGDVDQ offensive coordinator Jeff Tedford during his offensive assistant that helped with the tight ends freshman, sophomore and junior seasons. As Coaching Experience and specials teams (2016). a senior, Fresno State quarterback Billy Volek Fresno State (2017) connected with Thompson for 31 receptions and t"TTJTUBOU$PBDI 5& He managed all aspects of USC recruiting and 375 yards and a touchdown. His older brother, USC (2010-16) VXSHUYLVHG DOO RIÀFLDO DQG XQRIÀFLDO YLVLWV IRU Marty Thompson, played three seasons in the t"TTJTUBOU$PBDI 5&45 nearly six years, assisting in the Trojans bringing in NFL after a standout Fresno State career from t %JSFDUPS PG 4DPVUJOH)JHI 4DIPPM ÀUVWWHDP$OO3DFVHOHFWLRQVIURP 1989-92. 3FMBUJPOT t%JSFDUPSPG1MBZFS1FSTPOOFM Before the June Lake, California native returned Tennessee (2009) home in 2010, he spent the 2009 season at t0ČFOTJWF"TTJTUBOU 5&3# 7HQQHVVHH DV DQ RIIHQVLYH DVVLVWDQW WLJKW HQGV Crespi HS (2004-09) running backs). Thompson assisted the Volunteers t0ČFOTJWF$PPSEJOBUPS LQRSSRQHQWÀOPEUHDNGRZQDQGHYDOXDWLRQDQG assisted in week-to-week game planning. Personal Hometown t-BLF+VOF $BMJG Education t'SFTOP4UBUF Playing Exp. t'SFTOP4UBUF 5& Family t8JGF"MJTF t$IJMESFO$IBSMPUUF (MFOO 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 25 COACHES AND STAFF Bert Watts -ĶĻIJįĮİĸIJĿŀ ƉŀŁ4IJĮŀļĻ]$ĮĹĶijļĿĻĶĮ ƊƈƈƋ %HUW:DWWVHQWHUVKLVÀUVWVHDVRQDW)UHVQR6WDWH Wright was selected honorable mention after and will serve as the linebackers coach. He was leading the team with nine PBUs. hired on December 7, 2016. Pitts returned to the All-Big Sky honorable Watts was most recently the defensive coordinator mention squad in 2014 and was joined by safety for four seasons at UC Davis under Aggie head Charles Boyett. football coach Ron Gould; his position group focus was with the defensive backs. In 2016, defensive tackle Inoke Raikadroka was named a second-team selection after compiling Coaching Experience Watts’ history with Jeff Tedford dates back to his 24 tackles, 3.5 TFLs, 1.0 sacks and one fumble Fresno State (2017) playing days at Cal, and later as a graduate assistant recovery in nine games played. Defensive tackle t"TTJTUBOU$PBDI -# at Cal. Zak Pettit, inside linebacker Nas Anesi, cornerback UC Davis (2013-16) Keleen Culberson and safety Zach Jones earned t%FGFOTJWF$PPSEJOBUPS :DWWV· ÀUVW VHDVRQ RYHUVHHLQJ WKH 8& 'DYLV honorable mention recognition. Denver Broncos (2012) defense in 2013 resulted in four of his players t4UBČ"TTJTUBOU earning postseason recognition from the Big Sky Watts joined the UC Davis staff after also gaining Colorado (2010-11) Conference while it added two the next season and coaching experience at the collegiate level and t%FGFOTJWF5FDIOJDBM*OUFSO ÀYH PRUH KRQRUV IURP WKH FRQIHUHQFH LQ overseas. Watts spent 2012 with the Denver Bishop Kenny HS (Fla.) (2009) UCD held Southern Utah to 260 total yards in a Broncos, who went on to earn the top seed in the t%FGFOTJWF$PPSEJOBUPS contest on Oct. 8 — the school’s best defensive AFC playoffs. Prior to that, he spent two seasons Bartram Trial (Fla.) (2008) effort since 2013. A week later at Northern at the University of Colorado as the Buffaloes’ t"TTJTUBOU$PBDI 5& Colorado on Oct. 15, the Aggies allowed only 269 defensive technical intern. Raiffeisen Vikings-Austria yards. It marked the best back-to-back defensive (2007) performances at the time in the Big Sky. Watts, who also coached two years of high school t%FGFOTJWF$PPSEJOBUPS in Florida, was the defensive coordinator for the California (2004-05) In 2012, defensive lineman Nick King was a second- Raiffeisen Vikings in Austria in 2007. t%FGFOTJWF(SBEVBUF"TTJTUBOU team pick after amassing eight sacks, cornerback Jonathan Perkins had four pass breakups on his He moved into coaching after playing for Cal where Personal way to third-team accolades, linebacker Steven he led the Bears with 80 tackles as a senior in 2002, Hometown Pitts earned honorable mention after tallying 74 highlighting his year with a career-best 15 tackles t#BTLJOH3JEHF /FX+FSTFZ tackles and 11.5 TFLs, and cornerback Shamawn at USC. The starting senior safety was the leading Education WDFNOHUIRUWKDWVHDVRQZKLFKZDV7HGIRUG·VÀUVW t$BMJGPSOJB #" *ROGHQ %HDU IRRWEDOO WHDP )ROORZLQJ KLV ÀQDO t$BMJGPSOJB ." season, the three-year letterman was the recipient of the team’s Joe Roth Award, which is given Playing Exp. WR WKH SOD\HU WKDW H[HPSOLÀHV VXSHULRU FRXUDJH t$BMJGPSOJB %# attitude and sportsmanship. Family t8JGF-ZOETBZ The Basking Ridge, N.J. native continued his t$IJMESFO7FEEFS football career as a graduate assistant coach under Tedford during the 2004 and 2005 seasons - helping the team to a combined 18-6 mark, including a 10-2 season in 2004 that ended with a berth in the Holiday Bowl. Watts earned his undergraduate and graduate degrees in education from California and is married to Lyndsay Graubard. They have a 3-year- old son, Vedder. 26 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF J.D. Williams %IJijIJĻŀĶŃIJ#Įİĸŀ 1st Season | Fresno State (1997) After the past two seasons at UNLV, former Bulldog 'XULQJ WKH ÀUVW JRDURXQG DW 81/9 :LOOLDPV player and coach J.D. Williams returns to Fresno served two seasons (2010-11) as the Rebels’ assistant State for his third coaching stint at Fresno State. head coach, secondary coach and pass defense He was hired on December 6, 2016 to coach the coordinator before he was elevated to defensive %XOOGRJV·GHIHQVLYHEDFNVXQGHUÀUVW\HDUKHDGFRDFK coordinator in 2012, when he continued to coach the Jeff Tedford. defensive backs. A wide receiver turned cornerback at Fresno State Williams went to UNLV after spending the 2009 IURP KH LV RQH RI ÀYH %XOOGRJV WR KDYH season as the cornerbacks coach at Utah. The EHHQVHOHFWHGLQWKHÀUVWURXQGRI WKH1)/'UDIW Utes posted a 10-3 record, including a victory over Coaching Experience (16th overall by the Buffalo Bills, 1990) in school Washington in the Poinsettia Bowl, and ranked 16th Fresno State (2017) history. Williams was an AP honorable mention All- in the nation in passing yards allowed and ninth in t"TTJTUBOU$PBDI %# American in 1988, and a second-team Sporting News SDVVHIÀFLHQF\GHIHQVH UNLV (2015-16) All-American and a third-team AP All-American in t"TTJTUBOU$PBDI %# 1989. During his seven-year professional career, he He joined Utah after seven years working in Pac-10. Georgia State (2013-14) was a member of all four Bills’ teams that advanced Williams was the defensive backs coach at Washington t"TTJTUBOU$PBDI %#45 to the Super Bowl from 1991-94. from 2006-08. He went to Washington after four UNLV (2010-12) seasons coaching the secondary at California. t%FGFOTJWF$PPSEJOBUPS Williams was a G.A. one season under Pat Hill t"TTJTUBOU)$QBTTEFGFOTFDP- (1997) – Tedford was on that staff as the offensive Under then-head coach Jeff Tedford, the Bears PSEJOBUPS%FGFOTJWF#BDLT$PBDI coordinator. And returned as an assistant coach amassed a 33-17 record and played in three bowl under Pat Hill from 2000-01. games during Williams’ stay from 2002-05. In 2005, Utah (2009) &DOOHGWKH3DFLQSDVVHIÀFLHQF\GHIHQVH WKLQ t"TTJTUBOU$PBDI %# 0RVW UHFHQWO\ :LOOLDPV ÀQLVKHG KLV VHFRQG VHDVRQ WKHQDWLRQ DQGÀQLVKHGVHFRQGLQWKHOHDJXHLQWRWDO Washington (2006-08) of his second stop at UNLV. He returned to Las defense. In 2004, Cal ranked eighth in the nation in t"TTJTUBOU$PBDI %# Vegas after serving as the defensive backs coach and scoring defense and 24th in total defense. California (2002-05) special teams coordinator at Georgia State for two t"TTJTUBOU$PBDI %# seasons (2013-14). Prior to going to Berkeley, Williams served two Fresno State (2000-01) seasons as secondary coach at his alma mater, Fresno t"TTJTUBOU$PBDI %# In 2013, the GSU special teams featured all- State, from 2000-01. Fresno State posted an 18-7 San Jose State (1999) conference return specialist Albert Wilson, who record and made back-to-back Silicon Valley Bowl t"TTJTUBOU$PBDI %# UDQNHGLQWKHWRSÀYHLQWKH6XQ%HOW&RQIHUHQFHLQ appearances. Cal Poly (1998) both punt returns and kickoff returns. He is now a t"TTJTUBOU$PBDI %# member of the Kansas City Chiefs. He also coached the secondary at Cal Poly in 1998 Fresno State (1997) and San Jose State in 1999. He began his t(SBEVBUF"TTJTUBOU coaching career in 1997 as a Fresno State graduate assistant. Personal As a player, in addition to being named an Hometown All-American, he was a two-time all-Big t'SFTOP $BMJG :HVWÀUVWWHDPVHOHFWLRQDQGWKH'HIHQVLYH Education MVP of the East-West Shrine. He was t'SFTOP4UBUF also a standout triple jumper and sprinter, winning the 1986 Big West triple jump Playing Exp. crown and competing on the conference t4BO'SBODJTDPFST championship 4x100-meter relay team that t"SJ[POB$BSEJOBMT set a school record of 40.18. In 2002, he t#VČBMP#JMMT was inducted into the Fresno Athletic Hall t'SFTOP4UBUF %# of Fame. Family t8JGF+BNJF Williams earned his bachelor’s degree in t$IJMESFO/JDPMF ,ZSB ;PF criminology from Fresno State in 1997. %BWJE He and his wife, Jamie, have four children: Nicole, Kyra, Zoe and David. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 27 COACHES AND STAFF Andy Ward )IJĮı4ŁĿIJĻĴŁĵŗ$ļĻıĶŁĶļĻĶĻĴ Brian Wilkinson $ļĮİĵ 'ļļŁįĮĹĹ %ĶĿIJİŁļĿļij0ĽIJĿĮŁĶļĻŀ ƉŀŁ4IJĮŀļĻ]$ĮĹ4ŁĮŁIJ4ŁĮĻĶŀĹĮłŀ ƊƈƈƑ ƉŀŁ4IJĮŀļĻ]$ĮĹĶijļĿĻĶĮ$ļĮŀŁ6ĻĶŃ ƊƈƉƎ Andy Ward was named Fresno State’s head football strength and %ULDQ:LONLQVRQKLUHG'HFHPEHUHQWHUVKLVÀUVWVHDVRQDV conditioning coach on January 8, 2017. He joins the program after the director of football operations at Fresno State. He brings more six years at Stanford. than 10 years of football operations experience to the Bulldog football program. Ward worked full-time with the Cardinal football program for the past three seasons and with the team for the last six seasons. Before Wilkinson has also served as a member of the College Football going full-time with football, he also oversaw developing strength Playoff Advisory Board for Operations and was the Alabama team WUDLQLQJDVSHFWVIRUWKH&DUGLQDOWUDFNDQGÀHOGSURJUDP liaison for the 2016 National Championship Game. Prior to arriving at Stanford, Ward split the 2010-11 academic year The veteran of the position has led the postseason operations for with internships at UC San Diego and Sacramento State. At UC four bowl games – Poinsettia Bowl (2015), Fiesta Bowl (2014), San Diego, Ward assisted with the design and implementation of GoDaddy Bowl (2013), and Gildan New Mexico Bowl (2011) – and VSRUWVSHFLÀFSURJUDPV+LVWLPHDW6DFUDPHQWR6WDWHZDVVSHQW was an assistant for the 2007 Armed Forces Bowl. implementing programs for the men’s soccer, women’s soccer and men’s golf teams while assisting with 11 other programs. Wilkinson was last the operations director for the U19 World Championships for USA Football in Harbin, China, and was Ward earned an undergraduate degree in physical education from responsible for its day to day operations and team travel to and from Cal State Stanislaus in 2009, where he was a student assistant in the China as well its daily schedule and logistics. strength program while serving as a performance trainer at nearby Custom Built Personal Training. Wilkinson spent the previous two seasons (2014-15) as the director of football operations at Boise State, remaining on Bryan Harsin’s The Sutter, California native earned his master’s degree in exercise staff once he transitioned from Arkansas State. In one season with science at California University (Pa.). Harsin at Arkansas State in 2013, Wilkinson served as the team’s assistant athletic director for football operations. Prior to joining Arkansas State, Wilkinson was Wyoming’s director of football operations from 2011-12. He also spent time at California, alongside Jeff Tedford, as the DVVLVWDQWGLUHFWRURI IRRWEDOORSHUDWLRQVÀUVWIURPDQGWKHQ from 2010 until accepting his position with the Cowboys. Between stints with the Golden Bears, Wilkinson worked with Sacramento State as its director of football operations from 2008-09. %HIRUH DFFHSWLQJ KLV ÀUVW DVVLVWDQW GLUHFWRU RI RSHUDWLRQV SRVLWLRQ at Cal, he served as the Golden Bears equipment manager from 2003-05. Also while at Cal, Wilkinson was the director of softball operations from 2005-06. Wilkinson served in the United States Air Force from 1991-94. After the military, he was a minor league clubhouse manager and equipment manager for the Oakland Athletics. He earned a bachelor’s of science degree in management from California Coast University in 2016. He and his wife, Tami, have two sons, Bryce and Tyler. 28 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE COACHES AND STAFF Spencer Harris Brad Vonnahme %ĶĿIJİŁļĿļij1ĹĮņIJĿ1IJĿŀļĻĻIJĹ 0ijijIJĻŀĶŃIJ"ĻĮĹņŀŁ 1st Season | 8ĮŀĵĶĻĴŁļĻ ƊƈƉƍ ƊĻı4IJĮŀļĻ]6ŁĮĵ4ŁĮŁIJ ƊƈƉƉ 6SHQFHU+DUULVLVLQKLVÀUVWVHDVRQDVWKHGLUHFWRURI SOD\HUSHUVRQQHO Brad Vonnahme is in his second season as an offensive analyst for the for the Bulldog football program. He was hired on December 6, 2016. Bulldog football coaching staff. Harris was last on staff at the University of Washington, joining the The Omaha, Neb., native comes to Fresno State after spending a year program in April 2012. He rose sharply within the Husky football (2014) as a graduate assistant coach at Hawai`i and a year on staff at program as he learned how to manage staff needs, identify and Utah State (2015). evaluate prospects, manage scholarship numbers, organize recruit Vonnahme spent the 2013 season as linebackers coach and special visits and market the program under the mentorship of Aaron Knotts teams coordinator at Midland University in Fremont, Neb. He also (current director of player personnel at UW) and Marshall Malchow assisted with the strength and conditioning program. Prior to that, (current director of player personnel at Georgia). he was a graduate assistant at Wayne State College in Wayne, Neb., from 2011-12. Harris last served as an assistant director of player personnel for the Huskies during the 2016 season. Before that, he was Washington’s During his two-year stint as defensive administrative assistant at Utah head recruiting specialist from May 2015 until being elevated to 6WDWH IURP 9RQQDKPH·V GXWLHV LQFOXGHG ÀOP EUHDNGRZQ assistant director of player personnel after the 2015 football season. preparing scouting reports and running the scout teams. From 2006-08, Vonnahme served as a student manager at the +HJUDGXDWHGZLWKDGHJUHHLQÀQDQFHIURP:DVKLQJWRQLQ0DUFK University of Nebraska before transferring to USU, where he earned 2015, and while a student, Harris was on staff as a recruiting specialist his bachelor’s degree in interdisciplinary studies in 2011. He also for the 2014 season after initially joining the program in 2012 as a earned a master’s degree in sport management from Wayne State in student equipment manager. 2013. Harris is a native of Sacramento, California and attended Rio He and his wife Ashley reside in Fresno. Americano High School. Lucas Gingold 4ĽIJİĶĮĹ5IJĮĺŀ2łĮĹĶŁņ$ļĻŁĿļĹ Quinn Tedford ƊĻı4IJĮŀļĻ]$ĮĹĶijļĿĻĶĮ ƊƈƉƌ "ŀŀŁ%ĶĿIJİŁļĿļij1ĹĮņIJĿ1IJĿŀļĻĻIJĹ ƉŀŁ4IJĮŀļĻ]$ĮĹĶijļĿĻĶĮ ƊƈƉƉ Lucus Gingold (pronounced GHIN-gold) enters his second season at Fresno State serving as a special teams quality control assistant. He joined the staff 4XLQQ7HGIRUGLVLQKLVÀUVWVHDVRQDVWKHDVVLVWDQWGLUHFWRURISOD\HU on June 20, 2016. personnel for the Bulldog football program. Prior to joining the Bulldogs, Gingold was on staff at Clovis West High School. He spent the last four seasons as an assistant coach in various Gingold played collegiately at the University of California from 2012-14 after capacities. Tedford was last with the BC Lions of the CFL in 2015 as WZRVHDVRQVDW5HHGOH\&ROOHJH+HUHGVKLUWHGKLVÀUVW\HDUDW&DOEHIRUH playing in all 12 games and starting four as a redshirt junior during the 2013 DQRIIHQVLYHTXDOLW\FRQWURODVVLVWDQWZLGHUHFHLYHUVFRDFK3ULRUWR season, and then saw action in six games as a senior in 2014 before suffering a WKDWKHVSHQWWKHVHDVRQDVDQRIIHQVLYHLQWHUQZLGHUHFHLYHUV season-ending injury. He spent most of that stretch as the team’s top fullback coach with the Tampa Bay Buccaneers. At UC Davis in 2013, he ZLWKEORFNLQJKLVSULPDU\UHVSRQVLELOLW\6WDWLVWLFDOO\KHÀQLVKHGZLWKIRXU receptions for 41 yards and one touchdown catch during his Cal career. served in the same capacity as his time with the BC Lions. Tedford began his venture into coaching in 2012 on his father’s staff where he As a senior, Gingold earned a scholarship during training camp after initially joining the squad as a walk-on and was subsequently named a team season served as a volunteer assistant wide receivers coach at Cal. captain. He also served as game captain in a contest vs. Arizona. $VD-X&RSOD\HUKHZDVDÀUVWWHDP$OO&HQWUDO9DOOH\&RQIHUHQFHVHOHFWLRQ He joined the Golden Bears’ staff after playing in Berkeley from during his 2011 sophomore season as a fullback. 2008-11 where he graduated with a degree in sociology. A Fresno native, Gingold attended Buchanan High School where he was a second-team All-Valley selection who was also a team captain and his squad’s outstanding lineman of the year as a 2009 senior center for a club WKDWÀQLVKHGRYHUDOODQGZRQLWVVHFRQGVWUDLJKW7UL5LYHU/HDJXHWLWOH with a 5-0 conference mark. He graduated from Cal in December of 2014 with a bachelor’s degree in sociology. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 29 COACHES AND STAFF TEAM DOCTORS Josh harper Head Team Physician %ĶĿIJİŁļĿļij Matt Lea %S&SJD)BOTPO 0Ļ$Į弳ŀ3IJİĿłĶŁĶĻĴ ("%IJijIJĻŀIJ Family Practice/Sports Medicine 'ĿIJŀĻļ4ŁĮŁIJ ƊƈƉƌ 6/-7 ƊƈƉƎ %S3PE,SBę Former Fresno State wide receiver Josh Harper was 0DWW /HD UHWXUQV KRPH WR )UHVQR IRU KLV ÀUVW VHDVRQ DV D Internal Medicine announced as the program’s Director of On-Campus defensive graduate assistant for the Bulldogs. He will assist %S+FBO-JOEFS Recruiting on June 16, 2017. with the linebackers. The Fresno native, who attended Central High School, joins General Surgeon Harper’s playing career at Fresno State spanned from the Bulldogs after a collegiate playing career at UNLV. %S8JMMJBN$BSWFUI 2010-14, in that time he became the program’s second- leading receiver in receptions (228) and touchdown Lea, a three-year starting linebacker, started 23 games and Orthopedics catches (29) while amassing 2,938 yards receiving in 41 SOD\HGLQJDPHVGXULQJKLVFDUHHU,QKLVÀQDOVHDVRQ %S4UFWFOćBYUFS JDPHV SOD\HG +H ZDV D ÀUVWWHDP $OO0RXQWDLQ he started eight games and played in all 12. He recorded 30 tackles and one sack a season ago. West selection and a 2013 All-MW second-team selection. Orthopedics (Upper Extremity) Lea is a 2012 graduate of Central HS under coach Casey %S$BSZ5BOOFS After his playing career as a Bulldog, Harper had stints Quinn. He was a three-year letterwinner that earned All-Tri- in the NFL and CFL. Harper was signed by the Oakland River Athletic Conference honors all three seasons on the Orthopedics (Foot/Ankle) ÀHOG %S'SBODJT(MBTFS Raiders as an undrafted free agent in May 2015 and attended training camp. The following season the Calgary He earned a bachelor’s degree in criminal justice in the spring Orthopedics Stampeders signed Harper. An ongoing battle with various of 2016. (SFH.FMMPS 1"$ injuries hampered making his push in either league. Physiatrist Harper joined Oregon State’s staff as a recruiting assistant +FSSZ8JFOT .% from June 2016-April 2017 and gave it one more try with football and received multiple contract offers this spring, Team Dentist but suffered a hamstring injury that led him to retiring C.J. McGorisk %S9BWJFS(VUJFSSF[ from the gridiron. ("%IJijIJĻŀIJ Opthamologist .ĶİĵĶĴĮĻ ƊƈƉƎ %S"OESFX.BYXFMM &- 0F*RULVN HQWHUV KLV ÀUVW \HDU ZLWK )UHVQR 6WDWH DV D defensive graduate assistant. Chiropractic Care %S.BSL.PMUIFO McGorisk spent four seasons (2013-2016) at the University Dylan Chmura of Michigan holding various positions. During his time at Michigan he worked as a defensive student assistant, strength ("0ijijIJĻŀIJ & conditioning intern and student equipment manager. .ĶİĵĶĴĮĻ4ŁĮŁIJ ƊƈƉƏ He earned his bachelor’s degree in Movement Science from '\ODQ &KPXUD HQWHUV KLV ÀUVW \HDU DV DQ RIIHQVLYH the University of Michigan. graduate assistant at Fresno State. He will assist with the offensive line. McGorisk is a native of Wixom, Michigan and attended Walled Lake Western High School. Chmura is a former student-athlete at Michigan State (tight end) and student coach for the Spartans. ADDITIONAL FOOTBALL SUPPORT STAFF He joined the Spartans’ staff as a student coach in the summer of 2016, foregoing two seasons of eligibility in respect to multiple concussions suffered. He saw action in 10 games as a third-year sophomore in 2015 and played in 13 games as a redshirt freshman in 2014. Chmura completed his bachelor’s degree in Interdisciplinary Studies of Social Science in the spring of 2017. Henry Adelman Michael Adsit Willy Peterson Travis Brown Clare Flores-Coleman Luis Contreras S&C Assistant Football Graphic Design Video Coordinator Defensive Student Asst. Football Admin Asst. Football Assistant The Waukesha, Wis. native out of Waukesha West High School joined MSU as one of the nation’s top tight end recruits – ranked by MaxPreps.com (No. 24) and Rivals. com (No. 35). His father Mark Chmura played tight end at Boston College and spent seven years with the National Football League’s Green Bay Packers (1993-99). Alyssa De La Vega Charles Flood Roland Ford Alex Jones Tracy Keller Kyle Leslie Football Admin Asst. Equipment Room Compliance Coordinator Asst. Strength Coach Student-Athlete Services Asst. Dir. of Compliance D.J. Harper ("0ijijIJĻŀIJ #ļĶŀIJ4ŁĮŁIJ ƊƈƉƊ Sean McMannes Tom Milord Ryan Raymond Bobby Thomas Craig Tweedy Josh Hewitt Asst. Athletic Trainer G.A. Athletic Trainer Student-Athlete Services Asst. Strength Coach Athletic Trainer Equipment Manager Additional staff on page 172 30 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES JEFFREY ALLISON’S GAME-BY-GAME 79 Tackles 2016 - Freshman UA A Total TFL-Yds INT-Yds FF FR PBU NICK AIBUEDEFE OL at Nebraska 1 2 3 0.0-0 0-0 0 0 0 Sacramento State 1 2 3 0.0-0 0-0 0 0 0 6-4 | 270 | So. | 3rd Year at Toledo 1 3 4 0.0-0 0-0 0 0 0 Sacramento, Calif. (Capital Christian HS) Tulsa 0 0 0 0.0-0 0-0 0 0-0 0 CAREER GAMES: 5 at UNLV 1 1 2 0.0-0 0-0 0 0 0 at Nevada 4 3 7 0.0-0 0-0 0 0 0 San Diego State 0 1 1 0.0-0 0-0 0 0 0 2016 (REDSHIRT FRESHMAN): 6DZDFWLRQLQÀYHJDPHV at Utah State 0 0 0 0.0-0 0-0 0 0 0 2015 (FRESHMAN): :DONHGRQWRWKHSURJUDPDQGUHGVKLUWHG Air Force 0 0 0 0.0-0 0-0 0 0 0 at Colorado State 0 1 1 0.0-0 0-0 0 0 0 HIGH SCHOOL: $WWHQGHG &DSLWDO &KULVWLDQ +LJK 6FKRRO LQ 6DFUDPHQWR Hawai’i 0 0 0 0.0-0 0-0 0 0 0 HDUQHGVHFRQGWHDPDOOFRQIHUHQFHKRQRUV LQWKH*ROGHQ(PSLUH /HDJXHDVD San Jose State 0 0 0 0.0-0 0-0 0 0 0 GHIHQVLYHHQGZDVDIRXU\HDUIRRWEDOOOHWWHUZLQQHU TOTALS 8 13 21 0.0-0 0.0-0 0 0-0 0 PERSONAL: %RUQLQ6DQ-RVH&DOLIRUQLDSDUHQWVDUH%HQDQG$EOHV$LEXHGHIH JEFFREY ALLISON’S SINGLE-GAME HIGHS Solo Tackles: 4- at Nevada, 2016 KDVWZRVLEOLQJV%LDQFDDQG&KULVPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZ Total Tackles: 7 - at Nevada, 2016 HQIRUFHPHQW TFL: N/A Sacks: N/A Forced fumble: N/A 13 Fumble recovery: N/A JUSTIN ALLEN WR 5-11 | 188 | Jr. | 4th Year 90 Los Angeles, Calif. (Mater Dei HS) CAREER GAMES: 11 KEVIN ATKINS DT 6-2 | 297 | RFr. | 2nd Year 2016 (SOPHOMORE): 3OD\HGLQRI JDPHV«UHJLVWHUHGÀUVWFDUHHUFDWFK Murrieta, Calif. (Vista Murrieta) RQ2FWDW81/9DQHLJKW\DUGJUDE«WRWDOHGIRXUFDWFKHVIRU\DUGVRQ WKHVHDVRQ«VHDVRQORQJFDWFKZDV\DUGVUHFRUGHGYV+DZDL·LRQ1RY 2015 (REDSHIRT FRESHMAN): 'LGQRWVHHJDPHDFWLRQ 2016 (FRESHMAN):5HGVKLUWHG 2014 (FRESHMAN): 5HGVKLUWHG HIGH SCHOOL: 6RXWKZHVWHUQ /HDJXH 'HIHQVLYH 093 KHOSHG OHDG WKH %URQFRVWRWKHLUVHYHQWKVWUDLJKW6RXWKZHVWHUQ/HDJXHWLWOHDQGLQWRWKH&,)66 HIGH SCHOOL:$WWHQGHG0DWHU'HLDQ2UDQJH&RXQW\$OO6WDU :HVW9DOOH\ÀQDOVIRUWKHVL[WKWLPHLQWKHODVWVHYHQ\HDUVWKH%URQFRVGURSSHG WKHFKDPSLRQVKLSJDPHWR0LVVLRQ9LHMRDIWHUSLFNLQJXSWKUHHSOD\RII PERSONAL: %RUQLQ'RZQH\&DOLIVRQRI -HUDOGDQG/\QQ$OOHQKDV ZLQVWRDGYDQFHWRWKHWLWOHJDPHFRPSLOHGWDFNOHV VROR WDFNOHVRI WKUHHROGHUEURWKHUVPDMRULQJLQDIULFDQDVWXGLHV DORVVVDFNVRQHIRUFHGIXPEOHDQGRQHSDVVGHÁHFWLRQDVDVHQLRUZKLOH OHDGLQJWKHWHDPWRDRYHUDOOUHFRUGSRVWHGWDFNOHV VROR WDFNOHV IRUDORVVVDFNVRQHIRUFHGIXPEOHDQGRQHIXPEOHUHFRYHU\DVDMXQLRUZDV 24 UDWHGDVWKH1RGHIHQVLYHOLQHPHQLQWKHVWDWHRI&DOLIRUQLD JEFFREY ALLISON ILB PERSONAL:6RQRI 5DXVKDXQDQG.HQQHWK%OXHKDVRQHVLVWHU/HH=KDQH 6-0 | 250 | So. | 2nd Year LVDSUHEXVLQHVVPDMRUDW)UHVQR6WDWH Miami, Fla. (Langston Hughes HS [Ga.]) CAREER GAMES: 12 7 2016 (FRESHMAN): 3OD\HGLQDOOJDPHVDVDWUXHIUHVKPDQ«ÀQLVKHGZLWK WDFNOHVLQFOXGLQJHLJKWVRORVWRSV«LQVL[WKFDUHHUJDPHUHFRUGHGDVHDVRQ JAMES BAILEY SAM KLJKVHYHQWDFNOHVRQ2FWDW1HYDGD«WDOOLHGRI WDFNOHVWKURXJKWKH 6-1 | 225 | Jr. | 3rd Year ÀUVWVL[JDPHVRI WKHVHDVRQ«ZDVRQWKHUHFHLYLQJHQGRI WZRSRRFKNLFNRIIV Austin, Texas (Lake Travis HS) LQDFRQWHVWYV$LU)RUFHRQ2FWWRWDOLQJUHWXUQ\DUGVDQGDORQJUHWXUQ RI HLJKW\DUGV CAREER GAMES: 24 STARTS: 15 HIGH SCHOOL:6HOHFWHGE\WKH$WODQWD-RXUQDO&RQVWLWXWLRQWRLWV$OO 2016 (SOPHOMORE): 6WDUWHGDOOJDPHVDWRXWVLGHOLQHEDFNHU«ÀQLVKHG 0HWUR&LW\6RXWK)XOWRQDQGLWV$OO5HJLRQ$$$$$$ÀUVWWHDPVSRVWHG WKHVHDVRQZLWKWDFNOHVDQGWDFNOHVIRUDORVV«ZLOOVWDQGWLHGDVWKHWHDP·V WDFNOHVHLJKWWDFNOHVIRUDORVVWKUHHVDFNVWZRIXPEOHUHFRYHULHVDQGRQH UHWXUQLQJWDFNOHVOHDGHU IRUWKHVHDVRQZLWKWHDPPDWH'H6KDZQ3RWWV LQWHUFHSWLRQKLVVHQLRU\HDUUHJLVWHUHGWDFNOHVDVDMXQLRUZKHQKHOHGKLV DIWHUW\LQJIRUWKHWKLUGPRVWVWRSVRQWKHWHDPDVDVRSKRPRUH«SRVWHGDW WHDPWRDUHFRUGDQGWKH&ODVV$$$$$$SOD\RIIVKLVWDFNOHVLQ OHDVWVL[WDFNOHVLQVL[UHVSHFWLYHJDPHV«VLQJOHJDPHVHDVRQKLJKIRUWDFNOHV OHGWKHWHDPRQDURVWHUWKDWIHDWXUHGIHOORZOLQHEDFNHU'·$QGUH:DONHUZKR ZDVHLJKWYV6DFUDPHQWR6WDWHRQ6HSW«QHWWHGFDUHHUÀUVWTXDUWHUEDFNVDFN VLJQHGDQ1/,ZLWK*HRUJLDLQDOVRFRPSHWHGLQWUDFN ÀHOGDQGZDVD KDOIDVDFN DQGFDUHHUKLJKWDFNOHVIRUDORVVDJDLQVW7XOVDRQ6HSW« PHPEHURI KLVVFKRRO·V[UHOD\WHDP SRVWHGDIXPEOHUHFRYHU\DIWHU1HOD2WXNRORUHFRUGHGDIRUFHYV$LU)RUFHRQ PERSONAL: %RUQLQ0LDPL)OD«VRQRI (GZDUGDQG6K\QLWD3RQWRQ«KDV 2FW«WDOOLHGIRXUSDVVEUHDNXSVLQFOXGLQJWKUHHLQDVLQJOHJDPHDJDLQVW WKUHHEURWKHUV²%HUQDUG/HH(GZDUG3RQWRQ,,DQG*UHJRU\3RQWRQ«PDMRU 81/9RQ2FW DW)UHVQR6WDWHLVFULPLQRORJ\ODZHQIRUFHPHQW 2015 (FRESHMAN): 3OD\HGLQDOOJDPHVDQGPDGHWKUHHVWDUWVDWRXWVLGH OLQHEDFNHUGXULQJKLVWUXHIUHVKPDQVHDVRQ«KLVWDFNOHVZHUHWKHPRVWE\DQ\ %XOOGRJWUXHIUHVKPHQVLQFHOLQHEDFNHU.HYLQ$GDPVDOVRSRVWHGVWRSVDVD 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 31 THE BULLDOGS: RETURNEES WUXHIUHVKPDQLQ«WLHGIRUVHYHQWKRQWKHWHDPLQWDFNOHV«UDQNHG1R DPRQJWUXHIUHVKPHQLQWKH0RXQWDLQ:HVWLQWDFNOHV«DOVRSRVWHGWDFNOHV 4 IRUDORVVRQHIXPEOHUHFRYHU\WKDWFDPHLQWKH6DQ-RVH6WDWHJDPHWZRSDVV EUHDNXSVDQGRQHTXDUWHUEDFNKXUU\«SRVWHGQLQHWDFNOHVRQ6HSWDW6DQ -RVH6WDWHZKLFKZHUHWKHPRVWE\DQ\%XOOGRJIUHVKPDQVLQFH%HQ-DFREVKDG MIKE BELL DB WDFNOHVDW1R7H[DV$ 0LQ«GUHZKLVÀUVWFDUHHUVWDUWRQ2FWYV 6-3 | 205 | So. | 3rd Year 81/9DQGKDGVHYHQWDFNOHVLQWKHZLQ«UHFRUGHGDWOHDVWRQHWDFNOHLQHYHU\ Moreno Valley, Calif. (Citrus Hill HS) JDPHDQGKDGIRXUJDPHVZLWKVL[RUPRUHVWRSV CAREER GAMES: 12 STARTS: 1 HIGH SCHOOL: )LUVWWHDP$OO'LVWULFW$VHOHFWLRQDWRXWVLGHOLQHEDFNHU 2016 (REDSHIRT FRESHMAN): 3OD\HG LQ DOO JDPHV DQG HDUQHG ÀUVW E\WKH$XVWLQ6WDWHVPDQVHFRQGWHDP$OO&HQ7H[VHOHFWLRQQDPHGWRWKH FDUHHUVWDUWLQWKHÀQDOJDPHRIWKHVHDVRQDJDLQVW6DQ-RVH6WDWHRQ1RY« 7H[DV$VVRFLDWHG3UHVV6SRUWV(GLWRUV&ODVV$KRQRUDEOHPHQWLRQWHDP UHJLVWHUHGWDFNOHV VROR WDFNOHVIRUDORVVDQGRQHSDVVEUHDNXSGXULQJ LQJDPHVLQKHUHFRUGHGWDFNOHVDQGWDFNOHVIRUDORVVOHDGLQJ ÀUVWVHDVRQRQWKHJULGLURQIRUWKH¶'RJV«QHWWHGDVHDVRQKLJKVHYHQWDFNOHVDW KLVWHDPWRDUHFRUGDOVRSRVWHGWDFNOHVDQGWDFNOHVIRUDORVVDVD 8WDK6WDWHRQ2FW«DIWHUORJJLQJÀYHWDFNOHVRYHUKLVÀUVWÀYHFDUHHUJDPHV MXQLRUZKHQ/DNH7UDYLV+LJK6FKRROZHQWDQGWDFNOHVDVDVRSKRPRUH SRVWHGWDFNOHVRYHUWKHQH[WÀYHJDPHV«VHUYHGDVDVWDSOHPHPEHURIWKH LQDVHDVRQKDGVHYHQVDFNVLQKLJKVFKRROFDUHHUWKHPRVWLQRQHVHDVRQ VSHFLDOWHDPVXQLWWKURXJKRXWWKHVHDVRQDQGEDFNXSVDIHW\EHIRUHEHLQJLQVHUWHG ZDVIRXUDVDMXQLRUJDUQHUHGKRQRUDEOHPHQWLRQDOOVWDWHDFFRODGHVDVDMXQLRU LQWRWKHVWDUWLQJOLQHXSIRUWKHVHDVRQÀQDOH HDUQHGÀUVWWHDPDOOGLVWULFWKRQRUVWKUHHWLPHVLQKLVFDUHHUDOVROHWWHUHGLQ EDVNHWEDOODQGWUDFNLQKLJKVFKRRO 2015 (FRESHMAN): 5HGVKLUWHG PERSONAL: %RUQLQ&LQFLQQDWL2KLRVRQRI /LVDDQG%U\DQ%DLOH\KDV HIGH SCHOOL: /HGKLVWHDPDQUHFRUGDQGDVSRWLQWKH&,)66,QODQG WZRROGHUVLEOLQJVVLVWHU5DFKHODQGEURWKHU&DOHEOLVWVKLVIDYRULWHDWKOHWHDV 'LYLVLRQVHPLÀQDOVDVDVHQLRUXQGHUFRDFK(ULF=RPDOWZDVQDPHGWRWKH&DO 1)/VDIHW\(ULF%HUU\EHFDXVHRI KRZKHORYHVWKHJDPH«LVDKLVWRU\PDMRU +L6SRUWV$OO6WDWHIRRWEDOOWHDPIRUWKH&,)6RXWKHUQ6HFWLRQDQGQDPHGÀUVW DW)UHVQR6WDWH WHDP$OO&,)LQDVDMXQLRUKHKHOSHGOHDGKLVWHDPWRDUHFRUGDQG WKH&,)&KDPSLRQVKLSKDGWDFNOHVLQRQHLQWHUFHSWLRQDQGRQHIXPEOH JAMES BAILEY’S CAREER STATS UHFRYHU\JDUQHUHGVHFRQGWHDP$OO&,)KRQRUVDVDMXQLRULVDWKUHHWLPH TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH 2015 12 32 15 47 2.0 2 2 0 1 0 1 ÀUVWWHDPDOOOHDJXHVHOHFWLRQDVDGHIHQVLYHEDFNLQKLVSUHSFDUHHUKHUHFRUGHG 2016 12 32 27 59 5.0 11 4 0 1 0 1 WDFNOHVHLJKWLQWHUFHSWLRQVDQGWKUHHIXPEOHUHFRYHULHVRQGHIHQVHZKLOHDOVR TOTAL 24 64 42 106 7.0 13 6 0 2 0 2 WKURZLQJIRUWRXFKGRZQVDQGVFRULQJWRXFKGRZQVRIKLVRZQVSOLWWLQJWLPH SACKS G UA A Total Yds DWTXDUWHUEDFNDQGZLGHUHFHLYHU 2015 12 0 0 0.0 0 2016 12 0 1 0.5 3 PERSONAL: %RUQLQ0RUHQR9DOOH\&DOLIVRQRI6KDZQ&OHPRQVDQG0LNH TOTAL 24 0 1 0.5 3 %HOO 6U KDV WZR ROGHU VLVWHUV -HVVLND DQG -LOOLDQ DQG RQH \RXQJHU EURWKHU 0DUNXV KREELHV LQFOXGH KDQJLQJ RXW ZLWK IULHQGV DQG SOD\LQJ YLGHR JDPHV JAMES BAILEY’S GAME-BY-GAME IDYRULWHDWKOHWHLV/H%URQ-DPHVEHFDXVHKHWKLQNVKHLVDIUHDNRIQDWXUH Tackles XQGHFLGHGRQPDMRUDW)UHVQR6WDWH 2016 - Sophomore UA A Total TFL-Yds INT-Yds FF FR PBU at Nebraska 0 1 1 0.0-0 0-0 0 0 0 MIKE BELL’S GAME-BY-GAME Sacramento State 8 0 8 1.0-2 0-0 0 0 0 Tackles at Toledo 1 4 5 0.5-1 0-0 0 0 1 2016 - RS Freshman UA A Total TFL-Yds INT-Yds FF FR PBU Tulsa 6 1 7 1.5-4 0-0 0 0 0 at Nebraska 0 1 1 0.0-0 0-0 0 0 0 at UNLV 4 3 7 1.0-4 0-0 0 0 3 Sacramento State 0 0 0 0.0-0 0-0 0 0 0 at Nevada 0 2 2 0.0-0 0-0 0 0 0 at Toledo 1 0 1 0.0-0 0-0 0 0 0 San Diego State 1 5 6 0.0-0 0-0 0 0 0 Tulsa 1 0 1 0.0-0 0-0 0 0 0 at Utah State 2 2 4 0.5-0 0-0 0 0 0 at UNLV 1 1 2 0.0-0 0-0 0 0 0 Air Force 5 1 6 0.0-0 0-0 0 1-0 0 at Nevada 2 2 4 0.0-0 0-0 0 0 0 at Colorado State 1 6 7 0.5-0 0-0 0 0 0 San Diego State 2 2 4 0.5-0 0-0 0 0 1 Hawai’i 1 1 2 0.0-0 0-0 0 0 0 at Utah State 1 6 7 0.5-1 0-0 0 0 0 San Jose State 3 1 4 0.0-0 0-0 0 0 0 Air Force 2 3 5 0.0-0 0-0 0 0 0 TOTALS 32 27 59 5.0-11 0.0-0 0 1-0 4 at Colorado State 5 1 6 1.0-3 0-0 0 0 0 Hawai’i 1 0 1 0.0-0 0-0 0 0 0 Tackles San Jose State 1 2 3 0.5-0 0-0 0 0 0 2015 - Freshman UA A Total TFL-Yds INT-Yds FF FR PBU TOTALS 17 18 35 2.5-4 0.0-0 0 0 1 Abilene Christian 1 0 1 0.0-0 0-0 0 0 1 MIKE BELL’S SINGLE-GAME HIGHS at No. 14 Ole Miss 2 2 4 0.0-0 0-0 0 0 0 Solo Tackles: 5 - at Colorado State, 2016 No. 21 Utah 1 0 1 1.0-1 0-0 0 0 0 Total Tackles: 7 - at Utah State, 2016 at San Jose State 6 3 9 0.0-0 0-0 0 1-0 0 TFL: 1.0 - at Colorado State, 2016 at San Diego State 1 1 2 0.0-0 0-0 0 0 1 Sacks: N/A Utah State 5 1 6 0.5-0 0-0 0 0 0 Forced fumble: N/A UNLV 3 4 7 0.5-1 0-0 0 0 0 Fumble recovery: N/A at Air Force 6 0 6 0.0-0 0-0 0 0 0 Nevada 3 0 3 0.0-0 0-0 0 0 0 at Hawai`i 1 0 1 0.0-0 0-0 0 0 0 at BYU 0 3 3 0.0-0 0-0 0 0 0 Colorado State 3 1 4 0.0-0 0-0 0 0 0 TOTALS 32 15 47 2.0-2 0.0-0 0 1-0 2 JAMES BAILEY’S SINGLE-GAME HIGHS Solo Tackles: 8 - Sacramento State, 2016 Total Tackles: 8 - Sacramento State, 2016 TFL: 1.5 - Tulsa, 2016 Sacks: 0.5 - Tulsa, 2016 Forced fumble: N/A Fumble recovery: 1 - 2x (last-Air Force, 2016) 32 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES 94 36 PATRICK BELONY DT JIMMY CAMACHO K 6-1 | 295 | Jr. | 4th Year 5-10 | 180 | Sr. | 4th Year North Miami Beach, Fla. (N. Miami Beach HS/ Perris, Calif. (Citrus Hill HS/Riverside CC) Antelope Valley College) CAREER GAMES: 10 CAREER GAMES: 12 STARTS: 1 2016 (REDSHIRT SOPHOMORE): Played in all 12 games and made one start 2016 (JUNIOR): $SSHDUHGLQHLJKWRI JDPHV«ZDVXWLOL]HGDVDNLFNRII DWQRVHJXDUG«UHFRUGHGWDFNOHV VROR WDFNOHVIRUDORVVDQGRQHSDVV VSHFLDOLVW«ORJJHGNLFNRIIVIRU\DUGVDQGVL[WRXFKEDFNVQHWWLQJDQ EUHDNXS«UHJLVWHUHGWZRWDFNOHVDQGWDFNOHVIRUDORVVLQÀUVWFDUHHUVWDUWYV DYHUDJHRI \DUGVSHUNLFN 6DFUDPHQWR6WDWHRQ6HSW«KDGDVHDVRQKLJKWKUHHWDFNOHVYV6DQ'LHJR 6WDWHRQ2FW«RZQHGDWOHDVWRQHVWRSLQHLJKWRI WKHVHDVRQ·VFRQWHVWV« 2015 (SOPHOMORE): $SSHDUHG LQ WZR JDPHV JRLQJ RI RQ ÀHOG JRDO ZDVWKHSULPDU\VSHOOQRVHJXDUGIRUJDPHVWDUWHU0DOLN)RUHVWHU DWWHPSWV«ORQJZDVD\DUGÀHOGJRDOLQWKH81/9JDPH«DOVRFRQQHFWHG RQD\DUGÀHOGJRDOLQWKHVHDVRQRSHQHUDJDLQVW$ELOHQH&KULVWLDQ 2015 (SOPHOMORE): 5HGVKLUWHG PRIOR TO FRESNO STATE: *DUQHUHG ÀUVWWHDP $OO$PHULFD PRIOR TO FRESNO STATE: 6SHQWRQHVHDVRQDW$QWHORSH9DOOH\&ROOHJH DFFRODGHV E\ WKH &DOLIRUQLD &RPPXQLW\ &ROOHJH )RRWEDOO &RDFKHV $VVRFLDWLRQ DQG FRPHV WR )UHVQR 6WDWH ZLWK IRXU \HDUV WR FRPSOHWH KLV WKUHH UHPDLQLQJ DQG ZDV D ÀUVWWHDP 6&)$ &HQWUDO /HDJXH VHOHFWLRQ DV D IUHVKPDQ NLFNHU DW VHDVRQVRI HOLJLELOLW\UHFRUGHGWDFNOHVLQJDPHVIRUWKH0DUDXGHUVKDG 5LYHUVLGH&RPPXQLW\&ROOHJHPDGHRIÀHOGJRDODWWHPSWVLQDQG VDFNVDQGRQHIRUFHGIXPEOHLQDOVRUHFRYHUHGWZRIXPEOHVWKDWKH FRQQHFWHGRQDOORI KLVSRLQWDIWHUDWWHPSWVKLVSRLQWVOHGWKHWHDPDVKH UHWXUQHGIRUDWRWDORI \DUGVRQHRI WKRVHUHWXUQVKHEURXJKWEDFN\DUGV KHOSHG5&&WRWKH&&&$$6RXWKHUQ&DOLIRUQLD5HJLRQDOÀQDOJDPHZDVRI IRUDWRXFKGRZQLQDZLQRYHU/$3LHUFH RQÀHOGJRDODWWHPSWVRI RYHU\DUGVZLWKDORQJRI WKDWLVWKHIRXUWKORQJHVW PDGHÀHOGJRDOLQ5&&KLVWRU\ZDVRIRQÀHOGJRDODWWHPSWVRI XQGHU HIGH SCHOOL: 7ZR\HDU OHWWHUZLQQHU XQGHU FRDFK -HII %HUWDQL DW 1RUWK \DUGVKLVORQHPLVVLQWKDWUDQJHEHLQJD\DUGHU 0LDPL%HDFK6HQLRU+LJK6FKRROSOD\LQJWDFNOHDQGGHIHQVLYHWDFNOHSDUWLFLSDWHG LQORFDO´SXEOLFYVSULYDWHµDOOVWDUJDPH HIGH SCHOOL: :DV D SDUW RI EDFNWREDFN &,) FKDPSLRQVKLS WHDPV DW &LWUXV+LOO+LJK6FKRROXQGHUFRDFK(ULF=RPDOWÀUVWWHDPDOOOHDJXHDQGÀUVW PERSONAL: %RUQLQ%URRNO\Q1<VRQRI )UDQW]\DQG$QJHOH$QWRLQH WHDP$OO&,)KRQRUHHZHQWVWUDLJKWJDPHVZLWKRXWKDYLQJRQHRI KLVSXQWV KDVWZLQEURWKHUV*LRYDQDQG6FKQLGHUPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ UHWXUQHGVHWDQHZ,QODQG(PSLUHUHFRUGIRUWKHPRVWWRXFKEDFNV DOVR ODZHQIRUFHPHQW SOD\HGVRFFHUDQGZDVDQ$OO6WDWH*RRG+DQGV*RDONHHSHUOHGWHDPWRWKH &,)&KDPSLRQVKLSLQDQGSOD\HGIRU&KLYDV86$$FDGHP\LQWKH PATRICK BELONY’S GAME-BY-GAME VHDVRQ Tackles 2016 - RS Soph. UA A Total TFL-Yds Sacks-Yds FF FR QBH PERSONAL: %RUQLQ6DQWD$QD&DOLIVRQRI 5RVDDQG6HUJLR&DPDFKR at Nebraska 0 1 1 0.0-0 0.0-0 0 0 0 KDVRQHROGHUEURWKHU6HUJLRDQGD\RXQJHUVLVWHU-DFTXHOLQHHQMR\VZDWFKLQJ Sacramento State 1 1 2 0.5-1 0.0-0 0 0 0 LQWHUQDWLRQDOVRFFHUIDYRULWHDWKOHWHLV3DW0F$IHHEHFDXVHKHLVWKHKDUGHVW at Toledo 1 1 2 0.0-0 0.0-0 0 0 0 KLWWLQJSXQWHULQWKH1)/PDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZHQIRUFHPHQW Tulsa 2 0 2 0.0-0 0.0-0 0 0 0 at UNLV 0 0 0 0.0-0 0.0-0 0 0 0 at Nevada 0 0 0 0.0-0 0.0-0 0 0 0 JIMMY CAMACHO’S CAREER STATS SCORING G TD Rush Pass Retn PAT 2PAT FG Total Avg/G San Diego State 0 3 3 0.5-0 0.0-0 0 0 0 2015 2 0 0 0 0 0 0 2 6 3.0 at Utah State 1 1 2 0.0-0 0.0-0 0 0 0 2016 8 0 0 0 0 0 0 0 0 0.0 Air Force 0 0 0 0.0-0 0.0-0 0 0 0 TOTAL 10 0 0 0 0 0 0 2 6 0.6 at Colorado State 0 1 1 0.0-0 0.0-0 0 0 0 FIELD GOALS G Att Made Lg Pct Hawai’i 0 0 0 0.0-0 0.0-0 0 0 0 2015 2 4 2 44 50.0 San Jose State 1 0 1 0.0-0 0.0-0 0 0 0 2016 8 0 0 0 0.0 TOTAL 10 4 2 44 50.0 TOTALS 6 8 14 1.0-1 0.0-0 0 0 0 PATRICK BELONY’S SINGLE-GAME HIGHS Solo Tackles: 2 - Tulsa, 2016 82 Total Tackles: 3 - San Diego State, 2016 TFL: 0.5 - 2x DONTE COLEMAN TE 6-3 | 235 | RFr. | 2nd Year 13 Mesquite, Texas (West Mesquite HS) JARON BRYANT DB 6-0 | 183 | So. | 2nd Year 2016 (FRESHMAN): 5HGVKLUWHG Fort Worth, Texas (Duncanville HS) HIGH SCHOOL: :DVDWZRWLPH$OO'LVWULFW$VHFRQGWHDPVHOHFWLRQDW CAREER GAMES: 11 :HVW0HVTXLWH+LJK6FKRROXQGHUFRDFK-HII 1HLOOFDXJKWSDVVHVIRU \DUGVDQGIRXUWRXFKGRZQVDVDMXQLRUDQGKDGÀYHUHFHSWLRQVIRU\DUGVDVD 2016 (FRESHMAN): 3OD\HGLQRI JDPHVDVDWUXHIUHVKPDQSULPDULO\ VHQLRUZDVDKLJKVFKRROWHDPPDWHZLWK%XOOGRJTXDUWHUEDFN&KDVRQ9LUJLODQG RQWKHVSHFLDOWHDPVXQLW«UHJLVWHUHGRQHWDFNOHLQVL[GLIIHUHQWJDPHVGXULQJ RQHRI KLVSUHSFRDFKHVZDV&KDVRQ·VROGHUEURWKHU&KD]] WKHVHDVRQ PERSONAL: %RUQ LQ 'DOODV 7H[DV « VRQ RI 6KDZWD &ROHPDQ « KDV WZR HIGH SCHOOL: 6HFRQGWHDP$OO'LVWULFW$VHOHFWLRQDWVDIHW\DVERWKD \RXQJHUVLEOLQJV6DGHDQG0LOHV«KLVXQFOH'RQWH:DOGRQLVDIRUPHUIXOOEDFN MXQLRUDQGVHQLRUSRVWHGWDFNOHVDQGVL[LQWHUFHSWLRQVDVDVHQLRULQ DW2XDFKLWD%DSWLVW«PDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZHQIRUFHPHQW UHFRUGHGWDFNOHVDQGIRXULQWHUFHSWLRQVDVDMXQLRU PERSONAL: %RUQ LQ )RUW :RUWK 7H[DV « VRQ RI -DGD %U\DQW « KDV WZR \RXQJHUEURWKHUV-RUGDQDQG-XVWLQ«LVDNLQHVLRORJ\PDMRUDW)UHVQR6WDWH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 33 THE BULLDOGS: RETURNEES BLAKE CUSICK’S GAME-BY-GAME 58 Punting 2016 - RS Fr. No. Yds Avg Long BLK TB FC 50+ i20 CHRISTIAN CRONK OL at Nebraska 6 210 35.0 48 0 1 1 0 1 Sacramento State 8 286 35.8 59 0 0 2 2 6 6-5 | 305 | Jr. | 3rd Year at Toledo 12 461 38.4 47 0 0 11 0 1 Oceanside, Calif. (Oceanside HS/Riverside CC) Tulsa 8 341 42.6 57 0 0 6 1 3 CAREER GAMES: 12 STARTS: 12 at UNLV 8 334 41.8 54 0 1 4 1 0 at Nevada 2 73 36.5 43 0 0 2 0 2 2016 (SOPHOMORE): ,QÀUVWVHDVRQDW)UHVQR6WDWHVWDUWHGDOOJDPHVDW San Diego State 5 197 39.4 43 0 0 4 0 1 OHIWWDFNOHIRUWKH%XOOGRJV«KHOSHGOHDGDUXVKLQJDWWDFNWKDWJDLQHG\DUGV at Utah State 5 168 33.6 51 1 0 3 1 0 Air Force 3 112 37.3 45 0 0 2 0 1 RQWKHJURXQGOHGE\VWDUWLQJUXQQLQJEDFN'RQWHO-DPHV·\DUGV«EORFNHG at Colorado State 7 253 36.1 43 0 0 4 0 1 IRUDSDVVLQJJDPHWKDWSURGXFHG\DUGVWKURXJKWKHDLUWKHVWDUWLQJOLQH Hawai’i 8 334 41.8 51 0 0 6 1 3 XQLWOLPLWHGRSSRQHQWVWRVDFNVSHUJDPHVFRUHGÀUVWFDUHHUWRXFKGRZQ San Jose State 6 221 36.8 50 1 0 3 1 1 RQ1RYDVWKHUHFLSLHQWRI DEDFNZDUGVSDVVIURP=DFK.OLQHDVKHUROOHGWR Totals 78 2990 38.3 59 2 2 48 7 20 WKHULJKWDQGWKUHZDVWULNHEHKLQGWKHOLQHRI VFULPPDJHEDFNWRWKHOHIWVLGH FUHGLWHGZLWKD\DUGUXVKLQJ7' PRIOR TO FRESNO STATE: 3OD\HGOHIWWDFNOHDVDIUHVKPDQDW5LYHUVLGH&LW\ 19 &ROOHJHZDV2FHDQVLGH+LJK6FKRROFODVVRI WKH5LYHUVLGH&LW\RIIHQVLYH OLQHKHOSHGJHQHUDWHSRLQWVSHUJDPHEHKLQGUXVKLQJ\DUGVSHUJDPH FRANK DALENA WR GXULQJ&URQN·VIUHVKPDQVHDVRQWKH7LJHUVDYHUDJHG\DUGVSHUUXVK 5-8 | 158 | So. | 3rd Year Fresno, Calif. (San Joaquin Memorial HS) HIGH SCHOOL: +LV2FHDQVLGH3LUDWHVZHQWKLVVHQLRUVHDVRQKHZDV QDPHGÀUVWWHDP$OO$YRFDGR:HVW/HDJXHE\WKH6DQ'LHJR7ULEXQH CAREER GAMES: 6 PERSONAL: %RUQLQ2FHDQVLGH&DOLI«SDUHQWVDUH.DUHQ)HVLOL 0RP -DPHV 2016 (REDSHIRT FRESHMAN):$SSHDUHGLQVL[JDPHV«GLGQRWUHFRUG &URQN 'DG DQG-XOLHWWH&URQN 6WHSPRP «KDVWKUHHVLEOLQJV²0DUNHVH.LHUD DQ\VWDWLVWLFV DQG.DOLRQD«LVDSUHDWKOHWLFWUDLQLQJPDMRUDW)UHVQR6WDWH 2015 (FRESHMAN): :DONHGRQWRWKHSURJUDPDQGUHGVKLUWHG HIGH SCHOOL: :DV D WKUHH\HDU OHWWHU ZLQQHU LQ IRRWEDOO DW 6DQ -RDTXLQ 0HPRULDO+LJK6FKRROLQ)UHVQRSOD\HGZLGHUHFHLYHUGHIHQVLYHEDFNNLFNHU DQG NLFNRII UHWXUQHU IRU WKH 3DQWKHUV ZDV D WHDP FDSWDLQ DORQJ ZLWK EHLQJ 47 QDPHGDWHDP093DQGDQG,URQ0DQ$ZDUGZLQQHUÀQDOSOD\LQKLJKVFKRRO ZDVD\DUGWRXFKGRZQUHFHSWLRQDOVRSOD\HGIRXU\HDUVRIVRFFHURQH\HDU BLAKE CUSICK P RI EDVHEDOODQGWZR\HDUVRI WUDFNDQGÀHOGDW6DQ-RDTXLQ 6-2 | 185 | So. | 3rd Year Monrovia, Calif. (Monrovia HS) PERSONAL:%RUQLQ)UHVQR&DOLISDUHQWVDUH/LVDDQG%ULDQ'DOHQDDV WKUHH\RXQJHUVLEOLQJV(OOLH0DFDQG-RHIDWKHU%ULDQSOD\HGIRRWEDOODW)UHVQR CAREER GAMES: 12 6WDWHZKLOHPRWKHUSOD\HGDW6RQRPD6WDWHD)&$PHPEHULQKLJKVFKRRO PDMRUDW)UHVQR6WDWHLVDJULFXOWXUDOEXVLQHVV 2016 (REDSHIRT FRESHMAN): 3OD\HG LQ DOO JDPHV DV WKH ÀUVWVWULQJ SXQWHUZKLOHDOVRKDQGOLQJSODFHKROGLQJGXWLHVIRUÀHOGJRDOV«SXQWHGWLPHV IRUDQDYHUDJHRI\DUGVSHUSXQW«LWZDVQRWXQWLOWKHQLQWKJDPHRIWKH 45 VHDVRQWKDWDQRSSRQHQWORJJHGSRVLWLYHSXQWUHWXUQ\DUGDJH IRXUUHWXUQVRQ SXQWVIRU]HUR\DUGV ²WKHUHZHUHRQO\WKUHHRWKHUWHDPVLQWKH)%6WKDWKHOG NATHAN DE JAGER P WKHVDPHGLVWLQFWLRQDIWHUHLJKWJDPHV«)UHVQR6WDWHHQGHGWKHVHDVRQWKLQ 6-0 | 180 | RFr. | 2nd Year WKHFRXQWU\LQSXQWUHWXUQGHIHQVHZLWKUHWXUQVKHOGWR\DUGVSHUUHWXUQ Bakersfield, Calif. (Bakersfield Christian HS) «KDGDORQJSXQWRI\DUGVLQWKHVHDVRQ·VKRPHRSHQHUDJDLQVW6DFUDPHQWR 6WDWHRQ6HSWDJDPHLQZKLFKWKHEDOOZDVSLQQHGLQVLGHWKH\DUGOLQHD VHDVRQKLJKVL[WLPHV RXWRIHLJKWDWWHPSWV «RZQHGVHYHQSXQWVWKDWZHQWIRU JUHDWHUWKDQ\DUGV«GRZQHGSXQWVLQVLGHWKH\DUGOLQH«WZRSXQWVRI 2016 (FRESHMAN): 5HGVKLUWHG KLVDWWHPSWVZHUHWRXFKEDFNV«OHGWKH0RXQWDLQ:HVWLQVLQJOHJDPHKLJKV LQERWKFDWHJRULHVRISXQWVDQG\DUGVZLWKSXQWVIRU\DUGVLQWKH%XOOGRJV· HIGH SCHOOL: %&+6VSHFLDOWHDPV0931&6$$DOODPHULFDQVHOHFWHG 6HSWFRQWHVWDW7ROHGR²ZKLFKZDVRQHRIIWKHVLQJOHJDPHSXQWVVFKRRO WR FRPSHWH LQ %DNHUVÀHOG $OO6WDU JDPH ÀHOG JRDO UHFRUG KROGHU LQ .HUQ UHFRUG VHW LQ DQG WLHG *DUUHWW 6ZDQVRQ·V ERRWV LQ D PDWFKXS DJDLQVW &RXQW\ZLWKSRLQWVVFRUHGUHFRUGDQGSRLQWVE\DNLFNHUUHFRUGLQDVHDVRQ 1HEUDVNDLQ«KDGWKHRSSRUWXQLW\WRSDVVWKHEDOORQIDNHDWWHPSWVWZLFH WKUHHVSRUWDWKOHWHLQKLJKVFKRRO IRRWEDOOVRFFHUEDVHEDOO NLFNHGRI ERWKXQVXFFHVVIXODWWHPSWVLQJDPHVDJDLQVW6DQ'LHJR6WDWHRQ2FWDQG6DQ ÀHOGJRDOVGXULQJVHDVRQNLFNRII DYHUDJHRI \DUGVSXQWDYHUDJH -RVH6WDWHRQ1RY RI \DUGVVHDVRQORQJSXQWRI\DUGV 2015 (FRESHMAN): 5HGVKLUWHG PERSONAL: 6RQRI :LOPDDQG&DO'H-DJHUKDVWZRVLEOLQJV-DUHGDQG $O\VVHPDMRUDW)UHVQR6WDWHLVDJULFXOWXUDOEXVLQHVV HIGH SCHOOL: (DUQHGDOO5LR+RQGROHDJXHKRQRUVDVDNLFNHULQKLVÀQDO WZR\HDUVDW0RQURYLD+LJK6FKRRO«PDGHD\DUGÀHOGJRDODVD:LOGFDWLQ KLJKVFKRRODOVRFRPSHWHGLQVRFFHUDQGWUDFNZKLOHLQKLJKVFKRRO PERSONAL:%RUQLQ/RQJ%HDFK&DOLIPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ ODZHQIRUFHPHQW 34 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES MALIK FORRESTER’S GAME-BY-GAME 18 Tackles 2016 - Junior UA A Total TFL-Yds Sacks-Yds FF FR QBH JACKSON FINCH DB at Nebraska 1 3 4 0.0-0 0.0-0 0 0 0 6-1 | 200 | Sr. | 4th Year Sacramento State DNP at Toledo 1 1 2 0.0-0 0.0-0 0 0 0 Modesto, Calif. (Cental Catholic HS/Contra Costa College) Tulsa 3 1 4 0.5-3 0.5-3 0 0 0 at UNLV 3 2 5 1.0-1 0.0-0 0 0 0 CAREER GAMES: 1 at Nevada 4 2 6 0.0-0 0.0-0 0 0 0 2016 (JUNIOR): 0LVVHGÀUVWVL[JDPHVRI WKHVHDVRQGXHWRDOHJLQMXU\LQIDOO San Diego State 3 3 6 2.0-3 0.0-0 0 0 0 at Utah State 1 0 1 1.0-2 0.0-0 0 0 0 FDPS«UHWXUQHGIRUFRQWHVWRQ2FWDJDLQVW6DQ'LHJR6WDWHDQGVXIIHUHGDQ Air Force 2 2 4 0.0-0 0.0-0 0 0 0 DUPLQMXU\WKDWVLGHOLQHGKLPIRUWKHUHPDLQGHURIWKHVHDVRQ at Colorado State 0 1 1 0.0-0 0.0-0 0 0 0 Hawai’i 0 0 0 0.0-0 0.0-0 0 0 0 PRIOR TO FRESNO STATE: $WWHQGHG&RQWUD&RVWD&ROOHJHDOOFRQIHUHQFH San Jose State 3 2 5 0.5-3 0.5-3 0 0 0 VHOHFWLRQ LQ OHG WHDP ZLWK IRXU LQWHUFHSWLRQV LQ UHJLVWHUHG TOTALS 21 17 38 5.0-12 1.0-6 0 0 0 WDFNOHVKDGQLQHLQWHUFHSWLRQVLQDW&RQWUD&RVWD MALIK FORRESTER’S SINGLE-GAME HIGHS HIGH SCHOOL: :RQ VWDWH FKDPSLRQVKLS ZLWK &HQWUDO &DWKROLF LQ Solo Tackles: 4 - at Nevada, 2016 0RGHVWRSRVWHGWDFNOHVDQGWKUHHLQWHUFHSWLRQVGXULQJVHQLRUVHDVRQ Total Tackles: 6 - 2x (last vs. San Diego State, 2016) TFL: 2.0 - San Diego State, 2016 PERSONAL: 6RQRI -DFTXHOLQHDQG-DPHV)LQFKKDVWZRVLVWHUV-DGHDQG Sacks: 1.0 - Tulsa, 2016 -DVPLQHIDWKHUZDVDOLQHEDFNHUDW,OOLQRLV ¶ JXDUGLDQ-DPHV-USOD\HG RQWKHGHIHQVLYHOLQHDW7HQQHVVHH6WDWH ¶ FRXVLQ-HULP\)LQFKSOD\HG IRRWEDOO IRU RQH VHDVRQ DW )ORULGD VLVWHU -DGH UDQ WUDFN DW 7XVNHJHH 50 8QLYHUVLW\ PDMRUDW)UHVQR6WDWHLVSXEOLFUHODWLRQVZLWKLQWKHVFKRRO RI PDVVFRPPXQLFDWLRQVDQGMRXUQDOLVP TAINOA FOSTER ILB 6-2 | 200 | RFr. | 2nd Year 97 Honolulu, Hawai’i (Kamehameha HS) MALIK FORRESTER DT 6-1 | 295 | Sr. | 4th Year 2016 (FRESHMAN): 5HGVKLUWHG Annapolis, Md. (Glen Burnie HS/LA Pierce College) HIGH SCHOOL:+RQROXOX6WDU$GYHUWLVHUÀUVWWHDP$OO6WDWHVHOHFWLRQDOVR CAREER GAMES: 11 STARTS: 11 DÀUVWWHDP$OO,/+VHOHFWLRQWHDPFDSWDLQDQGUHFHLYHGWKHWHDP·VGHIHQVLYH 093 DZDUG SOD\LQJ XQGHU FRDFK -DPHV 0F&OXUH 3RO\QHVLDQ $OO$PHULFDQ 2016 (JUNIOR): 6WDUWHG JDPHV « DV D QRVH JXDUG OHG WKH %XOOGRJV· %RZO /LIH&KDPSLRQ6HQLRU%RZOLQYLWHHZDVDOVRVHOHFWHGWRSOD\LQWKH GHIHQVLYHOLQHZLWKWDFNOHV VROR ²UDQNHGDVWKHVL[WKPRVWWDFNOHVDPRQJ -XQLRU3UHS6SRUWV3DUDGLVH)RRWEDOO&ODVVLFDW$ORKD6WDGLXPRQ-DQ DOO 0RXQWDLQ :HVW GHIHQVLYH OLQHPHQ « KDG VLQJOHJDPH VHDVRQKLJKV RI VL[ UHFRUGHGWDFNOHVVL[VDFNVWKUHHIRUFHGIXPEOHVWKUHHIXPEOHUHFRYHULHV WDFNOHVLQJDPHVDW1HYDGD 2FW DQGYV6DQ'LHJR6WDWH 2FW «WDOOLHG DQGRQHLQWHUFHSWLRQDVDVHQLRUUDQNHGDVWKH1RRYHUDOOUHFUXLWRXWRI WKH RI VHDVRQ·VWDFNOHVRYHUWKHÀUVWVL[JDPHV«WLHGIRUWKHWHDP·VIRXUWKPRVW VWDWHRI +DZDLCLIRUFHGDQGUHFRYHUHGWKUHHIXPEOHVDVDMXQLRUDQGVFRUHGRQH WDFNOHVIRUDORVVZLWK«SRVWHGDVLQJOHJDPHVHDVRQKLJKWDFNOHVIRUD GHIHQVLYHWRXFKGRZQWKDW\HDUZDVQDPHGWRWKH0DQWL7H·2$ZDUG'HIHQVLYH ORVVYV6DQ'LHJR6WDWH 2FW DOVRQRWFKHG7)/VDJDLQVW7XOVD 81/9 3OD\HURI WKH PERSONAL: 0DMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZHQIRUFHPHQW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 35 THE BULLDOGS: RETURNEES JUSTIN GREEN’S CAREER STATS TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH 84 2014 7 1 0 1 0.0 0 0 0 1 0 0 2015 10 10 6 16 4.0 13 0 1 0 0 0 2016 12 6 2 8 2.0 4 0 0 0 0 0 ANTHONY GRAYSON WR TOTAL 29 17 8 25 6.0 17 0 1 1 0 0 6-1 | 168 | Jr. | 4th Year SACKS G UA A Total Yds Redlands, Calif. (Redlands East Valley HS) 2014 7 0 0 0.0 0 2015 10 3 0 3.0 11 2016 12 1 0 1.0 1 TOTAL 29 4 0 4.0 12 2016 (SOPHOMORE):6FRXWWHDPSOD\HU«GLGQRWVHHJDPHDFWLRQ JUSTIN GREEN’S GAME-BY-GAME 2015 (REDSHIRT FRESHMAN):'LGQRWVHHJDPHDFWLRQ Tackles 2016 - Junior UA A Total TFL-Yds Sacks-Yds FF FR QBH 2014 (FRESHMAN): 5HGVKLUWHGDIWHUZDONLQJRQWRWKHSURJUDP at Nebraska 0 0 0 0.0-0 0.0-0 0 0 0 Sacramento State 2 0 2 1.0-0 1.0-1 0 0 0 HIGH SCHOOL: $WKUHH\HDUIRRWEDOOOHWWHUZLQQHUSOD\HGYDUVLW\IRRWEDOODW at Toledo 1 0 1 0.0-0 0.0-0 0 0 0 5DQFKR&XFDPRQJDDVDVRSKRPRUHDQGMXQLRUEHIRUHWUDQVIHUULQJWR5HGODQGV Tulsa 0 0 0 0.0-0 0.0-0 0 0 0 (DVW9DOOH\IRUVHQLRUVHDVRQQDPHGD&LWUXV%HOWÀUVWWHDPVHOHFWLRQXQGHU at UNLV 1 0 1 0.0-0 0.0-0 0 0 0 FRDFK .XUW %UXLFK DW 5HGODQGV (DVW 9DOOH\ FRPSHWHG LQ 5LYHUVLGH YV 6DQ at Nevada 0 0 0 0.0-0 0.0-0 0 0 0 %HUQDUGLQR$OO6WDUJDPHDQG&DOLIRUQLD&ODVVLF$OO6WDUJDPH San Diego State 0 0 0 0.0-0 0.0-0 0 0 0 at Utah State 1 0 1 0.0-0 0.0-0 0 0 0 PERSONAL: %RUQ LQ $SSOH 9DOOH\ &DOLI VRQ RI $QJHOD &DUSHQWHU DQG Air Force 0 2 2 0.0-0 0.0-0 0 0 0 $QWKRQ\ *UD\VRQ KDV WKUHH EURWKHUV &DPHURQ 'H·$QJHOR DQG 4XLQF\ at Colorado State 1 0 1 1.0-3 0.0-0 0 0 0 Hawai’i 0 0 0 0.0-0 0.0-0 0 0 0 DQGWZRVWHSVLVWHUV (ULQDQG7\OHU KDVDSDLURIFRXVLQVWKDWERWKSOD\HG San Jose State 0 0 0 0.0-0 0.0-0 0 0 0 FROOHJLDWHIRRWEDOO²*DU\:DONHU ,GDKR DQG&HGULF-XOLXV (DVWHUQ,OOLQRLV TOTALS 6 2 8 2.0-4 1.0-1 0 0 0 HQMR\VFUHDWLQJPXVLFDQGYLGHRVDQGVKDULQJLWRQVRFLDOPHGLDFRPPXQLFDWLRQ PDMRUDW)UHVQR6WDWH Tackles 2015 - Sophomore UA A Total TFL-Yds Sacks-Yds FF FR QBH Abilene Christian 1 0 1 1.0-5 1.0-5 0 0 0 40 at No. 14 Ole Miss 1 0 1 1.0-2 0.0-0 1 0 0 No. 21 Utah 0 0 0 0.0-0 0.0-0 0 0 0 JUSTIN GREEN DE at San Jose State 3 5 8 1.0-3 1.0-3 0 0 0 at San Diego State 0 0 0 0.0-0 0.0-0 0 0 0 6-4 | 210 | Sr. | 4th Year Utah State 1 0 1 0.0-0 0.0-0 0 0 0 Oak Park, Calif. (Oak Park HS) UNLV 2 1 3 1.0-3 1.0-3 0 0 0 at Air Force 1 0 1 0.0-0 0.0-0 0 0 0 CAREER GAMES: 29 Nevada 0 0 0 0.0-0 0.0-0 0 0 0 Colorado State 1 0 1 0.0-0 0.0-0 0 0 0 2016 (JUNIOR): 3OD\HGLQDOOJDPHVDQGHQWHUVVHQLRUVHDVRQKDYLQJSOD\HG TOTALS 10 6 16 4.0-13 3.0-11 1 0 0 LQFDUHHUJDPHV«SRVWHGHLJKWWDFNOHVWDFNOHVIRUDORVVDQGVDFNVDV DWKLUGGRZQHGJHUXVKVSHFLDOLVWGXULQJMXQLRUFDPSDLJQ«WDOOLHGDVHDVRQEHVW Tackles WZRWDFNOHVLQJDPHVYV6DFUDPHQWR6WDWHDQG$LU)RUFH«DOVRQRWFKHGKLVVDFN 2014 - Freshman UA A Total TFL-Yds Sacks-Yds FF FR QBH LQFRQWHVWDJDLQVW6DFUDPHQWR6W«DGGHGD7)/LQPDWFKXSDW&RORUDGR6WDWH at UNLV 0 0 0 0.0-0 0.0-0 0 0 0 at Boise State 1 0 1 0.0-0 0.0-0 0 0 0 2015 (SOPHOMORE): 3OD\HG LQ JDPHV « ÀQLVKHG WKH VHDVRQ ZLWK San Jose State 0 0 0 0.0-0 0.0-0 0 1-0 0 WDFNOHVWDFNOHVIRUDORVVDQGVDFNV«IRUFHGRQHIXPEOHLQWKHVHFRQG at Nevada 0 0 0 0.0-0 0.0-0 0 0 0 JDPHRI WKH\HDUDW1R2OH0LVV«UHFRUGHGDVHDVRQKLJKHLJKWWDFNOHVDW Hawai`i 0 0 0 0.0-0 0.0-0 0 0 0 6DQ-RVH6WDWHZKHQKHKDGRQHVDFNWKDWKHOSHG)UHVQR6WDWHDVDWHDPVHWD !at No. 22 Boise St. 0 0 0 0.0-0 0.0-0 0 0 0 *vs. Rice 0 0 0 0.0-0 0.0-0 0 0 0 VHDVRQKLJKLQVDFNVZLWKVL[«KDGDVDFNRQIRXUWKGRZQZLWKOHIWLQWKH Totals 1 0 1 0.0-0 0.0-0 0 1-0 0 81/9JDPHSUHVHUYHGWKH%XOOGRJFRPHIURPEHKLQGYLFWRU\ ! - Sports Authority Mountain West Championship Game * - Hawai’i Bowl 2014 (FRESHMAN): 3OD\HGLQVHYHQJDPHVDVDWUXHIUHVKPDQSDUWLFLSDWLQJLQ VHYHQRI WKHÀQDOHLJKWJDPHVRQWKH\HDUVDZDFWLRQIRUWKHÀUVWWLPHRQ2FW DW81/9UHFRUGHGÀUVWFDUHHUWDFNOHDW%RLVH6WDWHRQ2FWUHFRYHUHG 6 DIXPEOHYV6DQ-RVH6WDWHRQ1RYODWHLQWKHIRXUWKTXDUWHUWKDWJDYHWKH %XOOGRJVWKHEDOORQWKH6-68VL[\DUGOLQHLQWKHYLFWRU\ DELVON HARDAWAY WR HIGH SCHOOL: 1DPHG WR WKH 9HQWXUD &RXQW\ 6WDU $OO&RXQW\ ÀUVWWHDP 6-1 | 195 | Sr. | 5th Year GHIHQVHDVDVHQLRULQZDVDYHUVDWLOHZHDSRQIRUWKH7UL9DOOH\/HDJXH Los Angeles, Calif. (Dorsey HS) FKDPSLRQVDVKHKDGWDFNOHVVDFNVWKUHHIRUFHGIXPEOHVDEORFNHGNLFN DQGDVDIHW\SOD\LQJGHIHQVLYHHQGDOVRSOD\HGWLJKWHQGIRUWKH(DJOHVLQ CAREER GAMES: 33 STARTS: 9 DYLFWRU\RYHU6LPL9DOOH\KHUHWXUQHGLQWHUFHSWLRQVDQGQLQH\DUGV IRUWRXFKGRZQVDQGWDFNOHGDEDOOFDUULHULQWKHHQG]RQHIRUDVDIHW\WRPDWFK 2016 (JUNIOR): 3OD\HGLQJDPHVDQGPDGHWZRVWDUWV«KDGUHFHSWLRQV 6LPL9DOOH\·VWRWDORISRLQWVZKLOHDOVRUHFRYHUHGWKUHHIXPEOHVLQWKHJDPH IRU D WRWDO RI \DUGV RQ WKH \HDU « UHFRUGHG D VHDVRQKLJK WKUHH FDWFKHV *UHHQWROGWKH9HQWXUD&RXQW\6WDU´,GRQ·WHYHQNQRZKRZWRFRPSUHKHQGLW LQ FRQVHFXWLYH JDPHV ÀUVW DW 8WDK 6WDWH RQ 2FW IROORZHG E\ DQ 2FW ,W·VEH\RQGZKDW,FDQXQGHUVWDQGZLWKIRRWEDOOULJKWQRZµLQWKUHHVHDVRQVRI FRQWHVWYV$LU)RUFH«WKHPDWFKXSDJDLQVW8WDK6WDWHZDVDOVRDVHDVRQEHVW YDUVLW\IRRWEDOOKHUHFRUGHGWRWDOWDFNOHVVDFNVTXDUWHUEDFNKXUULHVWZR LQUHFHLYLQJ\DUGV «ORQJHVWFDWFKRI WKHVHDVRQZDVD\DUGHUDW1HYDGD LQWHUFHSWLRQVERWKRI ZKLFKKHUHWXUQHGIRUWRXFKGRZQVIRUFHGHLJKWIXPEOHV RQ2FW«DYHUDJHG\DUGVSHUFDWFK«UDQNHGIRXUWKRQWKHWHDPLQERWK UHFHSWLRQVDQGUHFHLYLQJ\DUGV UHFRYHUHGWKUHHEORFNHGWZRÀHOGJRDOVDQGKDGVL[UHFHSWLRQVIRUWZR7'V PERSONAL: %RUQLQ,QJOHZRRG&DOLIVRQRI 0HODQLH*LEVRQDQG&KULV 2015 (SOPHOMORE): $IWHUWHDULQJKLV$&/LQVSULQJSUDFWLFHVKHPDGHD *UHHQKDVRQHROGHUEURWKHU.HYLQ%HYDQVZKRSOD\HGIRRWEDOODW7H[DV$ 0 TXLFNUHFRYHU\DQGUHWXUQHGWRWKHÀHOGIRUWKH%XOOGRJVLQZHHNIRXUDW6DQ &RPPHUFHIURPKDVÀYHFRXVLQVWKDWDOOSOD\HGFROOHJHIRRWEDOODQGKLV -RVH6WDWH«HQGHGXSSOD\LQJLQHDFKRI WKHODVWQLQHJDPHVRIWKHVHDVRQ« ODWHJUDQGIDWKHU*OHQQ(GZDUG*LEVRQSOD\HGIRRWEDOODW$UNDQVDV3LQH%OXII FDXJKWQLQHSDVVHVIRU\DUGVRQWKH\HDU«KDGDVHDVRQKLJKWKUHHFDWFKHV IURPPDMRULQJLQFLYLOHQJLQHHULQJ IRU\DUGVLQWKH1HYDGDJDPH«KDGRQHWDFNOHRQWKHSXQWUHWXUQXQLWLQWKH 36 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES %<8JDPHZKHQKHVWRSSHGWKH&RXJDUSXQWHUVKRUWRI DÀUVWGRZQZKHQ%<8 DELVON HARDAWAY’S GAME-BY-GAME (CONT.) DWWHPSWHGDIDNHSXQW Receiving 2014 (REDSHIRT FRESHMAN): 3OD\HGLQJDPHVDQGPDGHVHYHQVWDUWV 2014 - Redshirt Freshman Rec. Yds. TD Long DVDUHGVKLUWIUHVKPDQFDXJKW7'SDVVHVLQEDFNWREDFNJDPHVDJDLQVW1R at No. 15 USC 1 11 0 11 1HEUDVNDDQGYV6RXWKHUQ8WDKKDGUHFHSWLRQVIRU\DUGVDQGWKRVH at Utah 0 0 0 0 No. 21 Nebraska 4 52 1 21 WZR7'VRQWKHVHDVRQKDGVHDVRQKLJKVLQERWKUHFHSWLRQVDQG\DUGVYV1R Southern Utah 3 49 1 32 1HEUDVNDZKHQKHFDXJKWIRXUSDVVHVIRU\DUGVDOVRKDGIRXUUHFHSWLRQV at New Mexico 3 15 0 6 DJDLQVW6DQ-RVH6WDWH San Diego State 0 0 0 0 at UNLV 0 0 0 0 2013 (FRESHMAN): 5HGVKLUWHG at Boise State 2 44 0 33 HIGH SCHOOL: &DXJKWDWRXFKGRZQSDVVLQWKH:HVW&RDVW%RZO$OO6WDU Wyoming 2 39 0 35 San Jose State 4 36 0 12 JDPHWKDWKHZDVVHOHFWHGWRSOD\LQIROORZLQJKLVVHQLRUVHDVRQOHG'RUVH\ at Nevada 3 25 0 11 +LJK6FKRROZLWKUHFHSWLRQVIRU\DUGVDQGWKUHHWRXFKGRZQVDVDVHQLRU Hawai`i 0 0 0 0 DYHUDJLQJ\DUGVSHUFDWFKZDVDQ$OO&ROLVHXP/HDJXHVHOHFWLRQDVDMXQLRU !at No. 22 Boise St. 0 0 0 0 LQZKHQKHFDXJKWSDVVHVIRU\DUGVDQGWKUHHWRXFKGRZQV *vs. Rice 1 8 0 8 Totals 23 279 2 35 PERSONAL: %RUQLQ/RV$QJHOHV&DOLIVRQRI .D\UQDQG'HOYRQ+DUGDZD\ ! - Sports Authority Mountain West Championship Game KLVFRXVLQ$GULDQ.OHPPSOD\HGVHYHQVHDVRQVLQWKH1)/DQGZRQWKUHH * - Hawai’i Bowl 6XSHU%RZOVZLWKWKH1HZ(QJODQG3DWULRWVDQGZDVPRVWUHFHQWO\WKHRIIHQVLYH OLQHFRDFKDQGUXQJDPHFRRUGLQDWRUDW8&/$PDMRUDW)UHVQR6WDWHLVDIULFDQD VWXGLHV 93 DELVON HARDAWAY’S CAREER STATS RECEIVING G Rec Yds TD Lg Rec/G Avg/C Avg/G JASAD HAYNES DT 2014 14 23 279 2 35 1.6 12.1 19.9 2015 9 9 88 0 20 1.0 9.8 9.8 6-1 | 275 | So. | 3rd Year 2016 10 10 122 0 23 1.0 12.2 12.2 Fresno, Calif. (Clovis North HS) TOTAL 33 42 489 2 35 1.3 11.6 14.8 CAREER GAMES: 5 SCORING G TD Rush Pass Retn PAT 2PAT FG Total Avg/G 2014 14 2 0 2 0 0 0 0 12 0.9 2015 9 0 0 0 0 0 0 0 0 0.0 2016 (REDSHIRT FRESHMAN): 6DZOLPLWHGDFWLRQLQÀYHJDPHV«FUHGLWHG 2016 10 0 0 0 0 0 0 0 0 0.0 ZLWKDWDFNOHDW7ROHGRRQ6HSW TOTAL 33 2 0 2 0 0 0 0 12 0.4 ALL PURPOSE G Rush Rec PR KR IR Total Avg/G 2015 (FRESHMAN): :DONHGRQWRWKHSURJUDPDQGUHGVKLUWHG 2014 14 0 279 0 0 0 279 19.9 2015 9 0 88 0 0 0 88 9.8 HIGH SCHOOL: 3OD\HGGHIHQVLYHWDFNOHIRUDSDLURI \HDUVDW&ORYLV1RUWK 2016 10 0 122 0 0 0 122 12.2 +LJK6FKRRODIWHUVSHQGLQJKLVÀUVW\HDUDW6DQ-RDTXLQ0HPRULDOHDUQHG&R TOTAL 33 0 489 0 0 0 489 14.8 /LQHPDQRI WKH CAREER GAMES: 21 STARTS: 1 CAREER GAMES: 12 2017 (JUNIOR): 0RYHGWRWLJKWHQGIURPGHIHQVLYHHQGGXULQJVSULQJIRRWEDOO 2016 (FRESHMAN):3OD\HGLQDOOJDPHVDVDWUXHIUHVKPDQVHHLQJSULPDU\ DFWLRQRQVSHFLDOWHDPVEHIRUHHDUQLQJSOD\LQJWLPHLQWKHVHFRQGDU\GXULQJWKH 2016 (SOPHOMORE): :RUNLQJEDFNIURPDQLQMXU\WKDWRFFXUUHGLQWKHVHDVRQ ODWWHUKDOIRIWKHVHDVRQ«ÀQLVKHGZLWKWDFNOHVDQGWDFNOHVIRUDORVV« ÀQDOHWKH\HDUEHIRUHVDZÀUVWOLPLWHGDFWLRQLQZHHNWKUHHRIWKHVHDVRQDW7ROHGR UHFRUGHGDOO7)/VLQPDWFKXSYV$LU)RUFHRQ2FW«SRVWHGDVHDVRQ 6HSW PLVVHGZHHNIRXUDQGUHWXUQHGLQZHHNÀYHDQGSOD\HGWKHÀQDOHLJKW KLJKVL[WDFNOHVDW&RORUDGR6WDWHRQ1RYDIWHUQHWWLQJÀYHWDFNOHVWKHZHHN JDPHV«UHJLVWHUHGWDFNOHVIRUWKH\HDU«QRWFKHGKDOI DWDFNOHIRUDORVVRQ EHIRUHDJDLQVW$LU)RUFH«DIWHUQRWUHFRUGLQJDWDFNOHLQWKHÀUVWÀYHJDPHV 2FWYV$LU)RUFH«WDOOLHGDVLQJOHJDPHEHVWWZRWDFNOHVLQWKUHHJDPHV SRVWHGDWOHDVWRQHWDFNOHLQWKHÀQDOVHYHQJDPHV«FUHGLWHGZLWKDQ\DUG UHVSHFWLYHO\ SXQWUHWXUQIROORZLQJDEORFNHGSXQWE\'HVKDZQ3RWWVLQVHFRQGTXDUWHURID 2015 (REDSHIRT FRESHMAN): 1DPHG WR WKH IDOO 0RXQWDLQ :HVW $OO PDWFKXSDW81/9RQ2FW $FDGHPLFWHDPSOD\HGLQDOOJDPHVGUHZKLVÀUVWFDUHHUVWDUWDQGRQO\RQH RI WKHVHDVRQRQ2FWDW$LU)RUFHDQGSRVWHGDVHDVRQKLJKIRXUWDFNOHVLQWKH HIGH SCHOOL:1DPHGWRWKH)UHVQR%HH·V)DE)RRWEDOO$OO6WDUVWHDP JDPHUHFRUGHGKLVÀUVWFDUHHUWDFNOHIRUDORVVDKDOI WDFNOHIRUDORVVDJDLQVW1R KHOSHGOHDG+DQIRUG+LJK6FKRROWREDFNWREDFN&HQWUDO6HFWLRQWLWOHVXQGHU 8WDKRQ6HSWVXIIHUHGDNQHHLQMXU\LQWKHODVWJDPHRI WKHVHDVRQWKDW FRDFK-RVK HIGH SCHOOL: 1DPHG75$&3OD\HURI WKH PERSONAL: 6RQRI &ULVWLQDDQG6HWK+RNLWKDVWZREURWKHUV,VDLDKDQG 6FRWW,VDLDKLVVRSKRPRUHZUHVWOHVDW)UHVQR6WDWHKDVQRWGHFODUHGDPDMRU 38 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES VHQLRUVHDVRQIRUFLQJKLPWRPLVVWKHÀUVWÀYHJDPHVDYHUDJHG\DUGVSHU 62 FDUU\LQKDGVL[UXVKLQJWRXFKGRZQVDQG\DUGVRQDOLPLWHGQXPEHU RI FDUULHVKHOSHGOHDG6XPPLWWRDUHFRUGLQDSHUIHFWOHDJXH UHFRUGDQGWRWKH&,)6RXWKHUQ6HFWLRQSOD\RIIVDOVRUDQWUDFNLQKLJKVFKRRO LOGAN HUGHES OL ZKHUHKHFRPSHWHGLQWKHPPPDQGRQWKH[DQG[UHOD\ 6-4 | 285 | Jr. | 3rd Year WHDPVFORFNHGDSHUVRQDOEHVWLQWKHP Las Vegas, Nev. (Green Valley HS/Victor Valley College) PERSONAL:%RUQLQ5LYHUVLGH&DOLIVRQRI 7UDF\%RQQHUDQG'LPLWUL-DPHV CAREER GAMES: 11 STARTS: 6 KDVIRXUVLVWHUVDQGWKUHHEURWKHUVPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZ HQIRUFHPHQW 2016 (SOPHOMORE): 3OD\HGLQJDPHVLQFOXGLQJVL[VWUDLJKWVWDUWVWRFORVH WKHVHDVRQ«KHOSHGOHDGDUXVKLQJDWWDFNWKDWJDLQHG\DUGVRQWKHJURXQG DONTEL JAMES’ (FS) SINGLE-GAME HIGHS OHGE\VWDUWLQJUXQQLQJEDFN'RQWHO-DPHV·\DUGV«EORFNHGIRUDSDVVLQJ Carries: 29 - at Utah State, 2016 Yards: 169 - at Nevada, 2016 JDPHWKDWSURGXFHG\DUGVWKURXJKWKHDLUWKHVWDUWLQJOLQHXQLWOLPLWHG Touchdowns: 1 - 5x RSSRQHQWVWRVDFNVSHUJDPH«VWDUWHGÀYHJDPHVDWOHIWJXDUGDQGRQH Long Rush: 34 - at Nevada, 2016 JDPHDWWLJKWHQG DONTEL JAMES’ GAME-BY-GAME PRIOR TO FRESNO STATE: $WWHQGHG9LFWRU9DOOH\-XQLRU&ROOHJHSOD\LQJ WDFNOHRQLWVRIIHQVLYHOLQHWKDWSURGXFHGDVHDVRQ«6RXWKHUQ&DOLIRUQLD Rushing Receiving 2016 - Junior No. Yds. TD Long Rec. Yds. TD Long )RRWEDOO $VVRFLDWLRQ ² $PHULFDQ 'LYLVLRQ _ 0RXQWDLQ /HDJXH ² VHFRQGWHDP at Nebraska 12 20 0 5 0 0 0 0 RIIHQVHVHOHFWLRQ«9LFWRU9DOOH\SURGXFHGWKHWKLUGPRVW\DUGVSHUJDPH Sacramento State 27 121 1 1 1 6 0 6 LQWKH6&)$«OHIWIRU)UHVQR6WDWHDIWHURQHVHDVRQLQWKHVXPPHURI at Toledo 13 40 0 18 0 0 0 0 Tulsa 21 65 1 13 0 0 0 0 HIGH SCHOOL: 3OD\HG WDFNOH DQG GHIHQVLYH HQG DQG ZDV RQ WKH VWDWH at UNLV 18 53 0 7 0 0 0 0 FKDPSLRQZUHVWOLQJWHDP OEV DW*UHHQ9DOOH\+LJK6FKRRO«$OO6RXWKHDVW at Nevada 27 169 1 34 1 0 0 0 /HDJXHVHFRQGWHDPGHIHQVH '( ²VDPHOHDJXHWKDWWHDPPDWHV1HOD2WXNROR San Diego State 15 34 0 10 0 0 0 0 *RUPDQ DQG5REHUW6WDQOH\ *RUPDQ SOD\HGLQ at Utah State 29 80 1 20 1 3 0 3 Air Force 19 24 0 6 0 0 0 0 PERSONAL: 6RQ RI 7LQD &DUFLRQH DQG 'RXJ +XJKHV PDMRULQJ LQ at Colorado State DNP DQWKURSRORJ\ Hawai’i 15 49 0 9 0 0 0 0 San Jose State 12 42 1 17 0 0 0 0 28 Totals 208 697 5 34 3 9 0 6 2015 - Sophomore Rushing Receiving at Riverside CC No. Yds. TD Long Rec. Yds. TD Long DONTEL JAMES RB at Bakerfield 18 87 2 11 0 0 6-0 | 225 | Sr. | 5th Year Saddleback 14 57 0 12 1 3 0 3 Fontana, Calif. (Summit HS/Riverside CC) Grossmont 19 99 1 14 1 4 0 4 at El Camino 18 103 2 25 0 0 0 0 CAREER GAMES: 14 STARTS: 10 at Fullerton 16 102 0 16 0 0 0 0 LA Harbor 6 10 0 3 0 0 0 0 at Mt. San Antonio DNP 2016 (FRESNO STATE, JUNIOR):6WDUWHGJDPHVDQGSOD\HGLQ«OHG Long Beach DNP WKHWHDPZLWK\DUGVUXVKLQJRQDWHDPKLJKDWWHPSWVDYHUJLQJ\DUGV Chaffey 6 25 0 6 1 11 0 11 SHUJDPH«VFRUHGDWHDPKLJKÀYHUXVKLQJWRXFKGRZQV«UHFRUGHGÀUVWFDUHHU at Citrus DNP \DUGJDPHLQKRPHRSHQHUYV6DFUDPHQWR6WDWHZLWK\DUGVDOVRUHFRUGHG at Saddleback DNP ÀUVWFDUHHUUXVKLQJ7'ZLWKD\DUGVFRUH«VFRUHGRQHRI WKUHH)UHVQR6WDWH Totals 97 483 5 25 3 18 0 4 UXVKLQJVFRUHVLQWKHÀUVWTXDUWHUYV7XOVDWKDWRSHQHGDOHDG«UHFRUGHG Rushing Receiving VHFRQGFDUHHU\DUGJDPHLQWKHVL[WKJDPHRI WKHVHDVRQDFDUHHUKLJK 2014 - RS Fr. No. Yds. TD Long Rec. Yds. TD Long \DUGSHUIRUPDQFHRQ2FWDW1HYDGD²LWZDVWKHPRVWUXVKLQJ\DUGVDVLQJOH at No. 15 USC 5 8 0 8 1 8 0 8 JDPHE\D%XOOGRJVLQFH1RY«WKH1HYDGDFRQWHVWDOVRIHDWXUHGD missed remainder of season \DUGFDUHHUORQJUXVKWKDWKHOSHGUHVXOWLQDVHDVRQEHVW\DUGVSHUFDUU\« VHWDFDUHHUKLJKIRUDWWHPSWV RQ2FWDW8WDK6WDWHÀQLVKHGZLWK\DUGV Rushing Receiving DQG7'«UHJLVWHUHGÀIWKWRXFKGRZQRQ1RYYV6DQ-RVH6WDWHD\DUG7' 2013 - Freshman No. Yds. TD Long Rec. Yds. TD Long WKDWFDSSHGDSOD\GULYH Cal Poly 2 5 0 5 0 0 0 0 at Idaho 1 0 0 0 0 0 0 0 2015 (RIVERSIDE CITY COLLEGE, SOPHOMORE):,QVHYHQJDPHVKH missed remainder of season KDGUXVKHVIRU\DUGVDQGÀYHWRXFKGRZQVDYHUDJHG\DUGVSHUFDUU\ VFRUHGWZRWRXFKGRZQVRQWKHJURXQGLQURDGZLQVRYHU%DNHUVÀHOG&ROOHJH DQG(O&DPLQRUDQIRUDVHDVRQKLJK\DUGVRQFDUULHVLQWKDW(O&DPLQR 96 JDPHDOVRZHQWIRURYHU\DUGVDW)XOOHUWRQ FDUULHVIRU\DUGV KEVIN JEANNITON DE 2014 (FRESNO STATE, REDSHIRT FRESHMAN): $SSHDUHG LQ RQH 6-2 | 250 | RFr. | 2nd Year JDPHWKHVHDVRQRSHQHUDW1R86&KDGÀYHUXVKHVIRUHLJKW\DUGVRQH Fresno, Calif. (Edison HS) FDWFKIRUHLJKW\DUGVUHWXUQHGRQHNLFNRII IRU\DUGVDQGDOVRKDGRQHWDFNOH RQNLFNRII FRYHUDJH 2013 (FRESNO STATE, FRESHMAN): $SSHDUHGLQWZRJDPHVUHFRUGLQJ 2016 (FRESHMAN): 5HGVKLUWHG WKUHHFDUULHVIRUÀYH\DUGVVXIIHUHGDIRRWLQMXU\HDUO\LQWKH\HDUWKDWFDXVHG KLPWRPLVVWKHUHVWRI WKHVHDVRQUHFHLYHGDPHGLFDOKDUGVKLSZDLYHUDQGKDV HIGH SCHOOL: 5HFRUGHGWDFNOHVVDFNVWDFNOHVIRUORVVIRUFHG IRXUPRUHVHDVRQVRI HOLJLELOLW\ IRXU IXPEOHV DQG PDGH RQH LQWHUFHSWLRQ GXULQJ KLV VHQLRU \HDU DW (GLVRQ FDSWDLQGXULQJVHDVRQ HIGH SCHOOL: 1DPHG WR WKH $OO6XQNLVW /HDJXH WHDP DQG D 6DQ %HUQDUGLQR$OO6WDUSOD\HGLQWKHWKDQQXDO63257)RXQGDWLRQ(PSLUH$OO PERSONAL:6RQRI 9LOPDDQG:LOO\-HDQQLWRQKDVWZRVLEOLQJV:LOO\DQG 6WDU)RRWEDOO&ODVVLFWUDQVIHUUHGWR6XPPLW+LJK6FKRROLQWKHPLGGOHRI KLV .DUHQPDMRUDW)UHVQR6WDWHLVELRORJ\ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 39 THE BULLDOGS: RETURNEES KEESEAN JOHNSON’S GAME-BY-GAME 3 Receiving 2016 - Sophomore Rec. Yds. TD Long KEESEAN JOHNSON WR at Nebraska 8 61 0 18 6-2 | 202 | Jr. | 4th Year Sacramento State 7 82 2 24 at Toledo 4 51 1 16 Palo Alto, Calif. (Palo Alto HS) Tulsa 7 80 0 34 CAREER GAMES: 24 STARTS: 22 at UNLV 5 57 0 17 at Nevada 5 71 0 33 2016 (SOPHOMORE): $OO0RXQWDLQ :HVW KRQRUDEOH PHQWLRQ VHOHFWLRQ « San Diego State 8 56 0 22 VWDUWHGDOOJDPHV«OHGWKHWHDPLQUHFHSWLRQV UHFHLYLQJ\DUGV DQG at Utah State 6 59 0 13 UHFHLYLQJWRXFKGRZQV «UDQNHGWKLUGLQWKHOHDJXHDQGWKLQWKHQDWLRQ Air Force 10 142 3 52 at Colorado State 2 23 0 25 LQUHFHSWLRQVSHUJDPHZLWKSHUJDPH«UDQNHGVHYHQWKLQWKH0RXQWDLQ Hawai’i 3 38 0 18 :HVWLQUHFHLYLQJ\DUGV DQGHLJKWKLQWKHOHDJXHLQUHFHLYLQJ\DUGVSHUJDPH San Jose State 1 53 0 53 «WLHGIRUWKHWHDPOHDGLQDOOSXUSRVH\DUGVZLWKDVKHUHWXUQHG Totals 66 773 6 53 NLFNRIIVIRU\DUGVDQGVL[SXQWVIRU\DUGV«SRVWHGVLQJOHJDPHFDUHHU EHVWVIRUFDWFKHV UHFHLYLQJ\DUGV DQGUHFHLYLQJWRXFKGRZQV LQD Receiving VLQJOHSHUIRUPDQFHYV$LU)RUFHRQ2FW²WKHVRSKRPRUH·VWKUHHWRXFKGRZQV 2015 - RS Freshman Rec. Yds. TD Long ZHUHWKHPRVWLQDVLQJOHJDPHVLQFH'DYDQWH$GDPVGLGVRDJDLQVW6DQ-RVH Abilene Christian 4 30 0 11 at No. 14 Ole Miss 0 0 0 0 6WDWHRQ1RY«WLHGD0:VLQJOHJDPHVHDVRQEHVWZLWKVHYHQRWKHU No. 21 Utah 3 34 0 15 SOD\HUVLQWKHOHDJXHIRUUHFHLYLQJ7'VLQDJDPH «KLV\DUGVDJDLQVW at San Jose State 7 90 1 29 $LU)RUFHZDVWKHWKEHVWVLQJOHJDPHSHUIRUPDQFHLQWKHOHDJXHLQ« at San Diego State 5 35 1 16 IRUFHGDIXPEOHFKDVLQJGRZQ6DQ'LHJR6WDWH·VVDIHW\.DPHURQ.HOO\DIWHUDQ Utah State 1 5 0 5 LQWHUFHSWLRQRQ2FW«SRVWHGORQJHVWFDUHHUFDWFK \DUGV LQVHDVRQÀQDOH UNLV 2 24 0 16 at Air Force 5 36 0 13 YV6DQ-RVH6WDWHRQ1RY«ORJJHGDWOHDVWÀYHFDWFKHVLQHLJKWRI WKHÀUVW Nevada 2 18 0 13 QLQHJDPHVWKLVVHDVRQ«FDXJKWDWOHDVWRQHSDVVLQHDFKJDPHLQDQGKDV at Hawai`i 3 10 0 8 FDXJKWDWOHDVWRQHSDVVLQVWUDLJKWJDPHVGDWLQJEDFNWRODVWVHDVRQ at BYU 2 27 0 20 Colorado State 3 28 0 15 2015 (REDSHIRT FRESHMAN): 3OD\HGLQDOOJDPHVPDNLQJVWDUWVRQ TOTALS 37 337 2 29 WKHVHDVRQ«UDQNHGVHFRQGRQWKHWHDPZLWKUHFHSWLRQV«KDG\DUGV UHFHLYLQJDQGWZRWRXFKGRZQVRQWKH\HDU«DOVRUHWXUQHGRQHSXQWIRUVHYHQ KEESEAN JOHNSON’S SINGLE-GAME HIGHS \DUGVLQWKH6DQ'LHJR6WDWHJDPH«OHGWKHWHDPZLWKVHYHQUHFHSWLRQVIRU Receptions: 10 - Air Force, 2016 \DUGVRQ6HSWDW6DQ-RVH6WDWHZKHQKHFDXJKWKLVÀUVWFDUHHUWRXFKGRZQ Receiving Yards: 142 - Air Force, 2016 SDVVD\DUGVFRUH«FDXJKWDQRWKHU7'IRUWKHVHFRQGFRQVHFXWLYHJDPHRQ Receiving Touchdowns: 3 - Air Force, 2016 2FWDW6DQ'LHJR6WDWHZKHQKHOHDGWKHWHDPZLWKÀYHUHFHSWLRQV Long reception: 53 - San Jose State, 2016 2014 (FRESHMAN): 5HGVKLUWHG 24 HIGH SCHOOL: :DVDWZRZD\VWDQGRXWIRUFRDFK(DUO+DQVHQFDXJKW SDVVHVIRU\DUGVDQGWRXFKGRZQVDVDVHQLRUDYHUDJHG\DUGVSHU SAEVION JOHNSON RB FDWFKUHWXUQHGWKUHHSXQWVIRUWRXFKGRZQVLQRQGHIHQVHKHKDG 6-0 | 194 | RFr. | 2nd Year WRWDOWDFNOHVDQGWKUHHLQWHUFHSWLRQVDVDVHQLRUWRKHOSOHDGWKH9LNLQJVDOOWKHZD\ WRWKH'LYLVLRQ,,&,)&HQWUDO&RDVW6HFWLRQVHPLÀQDOVDVDMXQLRUKHKDXOHG Pearland, Texas (Pearland Dawson HS) LQSDVVHVIRU\DUGVDQGRQH7'ZKLOHDYHUDJLQJ\DUGVSHUUHFHSWLRQ KHOSHGKLV9LNLQJVVTXDGHDUQD&,)&HQWUDO&RDVW2SHQ'LYLVLRQ3OD\RIIEHUWK LQDOVRSOD\HGJXDUGRQWKH3DOR$OWREDVNHWEDOOWHDPDQGDYHUDJHG 2016 (FRESHMAN):5HGVKLUWHG SRLQWVSHUJDPHDVDMXQLRU HIGH SCHOOL: 1DPHGWKH'LVWULFW$2IIHQVLYH093E\WKH+RXVWRQ PERSONAL: %RUQ LQ 0RXQWDLQ 9LHZ &DOLI VRQ RI 0RQLTXH %XUQV DQG &KURQLFOHOHG'LVWULFW$LQUXVKLQJDVDVHQLRUFDUU\LQJWKHEDOOWLPHV 6HDQ-RKQVRQKDVRQHROGHUEURWKHU9LQFH0LOHVZKRSOD\VVDIHW\DW6DQ-RVH IRU \DUGV DQG WRXFKGRZQV DYHUDJHG \DUGV SHU FDUU\ KHOSHG 6WDWHDIWHUWUDQVIHUULQJRYHUIURP$UL]RQDDWWHQGHGWKHVDPHKLJKVFKRRODV 3HDUODQG'DZVRQJRZLWKDWKLUGSODFHGLVWULFWÀQLVKDQGTXDOLI\IRUWKH&ODVV IRUPHU%XOOGRJZLGHUHFHLYHU'DYDQWH$GDPVZKROHIW)UHVQR6WDWHDIWHU $SOD\RIIVWKHKLJKHVWFODVVLÀFDWLRQLQWKHVWDWHRI 7H[DVÀUVWWHDP$OO DVWKHVFKRRO·VDOOWLPHOHDGHULQUHFHSWLRQVDQGWRXFKGRZQFDWFKHV$GDPVZDV 'LVWULFWVHOHFWLRQDVDMXQLRUZKHQKHOHGWKH(DJOHVWRDUHFRUGUHDFKLQJWKH DVHFRQGURXQGGUDIWSLFN 1RRYHUDOO RI WKH*UHHQ%D\3DFNHUVLQWKH UHJLRQDOVHPLÀQDOURXQGRI WKH$'LYLVLRQ,,SOD\RIIVUXVKHGWLPHVIRU 1)/'UDIWPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\ODZHQIRUFHPHQW \DUGVDQGWRXFKGRZQVLQDYHUDJLQJ\DUGVSHUFDUU\ KEESEAN JOHNSON’S CAREER STATS RUSHING G Att Yds TD Lg Avg/C Avg/G PERSONAL: %RUQ LQ +RXVWRQ 7H[DV « VRQ RI 6XSHULRQ DQG 0LFKHOLQD 2015 12 0 0 0 0 0.0 0.0 -RKQVRQ«KDVVHYHQVLEOLQJV²$OD\D$QXHUQHH'DYRU\-DUUHW-DVPLQH-RXUQH\ 2016 12 3 13 0 10 4.3 1.1 TOTAL 24 3 13 0 10 4.3 0.5 DQG6XSHULRQ«KDVQRWGHFODUHGDWPDMRUDW)UHVQR6WDWH RECEIVING G Rec Yds TD Lg Rec/G Avg/C Avg/G 2015 12 37 337 2 29 3.1 9.1 28.1 2016 12 66 773 6 53 5.5 11.7 64.4 TOTAL 24 103 1110 8 53 4.3 10.8 46.2 PUNT RETURNS G No. Yds TD Lg Avg/R Avg/G 2015 12 1 7 0 7 7.0 0.6 2016 12 6 36 0 10 6.0 3.0 TOTAL 24 7 43 0 10 6.1 1.8 KICK RETURNS G No. Yds TD Lg Avg/R Avg/G 2015 12 0 0 0 0 0.0 0.0 2016 12 11 227 0 29 20.6 18.9 TOTAL 24 11 227 0 29 20.6 9.5 ALL PURPOSE G Rush Rec PR KR IR Total Avg/G 2015 12 0 337 7 0 0 344 28.7 2016 12 13 773 36 227 0 1049 87.4 TOTAL 24 13 1110 43 227 0 1393 58.0 40 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES JAMIRE JORDAN’S CAREER STATS RUSHING G Att Yds TD Lg Avg/C Avg/G 1 2015 12 10 55 1 25 5.5 4.6 2016 12 17 83 1 14 4.9 6.9 TOTAL 24 27 138 2 25 5.1 5.8 JAMIRE JORDAN WR RECEIVING G Rec Yds TD Lg Rec/G Avg/C Avg/G 5-11 | 171 | Jr. | 4th Year 2015 12 46 540 5 82 3.8 11.7 45.0 2016 12 45 713 2 85 3.8 15.8 59.4 Lancaster, Calif. (Highland HS) TOTAL 24 91 1253 7 85 3.8 13.8 52.2 CAREER GAMES: 24 STARTS: 20 SCORING G TD Rush Pass Retn PAT 2PAT FG Total Avg/G 2015 12 6 1 5 0 0 0 0 36 3.0 2016 12 3 1 2 0 0 0 0 18 1.5 2016 (SOPHOMORE): 3OD\HGLQDOOJDPHVDQGPDGHQLQHFRQVHFXWLYHVWDUWV TOTAL 24 9 2 7 0 0 0 0 54 2.2 WRHQGWKHVHDVRQ«ZDVWKHWHDP·VVHFRQGOHDGLQJSDVVFDWFKHUIRU\DUGVZLWK KICK RETURNS G No. Yds TD Lg Avg/R Avg/G DQGRZQHGWKHWHDP·VWKLUGPRVWUHFHSWLRQVZLWK«SRVWHGDWHDPKLJK 2015 12 16 315 0 50 19.7 26.2 WKUHH\DUGUHFHLYLQJJDPHVDQGZDVRQHRI HLJKW0RXQWDLQ:HVWSOD\HUVWR 2016 12 12 253 0 28 21.1 21.1 TOTAL 24 28 568 0 50 20.3 23.7 RZQDWOHDVWWKUHHJDPHVZLWK\DUGSOXVSHUIRUPDQFHVLQ«UDQNHG QLQWKLQWKHOHDJXHZLWK\DUGVUHFHLYLQJDQGUDQNHGQLQWKLQWKHOHDJXHZLWK ALL PURPOSE G Rush Rec PR KR IR Total Avg/G 2015 12 55 540 0 315 0 910 75.8 \DUGVUHFHLYLQJSHUJDPH«UHFRUGHGWKHVHFRQGORQJHVWUHFHSWLRQLQWKH 2016 12 83 713 0 253 0 1049 87.4 0:ZLWKDQ\DUGWRXFKGRZQJUDEDW7ROHGRRQ6HSWLWZDVWKHWKWLPH TOTAL 24 138 1253 0 568 0 1959 81.6 LQ)UHVQR6WDWHKLVWRU\DSOD\HUUHFRUGHGD\DUGRUORQJHUUHFHSWLRQDQGZDV JAMIRE JORDAN’S SINGLE-GAME HIGHS DOVRRQHRI FDWFKHVWRJRIRU\DUGVSOXVLQWKH)%6LQ«KLV\DUGV Receptions: 10 - at Utah State, 2016 SHUUHFHSWLRQRI OHGWKHWHDPDQGUDQNHGWKLQWKHQDWLRQDQGZDVWK Receiving Yards: 115 - Air Force, 2016 EHVWLQWKHFRQIHUHQFH«VFRUHGWKUHHWLPHVLQDQGWZRRI WKHWRXFKGRZQV Receiving Touchdowns: 1 - 7x ZHUHPDGHDJDLQVW7XOVDRQ6HSWRQHD\DUGUXQRII RI DIXPEOHUHFRYHU\ Long reception: 85 - at Toledo, 2016 DQGWKHQH[WD\DUGUHFHSWLRQ«VHWDVHDVRQDQGFDUHHUKLJKIRUVLQJOHJDPH Kick Returns: 5 - vs. Colorado State, 2015 UHFHSWLRQVDW8WDK6WDWHRQ2FWZLWK IRU\DUGV «VHWDVHDVRQDQG Kick Return Yards: 106 - vs. Colorado State, 2015 FDUHHUKLJKIRUVLQJOHJDPHUHFHLYLQJ\DUGVYV$LU)RUFHRQ2FWZLWK Long kick return: 50 - vs. Colorado State, 2015 \DUGV RQIRXUUHFHSWLRQV «RYHUÀUVWIRXUQRQFRQIHUHQFHJDPHVUDFNHGXS All-Purpose Yards: 176 - Air Force, 2016 FDWFKHVIRU\DUGVDQGWZRWRXFKGRZQV«VHUYHGXSDWHDPOHDGLQJDOO SXUSRVH\DUGVDVQRWRQO\DSDVVLQJDWWDFNZHDSRQEXWZDVWKHWHDPOHDGHULQNLFN JAMIRE JORDAN’S GAME-BY-GAME UHWXUQ\DUGV DQGZDVDUXQJDPHFRQWULEXWRUZLWK\DUGVRQWKHJURXQG« Rushing Receiving Kick Ret. All- KDVFDXJKWDWOHDVWRQHSDVVLQHYHU\FDUHHUJDPHVWUDLJKW 2016 - Soph. Att Yds TD Rec Yds TD Lg # Yds TD Lg Purp at Nebraska 1 1 0 5 52 0 16 0 0 0 0 53 2015 (REDSHIRT FRESHMAN): 3OD\HGLQDOOJDPHVPDNLQJVWDUWV Sacramento State 0 0 0 7 100 0 26 0 0 0 0 100 EHFDPHMXVWWKHIRXUWKIUHVKPDQLQVFKRROKLVWRU\JRLQJEDFNWRWROHDGWKH at Toledo 0 0 0 1 85 1 85 1 21 0 21 106 Tulsa 0 44 1 6 108 1 65 0 0 0 0 152 WHDPLQFDWFKHVDQGUHFHLYLQJ\DUGVOHGDOO0RXQWDLQ:HVWIUHVKPHQLQLQ at UNLV 6 16 0 2 10 0 6 3 70 0 28 96 UHFHSWLRQV UHFHLYLQJ\DUGV UHFHLYLQJWRXFKGRZQV ÀYH DQGDOOSXUSRVH at Nevada 0 0 0 3 50 0 25 0 0 0 0 50 \DUGV DOVRWLHGIRUWKH0:OHDGDPRQJIUHVKPHQLQWRWDOWRXFKGRZQV San Diego State 0 0 0 1 49 0 49 0 0 0 0 49 VFRUHGZLWKVL[KDGDVHDVRQKLJKHLJKWUHFHSWLRQVIRU\DUGVDW%<8ZKLFK at Utah State 0 0 0 10 67 0 11 2 42 0 22 109 ZDVDOVRWKHWHDPKLJKIRUFDWFKHVLQDJDPHRQWKHVHDVRQEHFDPHWKHÀUVW Air Force 3 21 0 4 115 0 58 2 40 0 22 176 %XOOGRJIUHVKPDQZLWKD\DUGUHFHLYLQJJDPHVLQFH'DYDQWH$GDPVLQ at Colorado State 4 15 0 3 64 0 48 1 19 0 19 98 ZKHQKHFDXJKWWKUHHSDVVHVIRU\DUGVDQGRQH7'DJDLQVW1R8WDK Hawai’i 2 -5 0 2 2 0 2 2 42 0 24 39 San Jose State 1 -9 0 1 11 0 11 1 19 0 19 21 KDGDQ\DUGWRXFKGRZQUHFHSWLRQDJDLQVWWKHQDWLRQDOO\UDQNHG8WHVZKLFK TOTALS 17 83 1 45 713 2 85 12 253 0 28 1049 ZDVWKHORQJHVWWRXFKGRZQFDWFKE\D%XOOGRJVLQFH$GDPVVFRUHGRQDQ\DUG SOD\LQDW1HZ0H[LFRKDGKLVÀUVWFDUHHUPXOWLWRXFKGRZQJDPHFDPH Rushing Receiving Kick Ret. All- RQ6HSWDW6DQ-RVH6WDWHZKHQKHKDGDVHYHQ\DUGWRXFKGRZQFDWFKDQGD 2015 - RFr. Att Yds TD Rec Yds TD Lg # Yds TD Lg Purp ÀYH\DUGWRXFKGRZQUXQDOVRUHWXUQHGNLFNRIIVIRUDQDYHUDJHRI \DUGV Abilene Christian 0 0 0 3 41 1 25 2 33 0 17 74 KLVORQJHVWUHWXUQEHLQJ\DUGVLQWKHVHDVRQÀQDOHDJDLQVW&RORUDGR6WDWH at No. 14 Ole Miss 0 0 0 3 3 0 3 3 39 0 20 41 No. 21 Utah 0 0 0 3 102 1 82 1 10 0 10 112 2014 (FRESHMAN): 5HGVKLUWHG at San Jose State 3 7 1 5 45 1 19 3 82 0 47 134 at San Diego State 0 0 0 2 18 0 13 0 0 0 0 18 HIGH SCHOOL:-RLQHGWKH%XOOGRJVIURP+LJKODQG+LJK6FKRROZKHUHKH Utah State 1 5 0 5 44 1 21 0 0 0 0 49 ZDVDVWDQGRXWDWKOHWHDQGUHWXUQVSHFLDOLVWIRUFRDFK7UR\-DFNVRQWKUHH\HDU UNLV 2 24 0 5 42 0 17 0 0 0 0 66 YDUVLW\PHPEHUDQGWZRWLPH$OO*ROGHQ&RQIHUHQFHÀUVWWHDPVHOHFWLRQLQ at Air Force 0 0 0 1 10 0 10 0 0 0 0 10 KHÀQLVKHGZLWKWRWDO\DUGVDQGWRWDOWRXFKGRZQVKHDYHUDJHG Nevada 1 9 0 3 50 0 24 0 0 0 0 59 \DUGVSHUUHFHSWLRQDVDVHQLRUWKH+LJKODQG%XOOGRJV DGYDQFHGWR at Hawai`i 3 10 0 4 79 1 64 0 0 0 0 89 at BYU 0 0 0 8 54 0 18 2 46 0 34 100 WKHVHFRQGURXQGRI WKH&,)6RXWKHUQ6HFWLRQ1RUWKHUQGLYLVLRQSOD\RIIVDV Colorado State 0 0 0 4 52 0 21 5 106 0 50 158 DMXQLRUKHZDVQDPHGÀUVWWHDP$OO&RQIHUHQFHRQRIIHQVHÀQLVKHGWKH TOTALS 10 55 1 46 540 5 82 16 315 0 50 910 VHDVRQZLWKDOOSXUSRVH\DUGVDQGWRXFKGRZQVDVKHKHOSHGOHDGWKH +LJKODQG%XOOGRJVWRD&,)6RXWKHUQ6HFWLRQ1RUWKHUQ'LYLVLRQSOD\RII EHUWK ZDVDOVRDPHPEHURI WKH+LJKODQGWUDFNWHDPFRPSHWLQJLQWKHPKXUGOHV DQGWKHKLJKMXPS PERSONAL: %RUQLQ%XUEDQN&DOLIVRQRI 'HDQQDDQG-DPHV-RUGDQ KDVWKUHHVLEOLQJVIDYRULWHDWKOHWHLV/HEURQ-DPHVPDMRUDW)UHVQR6WDWHLV FULPLQRORJ\FRUUHFWLRQV 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 41 THE BULLDOGS: RETURNEES WKDWRQHEHLQJD\DUGFRQQHFWLRQLQWKH$ELOHQH&KULVWLDQYLFWRU\OHGWKH 6 WHDPLQVFRULQJRQWKHVHDVRQZLWKWRWDOSRLQWV 2014 (FRESHMAN): 1DPHGWRWKH$FDGHPLF$OO0RXQWDLQ:HVW7HDP ANTHOULA (TANK) KELLY DB VHUYHGDVWKH%XOOGRJV·SULPDU\SODFHNLFNHULQRI JDPHVDVDWUXHIUHVKPDQ 5-10 | 185 | Jr. | 4th Year ZDONRQPDGHRIÀHOGJRDOWULHVRQWKH\HDUDQGZHQWIRURQ3$7V Galena Park, Texas (Galena Park HS) PDGHRIÀHOGJRDOWULHVLQ0RXQWDLQ:HVWJDPHVFRQQHFWHGRQRI3$7V CAREER GAMES: 16 STARTS: 1 LQÀUVWFDUHHUJDPHDW8WDKRQ6HSWÀUVWFDUHHUPDGHÀHOGJRDOZDV\DUGV RQ6HSWYV1HEUDVNDLQWKHVHFRQGTXDUWHUÀUVWFDUHHUDWWHPSW \DUGV ZDV 2016 (SOPHOMORE): 3OD\HGLQVHYHQJDPHVDQGPDGHRQHVWDUW«ÀUVWFDUHHU PLVVHGLQÀUVWTXDUWHUDJDLQVWWKH+XVNHUVKLWVHDVRQORQJÀHOGJRDORI \DUGV VWDUWZDVDW8WDK6WDWHRQ2FW«UHFRUGHGHLJKWWDFNOHVDQGWZRSDVVEUHDNXSV DW%RLVH6WDWHRQ2FWDJDPHKHZHQWIRUDOVRFRQQHFWHGRQD\DUGHU LQ«WDOOLHGDVLQJOHJDPHVHDVRQKLJKIRXUWDFNOHVDW&RORUDGR6WDWHRQ LQWKH+DZDLCL%RZORI KLVÀYHPLVVHGÀHOGJRDOVWKUHHZHUHEORFNHG 1RY«UHWXUQHGRQHNLFNRII IRU\DUGVDW1HEUDVNDRQ6HSW HIGH SCHOOL: $WWHQGHG9DOOH\&KULVWLDQ+LJK6FKRROZKHUHKHZDVDOVRD 2015 (REDSHIRT FRESHMAN): 3OD\HG LQ QLQH JDPHV RQ WKH VHDVRQ « PHPEHURI WKHVRFFHUWHDP SRVWHGWDFNOHVRQWKH\HDU«KLVVHDVRQKLJKZDVÀYHVWRSVLQZHHNWZRDW PERSONAL: %RUQLQ6DQ-RVH&DOLIVRQRI .ULVDQG7DPP\.URHQLQJ 1R2OH0LVV KDVRQHEURWKHU.\OHDQGRQHVLVWHU.HOVH\EXVLQHVVPDQDJHPHQWPDMRUDW 2014 (FRESHMAN): 5HGVKLUWHG )UHVQR6WDWH HIGH SCHOOL: 3OD\HG TXDUWHUEDFN ZLGH UHFHLYHU FRUQHUEDFN DQG VDIHW\ KODY KROENING’S CAREER STATS ZKLOHDOVRVHHLQJWLPHDVDSXQWDQGNLFNUHWXUQHUIRUWKH ZLGHUHFHLYHUGXULQJMXQLRUVHDVRQRI XQGHUFRDFK5D\=HSHGDKDG FIELD GOALS G Att Made Lg Pct DOOSXUSRVH\DUGVDQGQLQHWRWDOWRXFKGRZQVFDXJKWSDVVHVIRU\DUGVDQG 2014 13 14 9 44 64.3 2015 12 8 6 40 75.0 VL[WRXFKGRZQVZKLOHUXVKLQJIRU\DUGVDQGWZRVFRUHVLQDOVRKDG 2016 11 17 15 49 88.2 WZRLQWHUFHSWLRQVGXULQJKLVMXQLRUVHDVRQZDVDOVRDJXDUGRQWKHEDVNHWEDOO TOTAL 36 39 30 49 76.9 WHDPZKRDYHUDJHGSRLQWVKDGDVVLVWVVWHDOVDQGEORFNVGXULQJ MXQLRUVHDVRQ KODY KROENING’S GAME-BY-GAME Field Goals PERSONAL: %RUQLQ+RXVWRQ7H[DVVRQRI 7DQJHUQLNDDQG$QWKRXOD.HOO\ 2016 - Junior FGM-FGA Long 01-19 20-29 30-39 40-49 50+ BLK PAT 6UKDVRQH\RXQJHUEURWKHU$PDULRQFRPPXQLFDWLRQPDMRUDW)UHVQR6WDWH at Nebraska 1-2 26 0-0 1-1 0-1 0-0 0-0 0 1-1 TANK KELLY’S CAREER STATS Sacramento State 1-1 21 0-0 1-1 0-0 0-0 0-0 0 4-4 TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH at Toledo 1-1 42 0-0 0-0 0-0 1-1 0-0 0 2-2 2015 9 10 6 16 0.0 0 0 0 0 0 0 Tulsa 2-2 25 0-0 2-2 0-0 0-0 0-0 0 5-5 2016 7 6 2 8 0.0 0 2 0 0 0 0 TOTAL 16 16 8 24 0.0 0 2 0 0 0 0 at UNLV 2-2 47 0-0 0-0 0-0 2-2 0-0 0 2-2 at Nevada 3-3 44 0-0 1-1 1-1 1-1 0-0 0 1-1 TANK KELLY’S SINGLE-GAME HIGHS San Diego State 1-1 39 0-0 0-0 1-1 0-0 0-0 0 0-0 Solo Tackles: 3 - 2x (last, at Colorado State-2016) at Utah State 2-2 49 0-0 1-1 0-0 1-1 0-0 0 2-2 Total Tackles: 5 - 2x (last, at Air Force, 2015) Air Force 0-0 - 0-0 0-0 0-0 0-0 0-0 0 3-3 at Colorado State 0-0 - 0-0 0-0 0-0 0-0 0-0 0 0-0 Hawai’i 2-3 47 0-0 1-1 0-0 1-2 0-0 1 1-1 San Jose State 0-0 - 0-0 0-0 0-0 0-0 0-0 0 2-2 48 TOTALS 15-17 49 0-0 7-7 2-3 6-7 0-0 1 23-23 Field Goals KODY KROENING K 2015 - Sophomore FGM-FGA Long 01-19 20-29 30-39 40-49 50+ BLK PAT 5-11 | 180 | Sr. | 4th Year Abilene Christian 1-1 40 0-0 0-0 0-0 1-1 0-0 0 4-4 San Jose, Calif. (Valley Christian HS) at No. 14 Ole Miss 0-0 - 0-0 0-0 0-0 0-0 0-0 0 3-3 No. 21 Utah 1-1 35 0-0 0-0 1-1 0-0 0-0 0 3-3 CAREER GAMES: 36 at San Jose State 1-1 39 0-0 0-0 1-1 0-0 0-0 0 2-3 at San Diego State 0-0 - 0-0 0-0 0-0 0-0 0-0 0 1-1 2016 (JUNIOR):/RX*UR]D3ODFH.LFNHU$ZDUGVHPLÀQDOLVWDQG$OO0RXQWDLQ Utah State 0-0 - 0-0 0-0 0-0 0-0 0-0 0 2-2 UNLV 0-1 - 0-0 0-1 0-0 0-0 0-0 0 2-2 :HVWKRQRUDEOHPHQWLRQVHOHFWLRQ«SOD\HGLQRI JDPHV²WHDPGLGQRW at Air Force 0-0 - 0-0 0-0 0-0 0-0 0-0 0 2-2 KDYHDÀHOGJRDORUSRLQWDIWHUDWWHPSWLQWKHVLQJOHFRQWHVWQRWDSSHDUHGLQ« Nevada 1-1 25 0-0 1-1 0-0 0-0 0-0 0 1-2 PDGHFRQVHFXWLYHÀHOGJRDOVW\LQJDVLQJOHVHDVRQVFKRROUHFRUGVHWE\.HYLQ at Hawai`i 0-0 - 0-0 0-0 0-0 0-0 0-0 0 6-6 *RHVVOLQJLQ²PLVVHGKLVÀUVWDWWHPSWRI WKHVHDVRQDQGODVWDWWHPSWRI at BYU 1-2 28 0-0 1-1 0-1 0-0 0-0 1 1-1 WKHVHDVRQOHDYLQJKLPZLWKDQDFFXUDF\SHUFHQWDJH RI «DFFXUDF\ Colorado State 1-1 33 0-0 0-0 1-1 0-0 0-0 0 4-4 SHUFHQWDJHUDQNHG1RLQWKH)%6DQG1RLQWKH0:²WKH0:ZDVKRPH TOTALS 6-8 40 0-0 2-3 3-4 1-1 0-0 1 31-33 WRVL[RI )%6IRRWEDOO·VPRVWDFFXUDWHNLFNHUVLQ«UDQNHG1RLQWKH 0:LQÀHOGJRDOVSHUJDPHZLWKZKLFKDOVRUDQNHG1RLQWKH)%6« ZDVSHUIHFWRQ3$7NLFNLQJ RI «VFRUHGDWHDPKLJKSRLQWVIRU)UHVQR 6WDWH«VHWFDUHHUORQJPDGHÀHOGJRDORQ2FWDW8WDK6WDWHZLWKD\DUG )*DIWHUSUHYLRXVO\VHWWLQJDFDUHHUORQJRI \DUGVRQ2FWDW81/9«RI PDGHÀHOGJRDOVZHUHRI GLVWDQFHVJUHDWHUWKDQ\DUGVWKHRQO\PLVVZDVD \DUGHUEORFNHGRQ1RYYV+DZDL·LDWWKHHQGRI UHJXODWLRQ«VLQJOHJDPH KLJKIRUPDGHÀHOGJRDOVZDVWKUHHZKLFKFRQVLVWHGRI PDNHVRIDQGDW 1HYDGDRQ2FW«KDGRQHNLFNRII DWWHPSWWKDWWUDYHOHG\DUGV 2015 (SOPHOMORE): $SSHDUHG LQ DOO JDPHV PDNLQJ RI ÀHOG JRDO DWWHPSWVDQGRISRLQWDIWHUDWWHPSWVZDVIRURQÀHOGJRDODWWHPSWV IURP\DUGVRIIURP\DUGV\DUGDQGIRUIURP\DUGVRXW 42 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES KODY KROENING’S GAME-BY-GAME (CONT.) NATHAN MADSEN’S GAME-BY-GAME Field Goals Tackles 2014 - Freshman FGM-FGA Long 01-19 20-29 30-39 40-49 50+ BLK PAT 2016 - Junior UA A Total TFL-Yds Sacks-Yds FF FR QBH at No. 15 USC DNP at Nebraska 3 1 4 0.0-0 0.0-0 0 0 0 at Utah 0-0 - 0-0 0-0 0-0 0-0 0-0 0 3-3 Sacramento State 1 0 1 1.0-8 1.0-8 0 0 0 No. 21 Nebraska 1-2 27 0-0 1-1 0-1 0-0 0-0 0 2-2 at Toledo 0 0 0 0.0-0 0.0-0 0 0 0 Southern Utah 0-0 - 0-0 0-0 0-0 0-0 0-0 0 8-8 Tulsa 4 0 4 0.0-0 0.0-0 0 0 0 at New Mexico 0-0 - 0-0 0-0 0-0 0-0 0-0 0 5-5 at UNLV 1 3 4 0.0-0 0.0-0 0 0 0 San Diego State 1-2 37 0-0 0-0 1-2 0-0 0-0 1 3-3 at Nevada 0 0 0 0.0-0 0.0-0 0 0 0 at UNLV 0-0 - 0-0 0-0 0-0 0-0 0-0 0 3-4 San Diego State 0 2 2 0.0-0 0.0-0 0 0 0 at Boise State 2-2 44 0-0 0-0 1-1 1-1 0-0 0 3-3 at Utah State 0 0 0 0.0-0 0.0-0 0 0 0 Air Force 1 1 2 0.0-0 0.0-0 0 0 0 Wyoming 1-1 28 0-0 1-1 0-0 0-0 0-0 0 2-2 at Colorado State 0 0 0 0.0-0 0.0-0 0 0 1 San Jose State 1-1 26 0-0 1-1 0-0 0-0 0-0 0 5-5 Hawai’i 0 1 1 0.0-0 0.0-0 0 0 0 at Nevada 1-2 32 0-0 0-0 1-1 0-1 0-0 0 5-5 San Jose State 1 3 4 0.5-3 0.5-3 0 0 0 Hawai`i 0-0 - 0-0 0-0 0-0 0-0 0-0 0 4-4 TOTALS 11 11 22 1.5-11 1.5-11 0 0 1 at No. 22 Boise St.! 0-1 - 0-0 0-0 0-1 0-0 0-0 1 2-2 vs. Rice* 2-3 44 0-0 0-0 0-0 2-3 0-0 1 0-0 Tackles TOTALS 9-14 44 0-0 3-3 3-6 3-5 0-0 3 45-46 2015 - Sophomore UA A Total TFL-Yds Sacks-Yds FF FR QBH ! - Sports Authority Mountain West Championship Game Abilene Christian 1 0 1 0.0-0 0.0-0 0 0 0 * - Hawai’i Bowl at No. 14 Ole Miss 0 0 0 0.0-0 0.0-0 0 0 0 Career Long FG: 44 yards (2x) | Career Long FG Att.: 44 yards (4x) No. 21 Utah 2 3 5 0.5-1 0.0-0 0 0 0 at San Jose State 1 2 3 1.0-3 1.0-3 0 0 0 at San Diego State 0 2 2 1.0-9 0.5-7 0 0 0 Utah State 2 0 2 0.0-0 0.0-0 0 0 0 91 UNLV 1 0 1 0.0-0 0.0-0 0 0 1 Nevada 0 0 0 0.0-0 0.0-0 0 0 0 at Hawai`i 2 0 2 0.0-0 0.0-0 0 0 0 NATHAN MADSEN DT at BYU 1 2 3 1.0-3 0.0-0 0 0 0 6-4 | 298 | Sr. | 5th Year Colorado State 0 0 0 0.0-0 0.0-0 0 0 0 Eureka, Calif. (Eureka HS) TOTALS 10 9 19 3.5-16 1.5-10 0 0 1 CAREER GAMES: 37 STARTS: 26 Tackles 2014 - RFr. UA A Total TFL-Yds Sacks-Yds FF FR QBH 2016 (JUNIOR): 6WDUWHGJDPHVDQGSOD\HGLQDOO²VQDSSHGVWUHDNRI at No. 15 USC 0 1 1 0.0-0 0.0-0 0 0 0 at Utah 0 0 0 0.0-0 0.0-0 0 0 0 FRQVHFXWLYHVWDUWVLQWKHVHDVRQÀQDOH«PRYHGEDFNWRGHIHQVLYHHQGDVDMXQLRU No. 21 Nebraska 1 0 1 0.0-0 0.0-0 0 0 0 DIWHUDVHDVRQDWQRVHJXDUGWKH\HDUEHIRUH«UHJLVWHUHGWDFNOHV VROR Southern Utah 2 1 3 2.0-2 0.0-0 0 0 0 VDFNVDQGWDFNOHVIRUDORVVLQJDPHV«WDOOLHGDVLQJOHJDPHVHDVRQKLJK at New Mexico 1 0 1 0.0-0 0.0-0 0 0 0 IRXUWDFNOHVIRXUWLPHV²DW1HEUDVND 6HSW YV7XOVD 6HSW DW81/9 2FW San Diego State 0 1 1 0.0-0 0.0-0 0 0 0 DQGYV6DQ-RVH6WDWH 1RY «RIVHDVRQVDFNWRWDOUHFRUGHGRQHVDFN at UNLV 0 2 2 0.0-0 0.0-0 0 0 0 at Boise State 0 1 1 0.0-0 0.0-0 0 0 0 RQ6HSWYV6DFUDPHQWR6WDWHDQGKDOIDVDFNRQ1RYYV6-68 Wyoming 0 0 0 0.0-0 0.0-0 0 0 0 San Jose State 0 0 0 0.0-0 0.0-0 0 0 0 2015 (SOPHOMORE): 3OD\HGDQGVWDUWHGLQFRQWHVWVDWQRVHJXDUGPLVVHG at Nevada 0 1 1 0.0-0 0.0-0 0 0 0 WKH$LU)RUFHJDPHGXHWRLQMXU\UHFRUGHGWDFNOHVRQWKHVHDVRQWDFNOHV Hawai`i 0 0 0 0.0-0 0.0-0 0 0 0 IRUDORVVDQGVDFNVKDGDFDUHHUKLJKÀYHWDFNOHVLQWKH6HSWJDPH at Boise State! 0 0 0 0.0-0 0.0-0 0 0 0 DJDLQVW1R8WDKUHFRUGHGKLVÀUVWFDUHHUVDFNLQWKHFRQIHUHQFHRSHQHUDW vs. Rice* 0 0 0 0.0-0 0.0-0 0 0 0 6DQ-RVH6WDWHDJDPHLQZKLFKWKH%XOOGRJVKDGDVHDVRQKLJKVL[VDFNV TOTALS 4 7 11 2.0-2 0.0-0 0 0 0 ! - Sports Authority Mountain West Championship Game 2014 (REDSHIRT FRESHMAN): $FDGHPLF $OO0RXQWDLQ :HVW WHDP * - Hawai’i Bowl VHOHFWLRQSOD\HGLQDOOJDPHVDQGPDGHIRXUVWDUWVDWGHIHQVLYHHQGWRWDOHG NATHAN MADSEN’S SINGLE-GAME HIGHS WDFNOHV IRXUVROR WDFNOHVIRUORVVDQGWZRSDVVEUHDNXSVUHJLVWHUHGDW Solo Tackles: 4 - vs. Tulsa, 2016 OHDVWRQHWDFNOHLQHLJKWRI JDPHVPDGHÀUVWFDUHHUWDFNOHDW1R86&LQ Total Tackles: 5 - vs. No. 21 Utah, 2015 WKHVHDVRQRSHQHUOHGWKHWHDPZLWKWDFNOHVIRUORVVYV6RXWKHUQ8WDKDQG VHWFDUHHUKLJKVLQERWKWDFNOHV DQGWDFNOHVIRUORVV KDGSDVVEUHDNXSVLQ JDPHVDW1HZ0H[LFRDQGYV+DZDL·LGHÁHFWHGDSDVVDWWKHOLQHRI VFULPPDJH WKDWOHGWRDQLQWHUFHSWLRQE\WHDPPDWH.\ULH:LOVRQLQD1RYZLQRYHU6DQ 27 -RVH6WDWH KA’LONN MILTON DB 2013 (FRESHMAN): 5HGVKLUWHG 6-0 | 185 | RSo. | 3rd Year HIGH SCHOOL: :DV VHOHFWHG WR SOD\ LQ WKH &DO 6WDWH %RZO $OO6WDU Fresno, Calif. (Buchanan HS/Fresno City College) *DPH IROORZLQJ KLV VHQLRU VHDVRQ UDFNHG XS WDFNOHV WZR VDFNV VL[ SDVV EUHDNXSVWZRIRUFHGIXPEOHVDQGRQHIXPEOHUHFRYHU\LQFDXJKWHLJKW SDVVHVDVDWLJKWHQGIRU\DUGVDQGWZRWRXFKGRZQVDVDVHQLRU 2016 (SOPHOMORE): 5HGVKLUWHG PERSONAL: %RUQLQ(XUHND&DOLIVRQRI 7HUUDDQG-DPHV0DGVHQKDVWZR PRIOR TO FRESNO STATE: *UH\VKLUWHGLQDQGVWDUWHGJDPHVDVD ROGHUVLEOLQJVOLVWVKLVIDYRULWHDWKOHWHDV--:DWWHQYLURQPHQWDOVFLHQFHVPDMRU IUHVKPDQDW)UHVQR&LW\&ROOHJHLQ«UHJLVWHUHGWDFNOHV«SRVWHGRQH LQWHUFHSWLRQDQGUHWXUQHGLW\DUGV«DOVRUHFRUGHGWZRSDVVEUHDNXSV NATHAN MADSEN’S CAREER STATS TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH HIGH SCHOOL: 7KUHH\HDU YDUVLW\ OHWWHUZLQQHU LQ IRRWEDOO DW %XFKDQDQ 2014 14 4 7 11 2.0 2 2 0 0 0 0 2015 11 10 9 19 3.5 16 0 0 0 0 1 JUDGXDWHG -XQH « SOD\HGGHIHQVLYHEDFN DQG ZLGHUHFHLYHU «UDQWUDFN 2016 12 11 11 22 1.5 11 0 0 0 0 1 GXULQJKLVVHQLRU\HDU TOTAL 37 25 27 52 7.0 29 2 0 0 0 2 SACKS G UA A Total Yds PERSONAL: 6RQRI &DUODDQG&KULV0LOWRQKDVRQH\RXQJHUEURWKHU.HQGDOO 2014 14 0 0 0.0 0 QHSKHZRI IRUPHU$OO3UR.HYLQ+DUG\ZKRSOD\HGQLQHVHDVRQVLQWKH1)/ 2015 11 1 1 1.5 10 2016 12 1 1 1.5 11 IRUWKUHHWHDPVFRPPXQLFDWLRQPDMRUDW)UHVQR6WDWH TOTAL 37 2 2 3.0 21 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 43 THE BULLDOGS: RETURNEES 77 11 AARON MITCHELL OL DEJONTE O’NEAL RB 6-2 | 305 | Sr. | 4th Year 5-7 | 170 | Jr. | 3rd Year San Diego, Calif. (Cathedral Catholic HS) Fresno, Calif. (Bullard HS) CAREER GAMES: 25 STARTS: 24 CAREER GAMES: 8 2016 (JUNIOR): 6WDUWHGDOOJDPHVÀUVWIRXUJDPHVDWOHIWJXDUGDQGÀQDO 2016 (SOPHOMORE):3OD\HGLQÀUVWIRXUJDPHVRI WKHVHDVRQEHIRUHVXIIHULQJ HLJKWDWFHQWHU«ZLWKVWUDLJKWVWDUWVGDWLQJEDFNWRVRSKRPRUHVHDVRQHQWHUV VHDVRQHQGLQJNQHHLQMXU\RQ6HSWDJDLQVW7XOVD«LQIRXUFRQWHVWVQHW OHDGLQJWKHWHDPZLWKWKHPRVWFRQVHFXWLYHVWDUWVDQGRZQVWKHVHFRQG \DUGVUXVKLQJRQDWWHPSWVDQGVFRUHGRQFH«ZDVDIHDWXUHNLFNUHWXUQHUZKLOH PRVWFDUHHUVWDUWV«KHOSHGOHDGDUXVKLQJDWWDFNWKDWJDLQHG\DUGVRQWKH DFWLYHDQGUHWXUQHGHLJKWNLFNVIRUDQDYHUDJHRI \DUGVSHUUHWXUQ WRWDO JURXQGOHGE\VWDUWLQJUXQQLQJEDFN'RQWHO-DPHV·\DUGV«EORFNHGIRUD \DUGV «UHJLVWHUHGÀUVWFDUHHUUXVKLQJWRXFKGRZQZLWKDQHLJKW\DUGUXQLQWKH SDVVLQJJDPHWKDWSURGXFHG\DUGVWKURXJKWKHDLUWKHVWDUWLQJOLQHXQLW ÀUVWTXDUWHUYV6DFUDPHQWR6WDWHRQ6HSW«UHFRUGHGDWHDPVHDVRQORQJ OLPLWHGRSSRQHQWVWRVDFNVSHUJDPH \DUGNLFNUHWXUQRQ6HSWDJDLQVW7XOVD 2015 (SOPHOMORE): 3OD\HGDQGVWDUWHGLQDOOJDPHVIRUWKH%XOOGRJVDW 2015 (FRESHMAN):3OD\HGLQIRXUJDPHVUHFHLYHGWKHZHLJKWURRPDZDUGDW OHIWJXDUGKHOSHGOHDGDUXVKLQJDWWDFNWKDWJDLQHG\DUGVRQWKHJURXQG WKHWHDP·VVHDVRQHQGLQJEDQTXHWZDVRQHRI IRXUWUXHIUHVKPHQWRVHHJDPH RI ZKLFKFDPHIURPVWDUWLQJUXQQLQJEDFN0DUWH]H:DOOHUSDUWRI IURQW DFWLRQRQWKHVHDVRQWRWDOHGFDUULHVIRU\DUGVRQWKHVHDVRQELJJHVW ÀYHWKDWZDVÁDJJHGIRUMXVWRI WKH%XOOGRJVSHQDOWLHVRQWKH\HDUDVTXDG JDPHFDPHRQ1RYDW+DZDLCLZKHQKHKDGQLQHFDUULHVIRU\DUGVKLV WKDWUDQNHG1RLQWKHFRXQWU\IRUIHZHVWSHQDOWLHVKHSHUVRQDOO\ZDVÁDJJHG ORQJHVW UXVK RQ WKH \HDU ZHQW IRU \DUGV DW %<8 HQUROOHG LQ VFKRRO DQG IRUMXVWWKUHHSHQDOWLHVDOOIDOVHVWDUWVRQWKHVHDVRQ ZDONHGRQWRWKHSURJUDPDWWKHVWDUWRI WKHVSULQJVHPHVWHU 2014 (FRESHMAN): $SSHDUHGLQRQHJDPHWKH6HSWYLFWRU\RYHU6RXWKHUQ HIGH SCHOOL: 5XVKHGIRUWRXFKGRZQVDQGDYHUDJHG\DUGVSHUFDUU\ 8WDK DVDVHQLRUUXQQLQJEDFNDW%XOODUG+LJK6FKRROLQUXVKHGIRU\DUGV DQGWKUHHWRXFKGRZQVLQDYLFWRU\RYHU3DVR5REOHV HIGH SCHOOL: +HOSHG OHDG &DWKHGUDO &DWKROLF +LJK 6FKRRO WR DQ UHFRUGDQGWKH6DQ'LHJR6HFWLRQ'LYLVLRQ,FKDPSLRQVKLSDVDVHQLRULQ PERSONAL:%RUQLQ)UHVQR&DOLI«VRQRI .HQLVKD2·1HDODQG/DUU\:D\QH SOD\LQJIRUFRDFK6HDQ'R\OHZDVVHOHFWHGWRWKH$OO(DVWHUQ/HDJXHWHDPWZLFH « KDV WZR VLVWHUV $KMHDK DQG 'HMRQ\D DQG RQH EURWKHU -DOHQ « PDMRU DW DVDQRIIHQVLYHOLQHPDQQDPHGWRWKH$OO&,)6DQ'LHJR6HFWLRQÀUVWWHDP )UHVQR6WDWHLVFRPPXQLFDWLRQV DQGZDVQDPHGWKH&DWKHGUDO&DWKROLF2IIHQVLYH3OD\HURI WKH PERSONAL: %RUQLQ2FHDQVLGH&DOLIVRQRI 0LFKHOOHDQG$QWKRQ\0LWFKHOO KDVWKUHHROGHUVLEOLQJVIDWKHUSOD\HGIRRWEDOODWWKH8QLYHUVLW\RI 2NODKRPD 56 PDMRUDW)UHVQR6WDWHLVEXVLQHVVDGPLQLVWUDWLRQVSRUWVPDUNHWLQJ TOBENNA OKEKE DE 6-3 | 245 | Sr. | 4th Year 52 Missouri City, Texas (Elkins HS) CAREER GAMES: 34 STARTS: 12 NETANE MUTI OL 6-3 | 310 | RFr. | 2nd Year 2016 (JUNIOR): 6DZDFWLRQLQDOOJDPHVDQGPDGHVHYHQVWDUWV²VL[VWUDLJKW Wahiawa, Hawai’i (Leilehua HS) WRWKHFORVHVHDVRQ«HLJKWKOHDGLQJWDFNOHURQWKHWHDPZLWKIRUWKH\HDU« UDQNHGVHFRQGRQWKHWHDPZLWKVDFNV«UHFRUGHGDFDUHHUKLJKQLQHWDFNOHV DQGÀUVWFDUHHUIRUFHGIXPEOHRQ2FWDJDLQVW$LU)RUFH«LQWKUHHJDPHVSDQ IURP2FWWR2FWWDOOLHGQROHVVWKDQHLJKWWDFNOHVSHUJDPHDFFXPXODWLQJ 2016 (FRESHMAN):5HGVKLUWHG LQWKDWVSDQ«KDGVHDVRQEHVWVRI IRXUXQDVVLVWHGWDFNOHVLQWKUHHUHVSHFWLYH HIGH SCHOOL: :DVDWZRZD\OLQHPDQIRUWKH0XOHVSOD\LQJERWKOHIWWDFNOH FRQWHVWV DQGOHIWJXDUGRQRIIHQVHZKLOHDSSHDULQJDVQRVHJXDUGDQGHQGRQGHIHQVH 2015 (SOPHOMORE): 3OD\HGLQQLQHJDPHVDQGPDGHÀYHVWDUWVDWRXWVLGH «HDUQHGVHFRQGWHDP6FRULQJ/LYHDOO+DZDLL'LYLVLRQ,KRQRUVDVDQRIIHQVLYH OLQHEDFNHUKHPLVVHGWKUHHJDPHVIURP2FWGXHWRDNQHHLQMXU\VXVWDLQHG OLQHPDQDQGVHFRQGWHDP$PHULFDQ)DPLO\,QVXUDQFH$//86$+DZDL·LKRQRUV LQWKHÀUVWTXDUWHURI WKH6HSWJDPHDW6DQ-RVH6WDWHUHFRUGHGWDFNOHV DVDGHIHQVLYHOLQHPDQDVZHOODVÀUVWWHDPDOO2·DKX,QWHUVFKRODVWLF$VVRFLDWLRQ RQWKHVHDVRQWDFNOHVIRUDORVVDQGRQHVDFNDOVRZDVFUHGLWHGIRUWKUHH 2,$ 5HG KRQRUV DV D GHIHQVLYH OLQHPDQ DQG VHFRQGWHDP DFFRODGHV DV DQ TXDUWHUEDFNKXUULHVWRSSHUIRUPDQFHVRQWKH\HDUFDPHLQWKH1HYDGDJDPH RIIHQVLYHOLQHPDQ ZKHQKHKDGDVHDVRQKLJKVL[WDFNOHVDQGLQWKHVHDVRQRSHQHUDJDLQVW$ELOHQH PERSONAL: %RUQLQWKH3RO\QHVLDQVRYHUHLJQVWDWH7RQJDLQWKHVRXWK3DFLÀF &KULVWLDQZKHQKHSRVWHGDSHUVRQDOEHVWWDFNOHVIRUDORVVLQFOXGLQJKLVORQH «VRQRI 6HPLVL 'DG DQG/LOLDQL 0RP «KDVIRXUVLEOLQJV²$ELJDLO$QQD VDFNRQWKH\HDU 0D·DNHDQG0DQDPR·XL«KLVROGHUEURWKHU0D·DNHLVDPHPEHURIWKH$]XVD 2014 (FRESHMAN): 1DPHGWRWKH$FDGHPLF$OO0RXQWDLQ:HVWWHDP 3DFLÀFIRRWEDOOWHDP«KDVQRWGHFODUHGDPDMRUDW)UHVQR6WDWH SOD\HGLQJDPHVDVDWUXHIUHVKPDQUHFRUGHGÀUVWFDUHHUWDFNOHLQVHFRQG FDUHHUJDPHRQ6HSWDW8WDKDQGÀUVWFDUHHUWDFNOHIRUORVVUHJLVWHUHGÀUVW FDUHHUVDFNDJDLQVW6DQ'LHJR6WDWHRQ2FWWRWDOHGÀYHWDFNOHVRQWKHVHDVRQ RI ZKLFKZHUH7)/VDQGVDFNVDOVRFUHGLWHGZLWKDTXDUWHUEDFNKXUU\ RQ1RYYV6DQ-RVH6WDWH 44 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES HIGH SCHOOL: :DV D ÀUVWWHDP $OO'LVWULFW $ VHOHFWLRQ DV D MXQLRU DQGVHQLRUIRU(ONLQV+LJK6FKRROZKHQKHOHGWKHGLVWULFWLQVDFNVERWK\HDUV 10 KHOSHGOHDGWKH.QLJKWVWRDQUHFRUGGXULQJVHQLRUVHDVRQXQGHUFRDFK 'HQQLV%UDQWOH\LQWKH&ODVV$$UHDSOD\RIIVKHVWULSSHGWKHUXQQLQJEDFNRI WKHEDOODQGUHWXUQHGLW\DUGVIRUDWRXFKGRZQLQDZLQRYHU3RUW$UWKXU NELA OTUKOLO ILB 0HPRULDOUHFRUGHGVDFNVLQWZRVHDVRQVSOD\LQJRQYDUVLW\ 5-11 | 240 | Jr. | 3rd Year Las Vegas, Nev. (Bishop Gorman HS) PERSONAL: %RUQLQ1LJHULDVRQRI 3HWURQLOODDQG*DEULHO2NHNHWKH CAREER GAMES: 18 STARTS: 5 VHFRQGROGHVWRI ÀYHVLEOLQJVKDVWZREURWKHUV*DEULHODQG0LWFKHOODQGWZR VLVWHUV7UDF\DQG &\QWKLDPDMRU DW)UHVQR6WDWHLVEXVLQHVVDGPLQLVWUDWLRQ 2016 (SOPHOMORE): 7KH LQVLGH OLQHEDFNHU SOD\HG LQ JDPHV DQG PDGH VSRUWVPDUNHWLQJ IRXUVWDUWV«RZQHGWKHQLQWKPRVWWDFNOHVRQWKHWHDPZLWKLQFOXGLQJ VRORVWRSV«ZLWKWDFNOHVIRUDORVVKHWLHGIRUWKHVHFRQGPRVWRQWKHWHDP TOBENNA OKEKE’S CAREER STATS «UHFRUGHGWDFNOHVIRUDORVVLQIRXUVWUDLJKWJDPHVIURP6HSW2FW« TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH 2014 13 3 2 5 2.5 7 0 0 0 0 1 KDGDVLQJOHJDPHFDUHHUKLJKWDFNOHVRQ2FWYV6DQ'LHJR6WDWH«KDGD 2015 9 13 9 22 3.5 10 0 0 0 0 3 VHDVRQEHVWVL[VRORWDFNOHVRQ2FWDW81/9«IRUFHGÀUVWFDUHHUIXPEOHYV 2016 12 22 30 52 2.5 17 0 1 0 0 2 $LU)RUFHRQ2FWZKLFKFUHDWHGVHYHQSRLQWVRIIWKHWXUQRYHUIRUWKH¶'RJV TOTAL 34 38 41 79 8.5 34 0 1 0 0 6 «SRVWHGVDFNVRQWKH\HDUDJDLQVW6DFUDPHQWR6WDWHRQ6HSWDQGD KDOIVDFNRQ2FWYV6DQ'LHJR6WDWH«WDOOLHGDSDVVEUHDNXSRQ2FWDW SACKS G UA A Total Yds 2014 13 1 1 1.5 6 8WDK6WDWH 2015 9 1 0 1.0 6 2016 12 2 1 2.5 11 2015 (FRESHMAN): 3OD\HGLQWKHÀUVWHLJKWJDPHVEHIRUHPLVVLQJWKHODVWIRXU TOTAL 34 4 2 5.0 23 ZLWKDNQHHLQMXU\«GUHZKLVÀUVWFDUHHUVWDUWRQ2FWDJDLQVW6DQ'LHJR6WDWH ÀQLVKLQJWKHJDPHZLWKÀYHWDFNOHV«UHFRUGHGDVDFNLQEDFNWREDFNJDPHV TOBENNA OKEKE’S GAME-BY-GAME DJDLQVW8WDK6WDWHDQG81/9«SRVWHGWDFNOHVRQWKHVHDVRQWDFNOHVIRU Tackles DORVVDQGWKRVHWZRVDFNV«UHFRYHUHGKLVÀUVWFDUHHUIXPEOHLQZHHNWZRDW1R 2016 - Junior UA A Total TFL-Yds Sacks-Yds FF FR QBH 2OH0LVV at Nebraska 0 1 1 0.0-0 0.0-0 0 0 0 HIGH SCHOOL: $WWHQGHG SRZHUKRXVH %LVKRS *RUPDQ +LJK 6FKRRO DQG Sacramento State 1 0 1 0.0-0 1.0-8 0 0 0 at Toledo 4 1 5 0.0-0 0.0-0 0 0 0 SOD\HGXQGHUKHDGFRDFK7RQ\6DQFKH]ZKRLVQRZWKHKHDGFRDFKDW81/9 Tulsa 4 0 4 1.0-11 1.0-11 1 0 0 1HYDGD 'HIHQVLYH 3OD\HU RI WKH DQDGGLWLRQDOUHFHLYLQJDQGNLFNUHWXUQ\DUGVORJJHGVL[VRORWDFNOHV 23 LQWKHVHFRQGJDPHRIWKHVHDVRQRQ6HSWYV*UDQDGD+LOOVSRVWHGQLQH WDFNOHVWRWDORQWKHVHDVRQLQWKHVHDVRQRSHQHUDJDLQVW7DIWUHWXUQHGWKUHH KEVIN PARKER WR NLFNVIRU\DUGVLQFOXGLQJD\DUGWRXFKGRZQUHWXUQ&DQRJD3DUNZHQW LQOHDJXHSOD\DQGRYHUDOOIROORZLQJKLVMXQLRUVHDVRQKHZDVQDPHG 5-6 | 150 | RFr. | 2nd Year WRWKHVHFRQGWHDP$OO$UHD%R\V7UDFNDQG)LHOGWHDPIRUWKHPHWHUDQG Oakland, Calif. (Skyline HS) PHWHUUDQLQWKH&,)6WDWHÀQDOVLQ-XQHDQGZDVUHFRJQL]HGE\ WKH/$7LPHVDVRQHRIWKHIDVWHVWIRRWEDOOSOD\HUVLQWKH&LW\6HFWLRQHQWHULQJ WKHVHDVRQ«DVDVHQLRUKHUDQLQWKHPDWWKH/$&LW\6HFWLRQ HIGH SCHOOL: $PDVVHGDOOSXUSRVH\DUGVDVDVHQLRU«KDGFDUULHV SUHOLPVKHOGDW&HUULWRV&ROOHJH«ZRQWKHPDWWKH9DOOH\0LVVLRQ/HDJXH IRU\DUGVDQGUHFHSWLRQVIRU\DUGV«VFRUHGÀYHWRXFKGRZQV«IRXU ÀQDOVZLWKDWLPHRI \HDUOHWWHUZLQQHUDW6N\OLQH PERSONAL:%RUQLQ0DGHUD&DOLI«VRQRI7DQ\D3HUU\«KDVDQROGHU PERSONAL:%RUQLQ(XJHQH2UH«VRQRI .HYLQDQG/H*UHFLD3DUNHU« EURWKHU.HRQGUHDQGDQROGHUVLVWHU'DQD«PDMRUDW)UHVQR6WDWHLVNLQHVLRORJ\ KDVWZREURWKHUV.HYLRQDQG-D\GHQ«IDYRULWHDWKOHWHLV-DNHHP*UDQWEHFDXVH H[HUFLVHVFLHQFH KHLVDVPDOOHUZLGHUHFHLYHUZKRGLGQRWDFFHSWQRIRUDQVZHUDQGSXUVXHGKLV 1)/GUHDPV«XQGHFODUHGPDMRU 74 78 RYAN POPOLIZIO OL 6-7 | 311 | Sr. | 4th Year DAVID PATTERSON OL Fremont, Calif. (St. Francis HS/San Mateo College) 6-5 | 302 | Sr. | 5th Year Irvine, Calif. (Woodbridge HS) CAREER GAMES: 9 CAREER GAMES: 25 STARTS: 12 2016 (JUNIOR): 6DZDFWLRQLQQLQHRI JDPHVDVDÀUVW\HDU%XOOGRJ«DIWHU VWDUWLQJ)UHVQR6WDWHFDUHHUDWWDFNOHPRYHGWRJXDUGGXULQJWKHUHJXODUVHDVRQ 2016 (JUNIOR):0RYHGLQWRDVWDUWLQJUROHHDUQLQJVWDUWVLQDOOJDPHVDW «VWHDG\FRQWULEXWRURQWKHVSHFLDOWHDPV·XQLW«NLFNLQJJDPHVDZVWUDLJKW ULJKWWDFNOH«KHOSHGOHDGDUXVKLQJDWWDFNWKDWJDLQHG\DUGVRQWKHJURXQG ÀHOGJRDOVPDGHDQG]HUR3$7·VEORFNHGLQDWWHPSWVWKDWZHUHFRQQHFWHGRQ OHGE\VWDUWLQJUXQQLQJEDFN'RQWHO-DPHV·\DUGV«EORFNHGIRUDSDVVLQJ JDPHWKDWSURGXFHG\DUGVWKURXJKWKHDLUWKHVWDUWLQJOLQHXQLWOLPLWHG PRIOR TO FRESNO STATE: 6WDUWHG HYHU\ JDPH DW ULJKW WDFNOH DV D RSSRQHQWVWRVDFNVSHUJDPH VRSKRPRUHDIWHUZRUNLQJLQWRWKHURWDWLRQDVDIUHVKPDQ6DQ0DWHR·VUXVKLQJ DWWDFN DYHUDJHG \DUGV SHU JDPH LQ OHDGLQJ DOO SDUWLFLSDWLQJ 2015 (SOPHOMORE):1DPHGWRWKHIDOO0RXQWDLQ:HVW$OO$FDGHPLFWHDP &DOLIRUQLD&RPPXQLW\&ROOHJH$WKOHWLF$VVRFLDWLRQWHDPV6DQ0DWHRDYHUDJHG SOD\HGLQDOOJDPHVSULPDULO\RQWKH3$7DQGÀHOGJRDOXQLWV SRLQWVSHUJDPHVHYHQWKPRVWLQWKH$VVRFLDWLRQDQGLWVWRXFKGRZQV DFFRXQWHGIRURQWKHJURXQGZHUHWKHVHFRQGPRVWUXVKLQJ7'VVFRUHGZLOO 2014 (REDSHIRT FRESHMAN): $SSHDUHGLQRQHJDPHYV6RXWKHUQ8WDK KDYHWKUHH\HDUVWRSOD\KLVWZRUHPDLQLQJVHDVRQVRI HOLJLELOLW\ RQ6HSW HIGH SCHOOL: :DV LQYLWHG WR SDUWLFLSDWH LQ WKH WK DQQXDO &KDUOLH 2013 (FRESHMAN): 5HGVKLUWHG :HGHPH\HU $OO6WDU )RRWEDOO *DPH DIWHU JUDGXDWLQJ IURP 6W )UDQFLV +6 HIGH SCHOOL: 6HOHFWHGWRWKH&DO+L6SRUWV0HGLXP6FKRRO$OO6WDWH PHPEHURI WKH1RUWKWHDPWKDWZRQQDPHGVHFRQGWHDPDOORIIHQVHE\ WHDP QDPHG WR WKH $OO&,) 6RXWKHUQ 'LYLVLRQ WHDP OHG WHDP WR D WKH$OO'DLO\1HZV3UHS)RRWEDOO7HDPDVVHQLRU 6DQ-RVH0HUFXU\1HZV UHFRUG DQG VHFRQG SODFH ÀQLVK LQ WKH 3DFLÀF &RDVW /HDJXH DV D VHQLRU QDPHGDWHDPFDSWDLQDVVHQLRU KHOSHGWHDPUXVKIRU\DUGVSHUJDPHGXULQJKLVVHQLRUVHDVRQQDPHGWR PERSONAL: %RUQ LQ 1HZDUN &DOLIRUQLD « SDUHQWV DUH -LOO DQG 5REHUW WKH2UDQJH&RXQW\5HJLVWHU·V$OO&LW\7HDPÀUVWWHDP$OO3DFLÀF&RDVW 3RSROL]LR«KDVRQHROGHUVLEOLQJ/DXUHO«KLVXQFOHDQGDXQWDUHERWKIRUPHU /HDJXHVHOHFWLRQDVDMXQLRUZKHQWHDPZHQW VWXGHQWDWKOHWHVDW 6DQ 'LHJR 6WDWH ² (ULN 3ODQWHQEHUJ EDVHEDOO DQG -HQQLIHU PERSONAL: %RUQLQ-DFNVRQYLOOH1&VRQRI-XOLHDQG'DYLG3DWWHUVRQKDV 3ODQWHQEHUJ WHQQLV «PDMRUDW)UHVQR6WDWHLVÀQDQFH RQH\RXQJHUEURWKHU-DUUHWWPDMRUDW)UHVQR6WDWHLVEXVLQHVVDGPLQLVWUDWLRQ FRPSXWHULQIRUPDWLRQV\VWHPV 2 DeSHAWN POTTS DB 4 6-0 | 200 | Jr. | 4th Year Monrovia, Calif. (Monrovia HS) DEONTE PERRY RB 6-0 | 185 | RFr. | 2nd Year CAREER GAMES: 20 STARTS: 13 Canoga Park, Calif. (Canoga Park HS) 2016 (SOPHOMORE): 3OD\HGLQDOOJDPHVDQGPDGHVWDUWV«ZLWK WDFNOHVRQWKH\HDUZLOOVWDQGWLHGDVWKHWHDP·VUHWXUQLQJWDFNOHVOHDGHUIRUWKH VHDVRQZLWKWHDPPDWH-DPHV%DLOH\DIWHUERWKWLHGIRUWKHWKLUGPRVWVWRSV 2016 (FRESHMAN): 6XIIHUHGNQHHLQMXU\LQIDOOFDPS5HGVKLUWHG RQ WKH WHDP « RZQHG WKH VHFRQGPRVW SDVV EUHDNXSV ZLWK ÀYH LQFOXGLQJ D HIGH SCHOOL: )LUVWWHDP $OO9DOOH\ 0LVVLRQ /HDJXH RIIHQVH VHOHFWLRQ VLQJOHJDPHFDUHHUEHVWWZRLQWKHVHDVRQÀQDOHDJDLQVW6DQ-RVH6WDWHRQ1RY WHDPFDSWDLQSOD\HGFRUQHUEDFNDVZHOODVUXQQLQJEDFNUXVKHGIRU «VHWDVLQJOHJDPHFDUHHUKLJKRI WDFNOHVRQ2FWYV6DQ'LHJR6WDWH \DUGVRQFDUULHV \DUGVSHUJDPH DQGVFRUHGWRXFKGRZQVQDPHG «UHFRUGHGÀUVWFDUHHUWDFNOHIRUDORVVRQ6HSWDW7ROHGR«EORFNHGDSXQW 6R&DO3UHS/HJHQGV%R\V$WKOHWHRIWKH:HHNIROORZLQJDWRSSHUIRUPDQFH LQWKHVHFRQGTXDUWHURI DFRQWHVWDW81/9RQ2FW²ÀUVWFDUHHUEORFN« ZLWKD\DUGHIIRUWDQGÀYHWRXFKGRZQV VL[7'VWRWDO RQFDUULHVLQD UHFRYHUHGDIXPEOHG6DQ-RVH6WDWHSXQWUHWXUQRQ1RY²ÀUVWFDUHHUIXPEOH ZLQRYHU.HQQHG\RQ6HSWDOVRSRVWHG\DUGVUHFHLYLQJLQWKHZLQ UHFRYHU\ RZQHGWKUHHJDPHVZLWKSOXV\DUGVUXVKLQJDQGWDOOLHGDWOHDVW\DUGV 2015 (REDSHIRT FRESHMAN): 3OD\HGLQHLJKWJDPHVDQGPDGHWZRVWDUWV LQHLJKWRIJDPHVDVDVHQLRUUHFRUGHGDOOSXUSRVH\DUGVFKLSSLQJLQ ²WKHODVWWZRJDPHVRI WKHVHDVRQ«UHFRUGHGWDFNOHVDQGWZRSDVVEUHDNXSV RQWKHVHDVRQ«SRVWHGHLJKWWDFNOHVDQGRQHSDVVEUHDNXSLQWKHVHDVRQÀQDOH DJDLQVW&RORUDGR6WDWH 46 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES 2014 (FRESHMAN): 5HGVKLUWHG HIGH SCHOOL: 3OD\HGTXDUWHUEDFNFRUQHUEDFNDQGVDIHW\DW0RQURYLD+LJK 16 6FKRROXQGHUFRDFK5\DQ0DGGR[KHOSHGOHDGWKH:LOGFDWVWRDUHFRUGD 5LR+RQGR/HDJXHWLWOHDQGD&,)0LG9DOOH\'LYLVLRQVHPLÀQDODSSHDUDQFHLQ JARED RICE TE ZDVDÀUVWWHDP$OO5LR+RQGR/HDJXHVHOHFWLRQDWTXDUWHUEDFNDQGDW 6-5 | 228 | So. | 3rd Year VDIHW\LQWHDPRIIHQVLYH093DQG$OO&,)VHOHFWLRQDWVDIHW\DOVRDQ Modesto, Calif. (Central Catholic HS) $OO3DVDGHQD$UHDWHDPVHOHFWLRQDVDQDWKOHWHLQWRWDOHG\DUGVDQG CAREER GAMES: 11 WRXFKGRZQV RIIHQVLYHO\SOD\LQJ TXDUWHUEDFN DV D VHQLRU DQG KDG WDFNOHV DQGSDVVEUHDNXSVRQGHIHQVHDWVDIHW\DVDMXQLRUSOD\LQJLQ0RQURYLD·V GHIHQVHKHSRVWHGWDFNOHVDQGIRXULQWHUFHSWLRQVWZRRI ZKLFKKHUHWXUQHG 2016 (REDSHIRT FRESHMAN):3OD\HGLQRI JDPHV«ÀUVWWZRFDUHHU IRU WRXFKGRZQV VHOHFWHG WR WKH $OO5LR +RQGR /HDJXH WHDP DV D VDIHW\ LQ FDWFKHVZHUHERWKWRXFKGRZQV²WKHÀUVWFRPLQJRQ2FWDW1HYDGD DSDVV KHOSHGOHDG0RQURYLDWRDVHDVRQLQDQGWKH&,)0LG9DOOH\ RQWKDQGJRDOIURPWKH\DUGOLQHWKDWFRPSOHWHGDSOD\\DUGGULYH &KDPSLRQVKLSWKUHH\HDUYDUVLW\SOD\HUZKRDOVRKHOSHG0RQURYLDZLQWKH&,) WKHQH[WZDVDW8WDK6WDWHRQ2FW DSDVVRQQGDQGJRDOIURPWKH\DUG 0LG9DOOH\&KDPSLRQVKLSDVDVRSKRPRUHLQDOVRSOD\HGEDVNHWEDOOZKHUH OLQH WKDW FRPSOHWHG D SOD\\DUG GULYH « ÀQLVKHG WKH VHDVRQ ZLWK IRXU KHUHFHLYHGDOOOHDJXHDQGGHIHQVLYHWHDP093KRQRUVKLVMXQLRUVHDVRQ UHFHSWLRQVIRUVL[\DUGVDQGWZR7'V PERSONAL: %RUQ LQ 'XDUWH &DOLI VRQ RI *UHQHWWD 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 47 THE BULLDOGS: RETURNEES 29 89 JUSTIN RICE DB KYLE RIDDERING TE 6-2 | 210 | So. | 2nd Year 6-6 | 240 | Jr. | 4th Year Modesto, Calif. (Central Catholic HS) Fresno, Calif. (Clovis North HS) CAREER GAMES: 6 STARTS: 1 CAREER GAMES: 21 STARTS: 9 2017 (SOPHOMORE):6KLIWHGWRGHIHQVLYHEDFNGXULQJVSULQJIRRWEDOO 2016 (SOPHOMORE): 0DGHÀUVWQLQHFDUHHUVWDUWVDQGSOD\HGLQDOOJDPHV «FDXJKWVHYHQSDVVHVIRU\DUGVDVDVRSKRPRUH«SRVWHGUHFHSWLRQVLQIRXU 2016 (FRESHMAN):7KRXJKWWRPLVVWKHVHDVRQGXHWRDIRRWLQMXU\LQIDOO GLIIHUHQWJDPHVLQFOXGLQJDVLQJOHJDPHVHDVRQKLJKWKUHHFDWFKHV IRU\DUGV FDPSVDZDFWLRQDIWHUPLVVLQJÀUVWÀYHJDPHVRI WKHVHDVRQ«SOD\HGLQVL[ DW8WDK6WDWHRQ2FW«UHFRUGHGDVLQJOHJDPHVHDVRQKLJKUHFHLYLQJ\DUGV JDPHVDQGHDUQHGRQHVWDUWDWUXQQLQJEDFNDVDWUXHIUHVKPDQ«WRWDOHGQLQH RQ2FWDW1HYDGD FDUULHVIRU\DUGVDQGWZRUHFHSWLRQVIRU\DUGVRQWKH\HDU«VLQJOHJDPH VHDVRQKLJKIRUFDUULHVZDVWKUHHWZLFH«ORQJHVWUXQZDVÀYH\DUGVLQFROOHJLDWH 2015 (REDSHIRT FRESHMAN): 1DPHG WR WKH IDOO 0RXQWDLQ :HVW $OO GHEXWDW1HYDGDRQ2FW $FDGHPLFWHDPSOD\HGLQQLQHJDPHVRQWKHVHDVRQEHIRUHDVKRXOGHULQMXU\ LQWKHZHHNFRQWHVWDW+DZDLCLFDXVHGKLPWRPLVVWKHODVWWZRJDPHVRI WKH HIGH SCHOOL: 7ZRWLPH 2IIHQVLYH 093 RI WKH 9DOOH\ 2DN /HDJXH VHDVRQDOVRPLVVHGWKH6HSWFRQWHVWDW6DQ-RVH6WDWHGXHWRLOOQHVVVDZ 'LYLVLRQ,,,3OD\HURI WKH PERSONAL: %RUQLQ0RGHVWR&DOLI«VRQRI -HII DQG-XOHDQD5LFH«KLV PERSONAL: %RUQLQ)ROVRP&DOLIVRQRI &DWKHULQHDQG$OH[5LGGHULQJ ROGHU EURWKHU -DUHG LV D WKLUG\HDU VRSKRPRUH WLJKW HQG RQ WKH )UHVQR 6WDWH KDV RQH \RXQJHU VLVWHU IDYRULWH DWKOHWH LV &DOYLQ -RKQVRQ FRQVWUXFWLRQ IRRWEDOOWHDPDOVRKDVD\RXQJHUEURWKHU-DFN«KLVIDWKHU-HII SOD\HGIRRWEDOODW PDQDJHPHQWPDMRUDW)UHVQR6WDWH &DO«JUDGXDWHGIURPWKHVDPHKLJKVFKRRODV)UHVQR6WDWH'LUHFWRURI $WKOHWLFV -LP%DUWNR«KDVQRWGHFODUHGDPDMRUDW)UHVQR6WDWH KYLE RIDDERING’S CAREER STATS RECEIVING G Rec Yds TD Lg Rec/G Avg/C Avg/G 2015 9 2 7 0 4 0.2 3.5 0.8 JUSTIN RICE’S CAREER STATS 2016 12 7 33 0 12 0.2 3.5 2.8 RUSHING G Att. Yds TD Lg Avg/C Avg/G TOTAL 21 9 40 0 12 0.4 4.4 1.9 2016 6 9 11 0 5 1.2 1.8 RECEIVING G Rec Yds TD Lg Rec/G Avg/C Avg/G 2016 6 2 15 0 7 0.3 7.5 2.5 KYLE RIDDERING’S GAME-BY-GAME Receiving 2016 - So. Rec. Yds. TD Long 48 at Nebraska 0 0 0 0 Sacramento State 0 0 0 0 at Toledo 0 0 0 0 TANNER RICE ILB Tulsa 0 0 0 0 5-11 | 230 | RFr. | 2nd Year at UNLV 0 0 0 0 Clovis, Calif. (Clovis HS) at Nevada 1 12 0 12 San Diego State 1 2 0 2 at Utah State 3 11 0 5 Air Force 0 0 0 0 2016 (FRESHMAN):5HGVKLUWHG at Colorado State 2 8 0 6 Hawai’i 0 0 0 0 HIGH SCHOOL: $OO9DOOH\DQGDOOFRQIHUHQFHVHOHFWLRQKHOSHGOHDG&ORYLV San Jose State 0 0 0 0 TOTALS 7 33 0 12 +LJKWRDFRQIHUHQFHFKDPSLRQVKLSSRVWHGWDFNOHVWDFNOHVIRUORVVÀYH VDFNVDQGRQHLQWHUFHSWLRQGXULQJVHQLRUFDPSDLJQUHJLVWHUHGWDFNOHV Receiving WDFNOHVIRUORVVÀYHVDFNVDQGRQHLQWHUFHSWLRQDVDMXQLRU 2015 - RFr. Rec. Yds. TD Long Utah State 1 4 0 4 PERSONAL: 6RQRI 0HOLVVDDQG6KDZQ5LFHKDVRQHVLVWHU7D\ORULVDSUH at Hawai`i 1 3 0 3 EXVLQHVVPDMRUDW)UHVQR6WDWH TOTALS 2 7 0 4 KYLE RIDDERING’S SINGLE-GAME HIGHS Receptions: 3 - at Utah State, 2016 Receiving Yards: 12 - at Nevada, 2016 48 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES 2014 (SOPHOMORE): 3OD\HGLQDOOJDPHVXVHGDVDZLGHUHFHLYHUDQGNLFN UHWXUQHUPDGHRQHVWDUWWRRSHQWKHVHDVRQDW1R86&ÀQLVKHGWKH\HDU 17 ZLWKHLJKWFDWFKHVIRU\DUGVDQGRQHWRXFKGRZQKLVWRXFKGRZQUHFHSWLRQ ZHQWIRU\DUGVDJDLQVW6RXWKHUQ8WDKDQGZDVWKHORQJHVWSDVVLQJSOD\RI WKH CHRISTIAN ROSSI QB VHDVRQUHWXUQHGNLFNRIIVIRUDQDYHUDJHRI \DUGVZLWKDORQJRI ERWK 6-1 | 208 | Sr. | 5th Year WKHKLJKHVWUHWXUQDQGDYHUDJHRI DQ\SOD\HURQWKHWHDP Fresno, Calif. (Clovis North HS/Fresno City College) 2013 (FRESHMAN): 3OD\HG LQ JDPHV DV D WUXH IUHVKPDQ UHWXUQHG NLFNRIIVIRUDQDYHUDJHRI \DUGVSHUUHWXUQZLWKDORQJUHWXUQRI \DUGVRQ 1RYYV1HZ0H[LFRFDXJKWWZRSDVVHVRQWKHVHDVRQIRU\DUGVKDG 2016 (JUNIOR): 'LGQRWVHHDQ\JDPHDFWLRQ DQHLJKW\DUGFDWFKYV81/92FWDQGDQ\DUGUHFHSWLRQYV1HZ0H[LFR PRIOR TO FRESNO STATE: $UULYHGDW)UHVQR&LW\&ROOHJHLQWKHVXPPHU RQ1RYDOVRUHFRUGHGRQHWDFNOHRQVSHFLDOWHDPVYV%RLVH6WDWH6HSW RI WR SOD\ IRRWEDOO DIWHU GHFLGLQJ WR OHDYH &DO 6WDWH )XOOHUWRQ ZKHUH KH HIGH SCHOOL: +DG UHFHSWLRQV IRU \DUGV DQG WRXFKGRZQV DV D KDG UHFHLYHG D EDVHEDOO VFKRODUVKLS FRPLQJ RXW RI &ORYLV 1RUWK +LJK DV D VHQLRUKDGIRXUJDPHVFDWFKLQJWZRRUPRUHWRXFKGRZQSDVVHVLQFOXGLQJIRXU VRSKRPRUHLQKHFRPSOHWHGRI SHUFHQW SDVVHVIRUD&&&$$ 7'VDJDLQVW6DQWD%DUEDUDZKHQKHÀQLVKHGZLWKQLQHFDWFKHVIRU\DUGVKDG QLQWKEHVW\DUGVDQGVHYHQWKEHVWWRXFKGRZQVDJDLQVWLQWHUFHSWLRQV WKUHH\DUGUHFHLYLQJJDPHVGXULQJVHQLRUVHDVRQSRVWHGWDFNOHVDQG DV D IUHVKPDQ KH FRPSOHWHG RI SDVVHV IRU \DUGVDQG WDFNOHVIRUDORVVZLWKWZRVDFNVLQDOVRKDGWZRLQWHUFHSWLRQVSOD\LQJLQWKH WRXFKGRZQVZKLOHVKDULQJWLPHZLWK1RODQ6RUHQVHQ+HDOVRKDGWKUHHUXVKLQJ VHFRQGDU\DYHUDJHG\DUGVRQHLJKWNLFNRII UHWXUQVDQG\DUGVRQIRXU WRXFKGRZQV SXQWUHWXUQVDVDVHQLRUJXLGHG&DWKHGUDOWRDRYHUDOOUHFRUGDQGWKH&,) 1RUWKHUQ'LYLVLRQSOD\RIIVLQ HIGH SCHOOL: $ JUDGXDWH RI &ORYLV 1RUWK +LJK 6FKRRO LQ &ORYLV &DOLIZDVDWZRVSRUWVWDUIRUWKH%URQFRVVWDUULQJRQWKHIRRWEDOODQGEDVHEDOO PERSONAL: 6RQRI WKHODWH'RQQD&RYLQJWRQDQG'DUUHFR6FRWWKDVKDV ÀHOGZDVQDPHGWKH)UHVQR%HH3OD\HURI WKH \DUGV WRXFKGRZQV FDUHHUSDVVLQJ\DUGV DQGWRXFKGRZQV SCORING G TD Rush Pass Retn PAT 2PAT FG Total Avg/G GXULQJKLVVHQLRU\HDUKHFRPSOHWHGRISDVVHV IRU\DUGV 2013 10 0 0 0 0 0 0 0 0 0.0 DQGWRXFKGRZQVDGGLWLRQDODZDUGVRQWKHIRRWEDOOÀHOGLQFOXGHWZRWLPH 2014 14 1 0 1 0 0 0 0 6 0.4 2015 11 3 0 3 0 0 0 0 18 1.6 WHDP093 WZRWLPHÀUVWWHDP7UL5LYHU$WKOHWLF&RQIHUHQFH TOTAL 35 4 0 4 0 0 0 0 24 0.7 WZRWLPHÀUVWWHDPDOO9DOOH\VHOHFWLRQ DQGÀUVWWHDPDOOVWDWH PUNT RETURNS G No. Yds TD Lg Avg/R Avg/G RQWKHEDVHEDOOÀHOGSOD\HGWKUHHVHDVRQV RI VKRUWVWRSRQWKH 2013 10 0 0 0 0 0.0 0.0 YDUVLW\FOXEZDVQDPHGWRWKH)UHVQR%HHÀUVWWHDPWZLFH 2014 14 1 14 0 0 14.0 1.0 2015 11 5 32 0 21 6.4 2.9 DQGOHGWKH%URQFRVWRWKH&,)&HQWUDO6HFWLRQ'LYLVLRQ,FKDPSLRQVKLSLQ TOTAL 35 6 46 0 21 7.7 1.3 DV&ORYLV1RUWKÀQLVKHGWKHVHDVRQZLWKDUHFRUGDVWKHOHDGRII EDWWHUKLW ZLWKIRXUKRPHUXQVDQGDFRPELQHGUXQVDQG5%,VLQDGGLWLRQZDVD KICK RETURNS G No. Yds TD Lg Avg/R Avg/G 2013 10 20 392 0 31 19.6 39.2 WZRWLPH ÀUVWWHDPDOO7UL5LYHU$WKOHWLF&RQIHUHQFHDQGWZRWLPH 2014 14 16 329 0 37 20.6 23.5 ÀUVWWHDPDOO9DOOH\VHOHFWLRQDVDMXQLRUOHG&ORYLV1RUWKWRDUHFRUG 2015 11 26 579 0 66 22.3 52.6 TOTAL 35 62 1300 0 66 21.0 37.1 DQGKHWRSSHGWKH%URQFRVLQVHYHUDORIIHQVLYHFDWHJRULHVEDWWLQJZLWKD VOXJJLQJSHUFHQWDJHDQGDRQEDVHSHUFHQWDJHIROORZLQJKLVVHQLRUVHDVRQ ALL PURPOSE G Rush Rec PR KR IR Total Avg/G 2013 10 0 19 0 392 0 411 41.1 ZDVQDPHGWKH&ORYLV1RUWK$WKOHWHRI WKH HIGH SCHOOL: )LUVWWHDP $OO7ULQLW\ /HDJXH VHOHFWLRQ ÀUVWWHDP /RQJ CAREER GAMES: 21 STARTS: 17 %HDFK3UHVV7HOHJUDP'UHDP7HDP 2016 (SOPHOMORE): 6WDUWHGDOOJDPHVDWULJKWJXDUGXSSLQJFRQVHFXWLYH PERSONAL: 6RQRI /LQGDDQG%ULDQ6PLWKKDVRQHVLVWHU0DGLVRQIDWKHU VWDUWV WR VWUDLJKW GDWLQJ EDFN WR UHGVKLUW IUHVKPDQ VHDVRQ ² WKLUGPRVW SOD\HGIRRWEDOODW/RQJ%HDFK6WDWHSUHEXVLQHVVPDMRUDW)UHVQR6WDWH FRQVHFXWLYHVWDUWVKHDGLQJLQWRWKHVHDVRQ«KHOSHGOHDGDUXVKLQJDWWDFN WKDWJDLQHG\DUGVRQWKHJURXQGOHGE\VWDUWLQJUXQQLQJEDFN'RQWHO-DPHV· 22 \DUGV«EORFNHGIRUDSDVVLQJJDPHWKDWSURGXFHG\DUGVWKURXJKWKH DLUWKHVWDUWLQJOLQHXQLWOLPLWHGRSSRQHQWVWRVDFNVSHUJDPH TRENT SOECHTING ILB 2015 (REDSHIRT FRESHMAN): 3OD\HGLQQLQHJDPHVDQGPDGHÀYHVWDUWV 6-3 | 220 | Jr. | 4th Year IRUWKH%XOOGRJVDWULJKWJXDUGLQKLVÀYHVWDUWVKHKHOSHGWKHRIIHQVHDYHUDJH Katy, Texas (Cinco Ranch HS/Blinn College) \DUGVRI RIIHQVHRI WKDWFRPLQJRQWKHJURXQGDQGSRLQWVSHU JDPH CAREER GAMES: 12 2016 (SOPHOMORE): 3OD\HGLQDOOJDPHVLQÀUVWVHDVRQDW)UHVQR6WDWH« 2014 (FRESHMAN)::DONHGRQWRWKHWHDPDQGUHGVKLUWHGZDVJUDQWHGD VFKRODUVKLSDIWHUVSULQJSUDFWLFHVLQ UHFRUGHGWDFNOHV VROR DQGWDFNOHVIRUDORVV«EUHDNRXWJDPHRFFXUUHG RQ2FWYV$LU)RUFHZLWKDVLQJOHJDPHVHDVRQKLJKWDFNOHVDORQJZLWKD HIGH SCHOOL: 7ZRZD\ SOD\HU RQ WKH RIIHQVLYH DQG GHIHQVLYH OLQHV IRU KDOIWDFNOHIRUDORVV«LQ%XOOGRJGHEXWSRVWHGVHYHQWDFNOHVDQGWDFNOHVIRU FRDFK0LNH&ODUNDW(LVHQKRZHU+LJK6FKRROKHOSHGOHDGWHDPWR&LWUXV%HOW DORVVDW1HEUDVNDRQ6HSW«KDGDVHDVRQKLJKIRXUVRORWDFNOHVDJDLQVW6DQ /HDJXHFKDPSLRQVKLSVGXULQJKLVMXQLRUDQGVHQLRUVHDVRQVRI DQG -RVH6WDWHRQ1RY«WDOOLHGPXOWLSOHWDFNOHVLQVHYHQRI JDPHV QDPHG$OO6WDWHDVDMXQLRU$OO&,)DVDVHQLRUDQG$OO&LWUXV%HOW/HDJXHDV PRIOR TO FRESNO STATE: :DV D VHFRQGWHDP $OO6RXWKZHVW -XQLRU ERWKDMXQLRUDQGDVHQLRUSOD\HGDOODFURVVWKHRIIHQVLYHOLQHLQSUHSFDUHHUDW )RRWEDOO&RQIHUHQFHVHOHFWLRQOHGWKHWHDPLQWDFNOHVZLWKRQWKH\HDUKLV FHQWHUJXDUGDQGWDFNOHUHJLVWHUHGVDFNVDVERWKDMXQLRUDQGDVHQLRURXW WDFNOHVIRUDORVVDOVROHGWKHWHDPDQGUDQNHGLQDWLHIRUWKHIRXUWKPRVW RI WKHQRVHJXDUGSRVLWLRQRQGHIHQVHZDVDIRXU\HDUKRQRUUROOVWXGHQWLQ KLJKVFKRRO LQWKHFRQIHUHQFHGHVSLWHWKHIDFWWKDWKHSOD\HGLQWZRIHZHUJDPHVWKDQDQ\ SOD\HUUDQNHGLQWKHWRSÀYHUHFRUGHGDVHDVRQKLJKWDFNOHVLQFOXGLQJWZR PERSONAL: %RUQ LQ /RQJ %HDFK &DOLI VRQ RI 0HOL]]D DQG 0LFKDHO 6W IRUDORVVLQDZLQRYHU1RUWKHDVWHUQ2NODKRPD$ 0&ROOHJHRQ6HSW $QGUHZKDVRQHROGHUEURWKHU0DWDHVHKREELHVLQFOXGHSOD\LQJIRRWEDOO SRVWHGVHYHQWDFNOHVWZRIRUDORVVDQGRQHIRUFHGIXPEOHLQDZLQRYHU PXVLFHQJLQHHULQJYLGHRJDPHVDQGWHFKSODQVWRVWXG\FRPSXWHUVFLHQFHDW $UNDQVDV%DSWLVW&ROOHJHKHZLOOKDYHWKUHH\HDUVRI HOLJLELOLW\UHPDLQLQJWR )UHVQR6WDWHPDMRUDW)UHVQR6WDWHLVHFRQRPLFV FRPSOHWHZLWKWKH%XOOGRJV 50 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES ROBERT STANLEY’S GAME-BY-GAME (CONT.) 32 Tackles 2015 - Sophomore UA A Total TFL-Yds Sacks-Yds FF FR QBH ROBERT STANLEY ILB Abilene Christian 1 0 1 0.0-0 0.0-0 0 0 0 6-3 | 245 | Sr. | 5th Year at Ole Miss 0 0 0 0.0-0 0.0-0 0 0 0 at San Jose State 0 1 1 0.0-0 0.0-0 0 0 0 Las Vegas, Nev. (Bishop Gorman HS) at San Diego State 2 2 4 0.0-0 0.0-0 0 0 0 CAREER GAMES: 19 STARTS: 10 Utah State 2 0 2 0.0-0 0.0-0 0 0 0 at Air Force 1 1 2 0.0-0 0.0-0 0 0 0 2016 (JUNIOR): 6WDUWHGQLQHJDPHVDQGSOD\HGLQ²PLVVHGWZRJDPHVWRD Nevada 0 1 1 0.0-0 0.0-0 0 0 0 at Hawai`i 5 2 7 0.0-0 0.0-0 0 0 0 NQHHLQMXU\«WDOOLHGWDFNOHVRQWKH\HDUWKHVL[WKPRVWRQWKHWHDPDVZHOODV at BYU 0 2 2 0.0-0 0.0-0 0 0 0 ÀUVWFDUHHUWDFNOHVIRUDORVV «KDGWZRJDPHVZLWKGRXEOHGLJLWWDFNOHV²D TOTALS 11 9 20 0.0-0 0.0-0 0 0 0 WKHQFDUHHUKLJKWDFNOHVYV$LU)RUFHRQ2FWIROORZHGE\DFDUHHUKLJK WDFNOHVLQWKHVHDVRQÀQDOHYV6DQ-RVH6WDWHRQ1RY«SRVWHGÀUVWFDUHHU WDFNOHIRUDORVV DQGVHYHQWDFNOHVRQ6HSWYV7XOVD«WDOOLHGDFDUHHU KLJKWDFNOHVIRUDORVVDJDLQVW$LU)RUFHRQ2FW«EORFNHGDSXQWLQWKH 88 VHDVRQRSHQHUDW1HEUDVNDRQ6HSWWKDWOHGWRVHYHQSRLQWVIRUWKH%XOOGRJV RQWKHHQVXLQJSRVVHVVLRQ²ÀUVWFDUHHUSXQWEORFNDQGÀUVW%XOOGRJSXQWEORFN DAVID TANGIPA TE VLQFHRQ1RYYV6DQ-RVH6WDWH²DOVRFUHGLWHGZLWKD\DUGSXQWUHWXUQ 6-5 | 240 | Jr. | 4th Year RQWKHSOD\ Sacramento, Calif. (Foothill HS) 2015 (SOPHOMORE): Played in nine games and made one start at inside CAREER GAMES: 17 STARTS: 1 OLQHEDFNHULQZHHNDW%<8ZDVLQMXUHGLQWKH%<8JDPHZKLFKFDXVHG KLPWRPLVVWKHUHJXODUVHDVRQÀQDOHDJDLQVW&RORUDGR6WDWHKDGWDFNOHVRQ 2016 (SOPHOMORE): 3OD\HG LQ ÀUVW JDPHV EHIRUH PLVVLQJ ÀQDO WZR WR WKHVHDVRQDQGRQHSDVVEUHDNXSUHFRUGHGDVHDVRQKLJKVHYHQWDFNOHVLQWKH LQMXU\«XVHGLQSURWHFWLRQFRYHUDJH·VRQWKHVSHFLDOWHDPVXQLW«GLGQRWUHFRUG +DZDLCLJDPHZKHQÀYHRI WKRVHVHYHQVWRSVZHUHVRORHIIRUWV DQ\VWDWLVWLFV 2014 (REDSHIRT FRESHMAN): 'LGQRWVHHJDPHDFWLRQ 2015 (REDSHIRT FRESHMAN): 1DPHG WR WKH IDOO 0RXQWDLQ :HVW $OO $FDGHPLFWHDPSOD\HGLQVHYHQJDPHVDQGPDGHRQHVWDUWDWWLJKWHQGLQWKH 2013 (FRESHMAN): 5HGVKLUWHG 6DQ-RVH6WDWHFRQIHUHQFH²WKHOHDJXHRSHQHUIRUWKH%XOOGRJVDOVRHDUQHG SOD\LQJWLPHRQVSHFLDOWHDPVZLWKWKHNLFNRII UHWXUQVTXDG HIGH SCHOOL: +DLOV IURP QDWLRQDO SRZHUKRXVH %LVKRS *RUPDQ +LJK 6FKRROLQ/DV9HJDVKHOSHGOHDGWKH*DHOVWRWKHLUIRXUWKFRQVHFXWLYHVWDWH 2014 (FRESHMAN): :DONHGRQWRWKHWHDPDQGUHGVKLUWHG FKDPSLRQVKLSLQSRVWHGWDFNOHVVDFNVKDGRQHLQWHUFHSWLRQWZR IRUFHGIXPEOHVDQGRQHIXPEOHUHFRYHU\DVDVHQLRUDOVRSOD\HGWLJKWHQGZKHUH HIGH SCHOOL: 1DPHGÀUVWWHDP$OO3LRQHHU9DOOH\/HDJXHDQGWKHWHDP KHFDXJKWVHYHQSDVVHVIRU\DUGVDQGWZRWRXFKGRZQVSRVWHGHLJKWWDFNOHV 093 IROORZLQJ VHQLRU VHDVRQ DW )RRWKLOO +LJK 6FKRRO SDUWLFLSDWHG LQ WKH DJDLQVW2XU/DG\RI *RRG&RQVHO+LJK6FKRROLQ0DU\ODQGDQGVHYHQDJDLQVW 6DFUDPHQWR2SWLPXV$OO6WDUJDPHZDVLQWRSSHUFHQWLQ*3$IRUKLVVHQLRU %HUJHQ&DWKROLFRI 1HZ-HUVH\ERWKSUHSWHDPVWKDWHDFKÀQLVKHGWKHVHDVRQ FODVVDQGDOVRWKH$6%9LFH3UHVLGHQWDQG3UHVLGHQWRI6FKRRO6LWH&RXQFLO QDWLRQDOO\UDQNHGDOVRSOD\HGEDVNHWEDOODW%LVKRS*RUPDQ PERSONAL: %RUQLQ6DFUDPHQWR&DOLIVRQRI /DUU\DQG7XSRX(QWZLVWOH PERSONAL: %RUQLQ/RV$QJHOHV&DOLIVRQRI -XOLDQG5RQ6WDQOH\IDWKHU KDVWKUHHEURWKHUV5REHUW-RQDWKDQDQG-DFNDQGRQHVLVWHU%ULWWQH\PDMRUDW LVDSLORWKDVWZRROGHUEURWKHUV5RQQLHDQG-DURQDQGWKUHHVLVWHUV5D\FKHO )UHVQR6WDWHLVSROLWLFDOVFLHQFH \RXQJHU 'DQLHOOH ROGHU DQG/D7RQ\D ROGHU KLVROGHUEURWKHU5RQQLHZDV D FRQVHQVXV $OO$PHULFD RIIHQVLYH OLQHPDQ DW 1RWUH 'DPH DQG WKH 1R RYHUDOOSLFNRI WKH1)/'UDIWE\WKH%DOWLPRUH5DYHQV5REHUWLVWKH ÀUVW/DV9HJDVSURVSHFWWRFRPHWR)UHVQR6WDWHVLQFHOLQHEDFNHU %HQ -DFREV 30 6LOYHUDGR+6 ZKRZDVDWZRWLPH$OO:$&VHOHFWLRQIRUWKH%XOOGRJVDQGKDG WDFNOHVLQKLVFDUHHUWKDWHQGHGLQEXVLQHVVPDQDJHPHQWPDMRUDW MESSIAH TYLER SAM )UHVQR6WDWH 5-8 | 228 | RSo. | 3rd Year ROBERT STANLEY’S CAREER STATS Murrieta, Calif. (Vista Murrieta HS/Univ. of La Verne) TACKLES G UA A Total TFL Yds PD FF FR Blkd QBH 2015 9 11 9 20 0.0 0 1 0 0 0 0 2016 10 29 25 54 3.0 4 0 0 0 1 0 TOTAL 19 40 34 74 3.0 4 1 0 0 1 0 2016 (SOPHOMORE):'LGQRWVHHDQ\JDPHDFWLRQ ROBERT STANLEY’S GAME-BY-GAME PRIOR TO FRESNO STATE: $WWHQGHG WKH 8QLYHUVLW\ RI /D 9HUQH DV D IUHVKPDQLQSOD\HGLQHLJKWJDPHVUHFRUGHGWDFNOHVDQGDKDOI VDFN Tackles «UHJLVWHUHGDVLQJOHJDPHKLJKWKUHHWDFNOHVLQWKUHHUHVSHFWLYHJDPHV 2016 - Junior UA A Total TFL-Yds INT-Yds PBU FF FR at Nebraska 3 1 4 0.0-0 0-0 0 0 0 HIGH SCHOOL: (DUQHG )LUVW7HDP $OO&,) DQG DOOOHDJXH KRQRUV DV D Sacramento State 0 0 0 0.0-0 0-0 0 0 0 GXULQJVHQLRUVHDVRQUHJLVWHUHGWDFNOHVTXDUWHUEDFNKXUULHVDQGRQHSDVV at Toledo 6 0 6 0.0-0 0-0 0 0 0 GHÁHFWLRQOHGGHIHQVHLQWDFNOHVZLWKLQ&,)ÀQDO Tulsa 6 1 7 1.0-1 0-0 0 0 0 at UNLV 0 1 1 0.0-0 0-0 0 0 0 PERSONAL:6RQRI /D7RQ\D0LOOHUDQG'LRQH7\OHUKDVWZRVLVWHUV$VKOH\ at Utah State 1 5 6 0.0-0 0-0 0 0 0 Air Force 5 6 11 1.5-2 0-0 0 0 0 DQG(PPDPDMRUDW)UHVQR6WDWHLVFULPLQRORJ\IRUHQVLFEHKDYLRUDOVFLHQFH at Colorado State 3 1 4 0.0-0 0-0 0 0 0 Hawai’i 1 2 3 0.0-0 0-0 0 0 0 San Jose State 4 8 12 0.5-1 0-0 0 0 0 TOTALS 29 25 54 3.0-4 0-0 0 0 0 ROBERT STANLEY’S SINGLE-GAME HIGHS Solo Tackles: 6 - 2x Total Tackles: 12- vs. San Jose State, 2016 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 51 THE BULLDOGS: RETURNEES 44 5 STEPHEN VAN HOOK DE CHASON VIRGIL QB 6-2 | 245 | Sr. | 5th Year 6-1 | 192 | So. | 3rd Year Perris, Calif. (Citrus Hill HS) Mesquite, Texas (West Mesquite HS) CAREER GAMES: 11 CAREER GAMES: 13 STARTS: 11 2016 (JUNIOR): 3OD\HGLQVHYHQJDPHVLQFOXGLQJÀQDOÀYHRI WKHVHDVRQ«GLG 2016 (REDSHIRT FRESHMAN): 6WDUWHG JDPHV « SDVVHG IRU QRWUHFRUGDQ\VWDWLVWLFV \DUGVDQGWRXFKGRZQVFRPSOHWLQJRISDVVHVZLWKLQWHUFHSWLRQV «LVWKHWKLUGIUHVKPDQTXDUWHUEDFNLQ)UHVQR6WDWHKLVWRU\WRWKURZIRUPRUH 2015 (SOPHOMORE): $SSHDUHGLQIRXUJDPHVWKUHHRI ZKLFKZHUH0RXQWDLQ WKDQ\DUGVLQDVLQJOHVHDVRQ²3DXO3LQHJDU DQG.HYLQ6ZHHQH\ :HVWFRQWHVWVDJDLQVW8WDK6WDWH1HYDGDDQGDW+DZDLCL«UHFRUGHGRQHWDFNOH ²DQGZDVRQHRIQLQHIUHVKPDQLQ)%6IRRWEDOOWRWKURZIRUPRUHWKDQ RQWKH\HDULQWKH8WDK6WDWHJDPH \DUGVLQ«UDQNHGVHYHQWKLQSDVVLQJ\DUGVSHUJDPHDPRQJDOO)%6 2014 (REDSHIRT FRESHMAN): 'LGQRWVHHJDPHDFWLRQ IUHVKPHQZLWK«UDQNHGIRXUWKLQWKH0RXQWDLQ:HVWLQSDVVLQJ\DUGVSHU JDPH DQGVL[WKLQWKHOHDJXHLQWRWDORIIHQVHSHUJDPH «DJDLQVW 2013 (FRESHMAN): 5HGVKLUWHG $LU)RUFHRQ2FWWKUHZIRUDFDUHHUKLJK\DUGVDQGDFDUHHUKLJKWKUHH WRXFKGRZQVEXWDOVRWKUHZIRUDFDUHHUKLJKIRXULQWHUFHSWLRQV«VHWDFDUHHU HIGH SCHOOL: +HOSHG OHDG &LWUXV +LOO WR DQ XQGHIHDWHG VHDVRQ DV KLJKIRUFRPSOHWLRQV LQDVLQJOHJDPHDW8WDK6WDWHRQ2FWJRLQJRI DVHQLRUDQGWKH&,)6RXWKHUQ6HFWLRQ&KDPSLRQVKLS SDUWRI GHIHQVHWKDW SHUFHQW «UHFRUGHGWKHVHFRQGDQGWKLUGORQJHVWSDVVFRPSOHWLRQVRI UHFRUGHGWZRVKXWRXWVLQWKH&,)6RXWKHUQ6HFWLRQSOD\RIIVSRVWHGWDFNOHV WKHVHDVRQLQWKH0RXQWDLQ:HVWZLWKDQ\DUGFRQQHFWLRQWR-DPLUH-RUGDQRQ KDGVDFNVWDFNOHVIRUDORVVIRUFHGWKUHHIXPEOHVDQGUHFRYHUHGDSDLU 6HSWYV7ROHGRDQGDQ\DUGFRPSOHWLRQWR$DURQ3HFNRQ2FWDW81/9 RI IXPEOHVDVDVHQLRUZDVVHOHFWHGWRSOD\LQWKH&DO6WDWH%RZO$OO6WDU ²WKH\DUGFRPSOHWLRQPDGH9LUJLOWKHQLQWK%XOOGRJTXDUWHUEDFNLQ)UHVQR JDPHDQGWKHWKDQQXDO63257)RXQGDWLRQ,QODQG(PSLUH$OO6WDU&ODVVLF 6WDWHKLVWRU\WRFRPSOHWHDSDVVRIPRUHWKDQ\DUGVMRLQLQJ'HUHN&DUU LQDVDMXQLRUKHOHG&LWUXV+LOOWRWKHVHPLÀQDOVRI WKHSOD\RIIVZLWKD 3DXO3LQHJDU.HYLQ6ZHHQH\5\DQ&ROEXUQ0LFKDHO5RVV0DUN%DUVRWWL'DYH UHFRUGUHFRUGHGVDFNVLQ 7HOIRUGDQG-HII7HGIRUG«KLV\DUG7'SDVVWR-RUGDQWLHGIRUWKHQG ORQJHVWFRPSOHWLRQLQWKH)%6LQ«FRPSOHWHGVL[SDVVHVIRU\DUGVRU PERSONAL:%RUQLQ5LYHUVLGH&DOLIVRQRI &KHU\ODQG6WHSKHQ9DQ+RRN PRUHIRXURIZKLFKZHUHWRXFKGRZQV«ORJJHGWKHPRVWRIIHQVLYHSOD\VUXQLQ PRWKHULVDQXUVHDQGIDWKHUZRUNVDVDSUREDWLRQRIÀFHUKDVRQH\RXQJHU DVLQJOHJDPHE\DQLQGLYLGXDOLQWKH0RXQWDLQ:HVWZLWKSDVVDWWHPSWVDQG EURWKHU-D\VRQFULPLQRORJ\ODZHQIRUFHPHQWPDMRU UXVKLQJDWWHPSWVYV7XOVDRQ6HSW 2015 (FRESHMAN): *UDQWHGPHGLFDOUHGVKLUW«SOD\HGLQÀUVWWKUHHJDPHV EHIRUHVXIIHULQJDVHDVRQHQGLQJVKRXOGHULQMXU\DJDLQVW1R8WDKLQWKH WKLUGJDPHRIWKHVHDVRQHDUQHGÀUVWFDUHHUVWDUWDJDLQVWWKHQDWLRQDOO\UDQNHG 8WHVEHFRPLQJWKHÀUVWWUXHIUHVKPDQDW)UHVQR6WDWHVLQFHWRPDNHDVWDUW ZDVIRUSDVVLQJRQWKH\HDUIRU\DUGVZLWKWKUHHWRXFKGRZQVDQG WKUHHLQWHUFHSWLRQVLQDFWLRQDJDLQVW1R2OH0LVVRQWKHURDGKHHQWHUHG WKHJDPHLQWKHVHFRQGTXDUWHUDQGÀQLVKHGWKDWTXDUWHURISDVVLQJIRU \DUGVDQGRQHWRXFKGRZQÀQLVKHGWKH0LVVLVVLSSLJDPHRISDVVLQJIRU \DUGVDQGWZR7'VZLWKWZRSLFNVZDVIRUSDVVLQJIRU\DUGVLQKLV VWDUWDJDLQVW1R8WDKEHIRUHOHDYLQJWKHJDPHZLWKWKHLQMXU\WKUHZKLVÀUVW FDUHHUWRXFKGRZQSDVVLQWKHVHDVRQRSHQHUDJDLQVW$ELOHQH&KULVWLDQDJDPH LQZKLFKKHEHFDPHWKHÀUVWWUXHIUHVKPDQVLQFH-HII*UDG\LQWRWKURZD WRXFKGRZQSDVVJUDGXDWHGHDUO\IURPKLJKVFKRRODQGHQUROOHGDW)UHVQR6WDWH LQ-DQXDU\IRUWKHVSULQJVHPHVWHU HIGH SCHOOL: $UDUHIRXU\HDUVWDUWLQJYDUVLW\TXDUWHUEDFNLQKLJKVFKRRO WKUHZIRURYHU\DUGVDQGUXVKHGIRURYHULQKLVSUHSFDUHHUQDPHG WKH'LVWULFW$FR0RVW9DOXDEOH3OD\HUDVDVHQLRUE\WKH0HVTXLWH1HZV FRPSOHWHGRI SDVVHVIRU\DUGVDQGWRXFKGRZQVDVD VHQLRUZKLOHOHDGLQJ:HVW0HVTXLWHWRDUHFRUGDQGLQWRWKH&ODVV$'LYLVLRQ ,ELGLVWULFWSOD\RIIVDOVRUXVKHGIRU\DUGVDQGHLJKWWRXFKGRZQVDVDVHQLRU WKUHZIRU\DUGVDQGVL[WRXFKGRZQVLQKLVÀQDOKLJKVFKRROJDPHDJDLQVW 0F.LQQH\1RUWK+LJK6FKRRODWWKH&RWWRQ%RZOLQWKH&ODVV$'LYLVLRQ, DUHDURXQGSOD\RIIVWKDWZDVRQHRIWKUHH\DUGSDVVLQJJDPHVDVDVHQLRU WKUHZWKUHHRUPRUHWRXFKGRZQSDVVHVLQRIUHJXODUVHDVRQJDPHV PERSONAL: 6RQRI6WHYHDQG3DWULFH9LUJLOKDVRQHEURWKHU&KD]]DQG WZRVLVWHUV&KDVHDDQG&KDVDWH\EURWKHULVWKHZLGHUHFHLYHUVFRDFKDW:HVW 0HVTXLWH +LJK 6FKRRO ZKHUH KH JUDGXDWHG IURP WKUHH IRUPHU KLJK VFKRRO WHDPPDWHVDUHPHPEHUVRIWKH%RLVH6WDWHIRRWEDOOWHDPOLNHVWRVOHHS DQGSOD\YLGHRJDPHVGXULQJGRZQWLPHFRPPXQLFDWLRQPDMRUDW)UHVQR6WDWH 52 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: RETURNEES CHASON VIRGIL’S CAREER STATS 3$66,1* * $WW &PS ,QW TOTAL OFFENSE G Rush Pass Total Avg/G 2015 3 53 298 351 117.0 2016 (FRESHMAN):5HGVKLUWHG 2016 10 122 2021 2143 214.3 TOTAL 13 175 2319 2494 191.8 HIGH SCHOOL: $ IRXU\HDU VWDUWHU DQG IRXU\HDU VFKRODUDWKOHWH « VSHFLDOL]HGORQJHUVQDSSHUDQGZDVUDQNHGDPRQJWKHQDWLRQ·VWRSDWWKHSRVLWLRQ CHASON VIRGIL’S GAME-BY-GAME E\5XELR/RQJ6QDSSLQJFRP«PHPEHURI 0RQWLFHOOR(PSLUH/HDJXHWLWOHWHDP Rushing Passing DQGD*UHDW$PHULFDQ5LYDOU\&KDPSLRQ«PDGH'HDQ·V/LVWLQ 2016 - Sophomore Att. Yds. TD Lg Cmp Att Int Yds TD Lg Abilene Christian 6 -3 0 19 17 32 1 133 1 12 PERSONAL: %RUQLQ'DYLV&DOLI«VRQRI 3DWULFNDQG5RE\Q:LOOLDPV«KDV at No. 14 Ole Miss 6 8 0 15 22 42 1 274 2 31 D\RXQJHUVLVWHU-LOOLDQ«SUHEXVLQHVVPDMRUDW)UHVQR6WDWH No. 21 Utah 9 -1 0 22 12 23 0 190 2 85 Tulsa 19 47 2 14 21 45 1 276 1 65 at UNL 8 -5 0 19 16 45 1 296 2 80 at Nevada 7 16 0 15 16 27 0 197 1 33 31 San Diego State 9 44 0 28 16 26 2 139 0 49 at Utah State 8 28 0 11 27 44 0 205 1 22 ANDREW WRIGHT SAM Air Force 4 -12 0 2 18 37 4 303 3 58 6-2 | 210 | RFr. | 2nd Year at Colorado State 1 0 0 0 1 1 0 8 0 8 Buena Park, Calif. (Buena Park HS) TOTALS 77 122 2 28 166 322 10 2021 13 85 Rushing Passing 2015 - RFr. Att. Yds. TD Lg Cmp Att Int Yds TD Lg 2016 (FRESHMAN): 5HGVKLUWHG Abilene Christian 1 3 0 3 8 13 1 61 1 21 at No. 14 Ole Miss 3 22 0 9 12 18 2 140 2 37 HIGH SCHOOL: 1DPHGÀUVWWHDP$OO/HDJXHDQG'HIHQVLYH093UDFNHG No. 21 Utah 5 28 0 10 11 25 0 97 0 18 XSVDFNVWDFNOHVIRUDORVVDQGWRWDOWDFNOHVDVDVHQLRUKHOSHGOHDG TOTALS 9 53 0 10 31 56 3 298 3 37 WKHWHDPWRDQUHFRUGGXULQJKLVVHQLRUVHDVRQXQGHUFRDFK$QWKRQ\:KLWH KHOSHG%XHQD3DUN+LJK6FKRROJRDQGUHDFKWKH&,)6RXWKZHVW'LYLVLRQ CHASON VIRGIL’S SINGLE-GAME HIGHS VHPLÀQDOVORVLQJWRHYHQWXDOFKDPSLRQ7UDEXFR+LOOVDVDMXQLRU Rushing Yards: 47 - vs. Tulsa, 2016 Pass Attempts: 45 - 2x, 2016 PERSONAL: %RUQ LQ /RQJ %HDFK &DOLI « VRQ RI $QWKRQ\ DQG 6WHSKDQLH Pass Completions: 27- at Utah State, 2016 )HUQDQGH]«KDVWZR\RXQJHUVLVWHUV$ELJDLODQG$OH[DQGULD«LVDFULPLQRORJ\ Yards: 303 - vs. Air Force, 2016 ODZHQIRUFHPHQWPDMRUDW)UHVQR6WDWH TD: 3 - vs. Air Force, 2016 53 JACOB WESTBERRY LS 6-3 | 235 | RFr. | 2nd Year Bradenton, Fla. (Saint Stephen’s Episcopal) 2016 (FRESHMAN): 5HGVKLUWHG HIGH SCHOOL: 7KUHHVSRUW DWKOHWH DW 6DLQW 6WHSKHQ·V (SLVFRSDO LQ %UDGHQWRQ )ORULGD IRRWEDOO EDVNHWEDOO DQG EDVHEDOO QDPHG WR ÀUVW WHDP$OO6XQVKLQH6WDWH$WKOHWLF&RQIHUHQFHWHDP²RIIHQVLYHOLQHWKHWZRZD\ SOD\HUSURGXFHGWDFNOHVWDFNOHVIRUDORVVVDFNVDEORFNHGNLFNWKUHH IRUFHGIXPEOHVDQGRQHIXPEOHUHFRYHU\RQWKHGHIHQVLYHOLQHDQGZDVD ,QDXJXUDO,QGHSHQGHQWV$OO6WDWH(OLWH7HDPVHFRQGWHDPGHIHQVLYHHQGVHOHFWLRQ «ZDVDSRLQWVFRUHULQEDVNHWEDOODQGKDGDEDWWLQJDYHUDJHZLWK 5%,VDVDVHQLRUIRUWKHEDVHEDOOWHDPVHUYHGDVDFDSWDLQIRUERWKKLVIRRWEDOO DQGEDVNHWEDOOWHDPV PERSONAL: 6RQRI $OLVKDDQG0LFKDHO:HVWEHUU\KDVWZR\RXQJHUEURWKHUV &DGHDQG6WHYHQSUHEXVLQHVVPDMRUDW)UHVQR6WDWH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 53 THE BULLDOGS: NEWCOMERS 19 72 BRENT BAILEY QB DONTAE BULL OL 6-0 | 212 | Fr. | 1st Year 6-7 | 305 | Fr. | 1st Year Fresno, Calif. (Clovis North HS) Victoria, Canada (Belmont Secondary) HIGH SCHOOL: &LW\&RXQW\$OO6WDUJDPH093«ÀUVWWHDPDOO7UL5LYHU $WKOHWLF&RQIHUHQFHUHFRUGHGRYHUWRWDO\DUGVDQGWRXFKGRZQV« HIGH SCHOOL:1DPHGWKH6XEZD\3URYLQFLDO'HIHQVLYH3OD\HURI WKH OHG&ORYLV1RUWKWRDZLQLQWKHÀUVWURXQGRI WKH&HQWUDO6HFWLRQ PERSONAL: %RUQLQ%HOOÁRZHU&DOLI«VRQRI 5LFKDUG-UDQG.HLOD&DJH 26 «KDVWKUHHVLVWHUV5DFKHO$XVKDDQG$QLVVD«IRUPHUWHDPPDWH&DP6PLWK SOD\VDW6DQ-RVH6WDWH«IRUPHUWHDPPDWH&KULV:LOFR[SOD\VDW%<8«IRUPHU MATT BOATENG DB WHDPPDWH (YDQ 7\OHU SOD\V DW %RLVH 6WDWH « IDYRULWH DWKOHWH LV .KDOLO 0DFN 6-0 | 175 | Jr. | 4th Year EHFDXVH KLV SOD\ UHVHPEOHV PLQH DQG KH LV YHU\ KXPEOH « SODQV WR PDMRU LQ Toronto, Canada (Arizona Western College) PDUNHWLQJ PRIOR TO FRESNO STATE: $UULYHV DW )UHQVR 6WDWH DIWHU VSHQGLQJ D VHDVRQDW$UL]RQD:HVWHUQ&ROOHJHLQZKHUHKHUHJLVWHUHGWDFNOHVWZR LQWHUFHSWLRQVDQGDGGHGWZRSDVVEUHDNXSVLQJDPHVSOD\HGLQHLJKWJDPHV DV D WUXH IUHVKPDQ LQ SOD\LQJ IRU %LJ SURJUDP .DQVDV UHFRUGHG QLQHWDFNOHVZKLOHSRVWLQJDWHDPWKLUGEHVWÀYHSDVVEUHDNXSVDORQJZLWKWZR LQWHUFHSWLRQVGXULQJKLVWLPHZLWKWKH-D\KDZNV HIGH SCHOOL: 5DQNHG DV D WKUHHVWDU SURVSHFW DFFRUGLQJ WR (631FRP RXWRI WKH,0*$FDGHP\LQ%UDGHQWRQ)ORULGDQDPHGRQHRI WKHWRSVL[ &DQDGLDQVKHDGLQJWRDQ1&$$SURJUDPLQE\1)/FRPKHOSHGOHDG ,0*$FDGHP\WRDQPDUNÀQLVKLQJWKHVHDVRQZLWKWDFNOHVLQFOXGLQJ VRORVWRSVDQGZDVFUHGLWHGZLWKRQHLQWHUFHSWLRQRQHIRUFHGIXPEOHDQGRQH IXPEOHUHFRYHU\ZDVVHOHFWHGWRSDUWLFLSDWHLQWKH(DVWED\ PERSONAL: 6RQRI 54 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: NEWCOMERS 3 1 CHRIS COLEMAN DB DAMIEN DEGRUY DL 5-11 | 180 | Fr. | 1st Year 6-3 | 245 | Fr. | 1st Year Bakersfield, Calif. (Garces Memorial HS) New Orleans, La. (McDonogh HS) HIGH SCHOOL: 1DPHGD6RXWKZHVW PERSONAL: 6RQRI 7RGGDQG.LUVWHQ-DYHUQLFN«KDVRQHEURWKHU6KDQHDQG 7 RQHVLVWHU0D[«IRUPHUWHDPPDWHRI -DNH&ROHPDQ 6DQ-RVH6WDWH DQG9RVHDQ &UXPELH 1HYDGD «IDYRULWHDWKOHWHLV-RKQ(OZD\ DERRION GRIM WR 6-1 | 186 | So. | 1st Year Stockton, Calif. 2 (Ronald E. McNair HS/Delta JC/Nebraska) PATRICK JEUNE WR 6-0 | 187 | Fr. | 1st Year PRIOR TO FRESNO STATE: *ULPDUULYHVDW)UHVQR6WDWHDIWHUVSHQGLQJD Inglewood, Calif. (Morningside HS) VHDVRQDW'HOWD-XQLRU&ROOHJHZKHUHKHPDGHWKH1RU&DO$OO5HJLRQ,WHDPDIWHU OHDGLQJWKH0XVWDQJVZLWK\DUGVDQGWRXFKGRZQVRQUHFHSWLRQVLQ HQUROOHGHDUO\DW1HEUDVNDLQWKHVSULQJRI SDUWLFLSDWLQJLQWKH+XVNHUV VSULQJSUDFWLFHVEHIRUHGHFLGLQJWRUHWXUQFORVHUWRKRPH«ZDVQDPHGWRWKH HIGH SCHOOL: 1DPHGWR$OO%D\/HDJXHÀUVWWHDPDQGOHDJXH093DVD 6FKRODU$WKOHWH+RQRU5ROOGXULQJKLVVSULQJVHPHVWHUDW1HEUDVND VHQLRUGHVSLWHPLVVLQJWZRJDPHVWRLQMXU\«WKHGXDOWKUHDWVHQLRUUHFRUGHG FDWFKHVIRU\DUGVDQGVHYHQWRXFKGRZQVZKLOHFKLSSLQJLQWDFNOHVIRXU HIGH SCHOOL: :DV QDPHG WKH 6DQ -RDTXLQ $WKOHWLF $VVRFLDWLRQ 6-$$ LQWHUFHSWLRQVDQG3%8VRQGHIHQVH«UHWXUQHGIRXUNLFNRIIVIRUVFRUHV« 2IIHQVLYH3OD\HURI WKH PERSONAL: %RUQ LQ 6WRFNWRQ &DOLI « VRQ RI /D 7H·I *ULP DQG )ODQGUD :LOOLDPV*ULP«IDWKHU/D7H·I *ULPZDVDWZRWLPHÀUVWWHDP%LJ(DVWZLGH UHFHLYHUDW3LWWVEXUJKLQKDVWZREURWKHU 0DOLNDQG7\OHR DQGWZR VLVWHUV $ULRQDQG)DLWK «ZDVKRQRUHGIRUDFKLHYLQJDJUDGHSRLQWDYHUDJH IRU WZR FRQVHFXWLYH VHPHVWHUV DW 5RQDOG ( 0F1DLU +LJK 6FKRRO KDV DOVR YROXQWHHUHGKLVWLPHZLWK0DNH$:LVKDQG%HWKH0DWFK$YHU\6WURQJ%RQH 0DUURZ'ULYH«IDYRULWHDWKOHWHLV/H%URQ-DPHV«SODQVWRPDMRULQJUDSKLF GHVLJQDW)UHVQR6WDWH 56 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: NEWCOMERS 16 22 KYLE LINDQUIST QB JORDAN MIMS RB 6-4 | 212 | Fr. | 1st Year 5-11 | 190 | Fr. | 1st Year Chico, Calif. (Pleasant Valley HS) East Palo Alto, Calif. (Menlo-Atherton HS) HIGH SCHOOL: /HG3OHDVDQW9DOOH\+LJK6FKRROWRWKH'LYLVLRQ$VWDWH FKDPSLRQVKLSLQWKDWJDPHEURNHWKHVFKRRO·VUHFRUGIRUPRVWSDVVLQJ\DUGV HIGH SCHOOL: 0LPVZDVQDPHGWKH6RXWK%D\3HQLQVXOD2IIHQVLYH LQDJDPH ZKLFKZDVSUHYLRXVO\KHOGE\$DURQ5RGJHUVDOVRVXUSDVVHG 3OD\HURI WKH PRIOR TO FRESNO STATE: 3OD\HG LQ JDPHV GXULQJ WKUHH VHDVRQV DW 1RUWKHUQ$UL]RQD«FROOHFWHGWDFNOHVIRUWKH/XPEHUMDFNV 15 HIGH SCHOOL: 6WDUWHUDQGFDSWDLQDW(GLVRQ«OHGWKHWHDPLQVRORWDFNOHV DANIEL MORAGA TE DQGIRUFHGIXPEOH 6-3 | 235 | Fr. | 1st Year PERSONAL: %RUQLQ)UHVQR&DOLI«VRQRI 5RQDQG7DVKD0DQQLQJ«KDV Oxnard, Calif. (Pacifica HS) WZRVLVWHUV7DWLDQDDQG%DLOH\«XQFOH5LFN\0DQQLQJSOD\HGLQWKH1)/IRUWKH &DUROLQD3DQWKHUV&KLFDJR%HDUVDQG6W/RXLV5DPVDQGFXUUHQWO\VHUYHVDVDQ DVVLVWDQWGHIHQVLYHEDFNVFRDFKIRUWKH6HDWWOH6HDKDZNVIDYRULWHDWKOHWHLV.REH HIGH SCHOOL: 1DPHGWRWKH9HQWXUD6WDU·V$OO&RXQW\2IIHQVLYH)LUVW %U\DQW«ELJJHVWDWKOHWLFWKULOOLVVFRULQJD\DUGWRXFKGRZQLQKLJKVFKRRO« 7HDP«FRXQW\FRDFKHVYRWHGKLPFR5HFHLYHURI WKH HIGH SCHOOL: 1DPHGWRWKH)UHVQR%HH)RRWEDOO$OO6WDU-LYHDVDVHQLRU HIGH SCHOOL: 9HQWXUD6WDU·V$OO&RXQW\GHIHQVLYHÀUVWWHDP«QDPHGWKH LQQDPHGWRWKHÀUVWWHDP&0$&GHIHQVH ZDVDWZRZD\VWDUWHU &DPLQR /HDJXH ZLGH UHFHLYHU RI WKH \HDU « FRXQW\ FRDFKHV YRWHG KLP DW UHFHLYHU DQG FRUQHUEDFN DW 6DQJHU +6 KHOSHG OHDG 6DQJHU WR WKH 6HFWLRQ FRUHFHLYHURI WKH\HDU «9HQWXUD&RXQW\$OO6WDU«9HQWXUD 'LYLVLRQ ,, 9DOOH\ FKDPSLRQVKLS DQG &RXQW\0HWUR /HDJXH &KDPSLRQVKLS &RXQW\DWKOHWHRI WKH\HDU«0RRUSDUN+LJK6FKRRODWKOHWHRI WKH\HDU ZDVDWZRWLPHDOOOHDJXHGHIHQVLYHEDFN «ÀQLVKHGKLVVHQLRUVHDVRQZLWKFDWFKHVIRU\DUGVRQRIIHQVHDQGWKUHH LQWHUFHSWLRQVWDFNOHVWZRSDVVEUHDNXSVDQGRQHIRUFHGIXPEOHRQGHIHQVH PERSONAL: 6RQRI 3RQGHU5LFKDUGVRQ,,DQG6RQ\D0XUSK\«KDVWKUHH «OHG0RRUSDUNWRDUHFRUGLQDQGPDGHWKHSOD\RIIVIRUÀUVWWLPH EURWKHUV.HYLQ3ULFH5RQQLH PERSONAL: 3ODQVWRPDMRULQFRPPXQLFDWLRQVDW)UHVQR6WDWH 58 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE THE BULLDOGS: NEWCOMERS 20 65 RONNIE RIVERS RB SYRUS TUITELE OL 5-8 | 175 | Fr. | 1st Year 6-6 | 298 | Fr. | 1st Year Brentwood, Calif. (Freedom HS) Chico, Calif. (Pleasant Valley HS) HIGH SCHOOL: 5LYHUVZDVRQHRI VL[ÀQDOLVWVIRU&DO+L6SRUWV·0U)RRWEDOO HIGH SCHOOL: 6HOHFWHG WR $OO16&,) ÀUVWWHDP GHIHQVH D 6WDWH3OD\HURI WKH PERSONAL: %RUQLQ)UHVQR&DOLIDQGKRPHWRZQLV3HWDOXPD&DOLIVRQ RI 6DVNLD5XVVHOOLVWKHROGHVWRI IRXUFKLOGUHQKDVWZREURWKHUV0DYHULFN DQG+XGVRQDQGRQHVLVWHU%URGLQH[SHFWVWRVHHKLJKVFKRROWHDPPDWHV-DFN 6Q\GHU 6DQ-RVH6WDWH DQG+XQWHU-XDUH] 1HYDGD LQ0RXQWDLQ:HVWOHDJXH SOD\IDYRULWHDWKOHWHLV.HYLQ'XUDQWEHFDXVHRI WKHUHVSHFWKHVKRZVIRUKLV PRWKHUELJJHVWDWKOHWLFWKULOOLVNQRFNLQJDOLQHEDFNHURQKLVEDFNPDMRUDW )UHVQR6WDWHLVXQGHFLGHGEXWVHHVKLPVHOI ZLWKDFDUHHULQODZHQIRUFHPHQWRU WKHPLOLWDU\ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 59 THE BULLDOGS: NEWCOMERS 57 66 MYKAL WALKER ILB QUIREO WOODLEY OL 6-3 | 215 | Jr. | 3rd Year 6-4 | 300 | Fr. | 1st Year Vacaville, Calif. (Azusa Pacific/Vacaville HS) Murrieta, Calif. (Murrieta Valley HS/Fresno City College) PRIOR TO FRESNO STATE: 1DPHG WR WKH ÀUVWWHDP $OO*UHDW PRIOR TO FRESNO STATE: ,QLWLDOO\FRPPLWWHGWR)UHVQR6WDWHRQQDWLRQDO 1RUWKZHVW$WKOHWLF&RQIHUHQFH *1$& GHIHQVLYHWHDPSOD\HGLQDOOJDPHV VLJQLQJGD\RQ)HEDVKHZRUNHGWKURXJK1&$$HOLJLELOLW\LVVXHVDQG IRU$]XVD3DFLÀFDQGZDVRQHRI WZRLQGLYLGXDOVRQWKHWHDPWRSRVWWULSOHGLJLW DIWHUDWWHQGLQJFODVVHVDW)UHVQR&LW\&ROOHJHGXULQJWKHIDOORI HQUROOHGDW WDFNOHV²OHGWKHWHDPLQWDFNOHVIRUDORVVZLWKDOVRUHFRUGHG )UHVQR6WDWHLQWKHVSULQJRI DQGSDUWLFLSDWHGLQVSULQJSUDFWLFH VDFNVWZRLQWHUFHSWLRQVWZRSDVVEUHDNXSVIRXUTXDUWHUEDFNKXUULHVDQGRQH EORFNHGNLFNSRVWHGDVHDVRQKLJKWDFNOHVYV&RORUDGR0LQHV 6DZ HIGH SCHOOL: *DUQHUHG ÀUVWWHDP $OO6RXWKZHVWHUQ /HDJXH DQG VLJQLÀFDQWDFWLRQDVDWUXHIUHVKPDQOLQHEDFNHUSOD\HGLQQLQHJDPHVÀQLVKLQJ 3UHVV(QWHUSULVH$OO$UHDKRQRUDEOHPHQWLRQDFFRODGHVDW0XUULHWD9DOOH\ VHYHQWKRQWKHWHDPLQWDFNOHVEHVWSHUIRUPDQFHZDVDQWDFNOHWZR7)/ +LJK6FKRROKHOSHGOHDG0XUULHWD9DOOH\WRDUHFRUGDQGDPDUNLQWKH SHUIRUPDQFHDJDLQVW&HQWUDO:DVKLQJWRQVHYHQWDFNOHRQH7)/RQHVDFNDQG 6RXWKZHVWHUQ/HDJXHWRÀQLVKVHFRQGLQWKHOHDJXHUDQNHGDVWKHVL[WKEHVW RQHLQWHUFHSWLRQDJDLQVW'L[LH6WDWH RIIHQVLYHJXDUGLQ&DOLIRUQLDE\6FRXWFRPDQGWKEHVWRYHUDOOQDPHGDÀUVW WHDP$OO6RXWKZHVWHUQ/HDJXHVHOHFWLRQDVDMXQLRULQ HIGH SCHOOL: :DVDWKUHHVSRUWDWKOHWHDW9DFDYLOOH+LJK6FKRROFRPSHWLQJ LQ IRRWEDOO EDVNHWEDOO DQG WUDFN ÀHOG FRPSHWHG RQ WKH YDUVLW\ OHYHO IRU PERSONAL: %RUQLQ9LUJLQLD%HDFK9DVRQRI )DWLPDK+DUYH\«KDVD WUDFN ÀHOGIRUIRXU\HDUVLQUHOD\VDQGKXUGOHVSOD\HGYDUVLW\EDVNHWEDOOIRU JRGGDXJKWHU/LQJ/LQJNLQHVLRORJ\PDMRUDW)UHVQR6WDWH WZR\HDUVDVDIRUZDUGDQGFHQWHUOHWWHUHGWKUHHWLPHVLQIRRWEDOO DVD IUHH VDIHW\OLQHEDFNHUDQGUXQQLQJEDFNIRUKHDGFRDFK0LNH3DSDGRSRXORVDVD VHQLRUWDOOLHGFDUULHVIRU\DUGVDQGHLJKWWRXFKGRZQVDVDUXQQLQJEDFN GHIHQVLYHO\OHGWKHWHDPLQWRWDOWDFNOHVZLWKLQFOXGLQJVRORWDFNOHV UHWXUQHGNLFNVIRXUWLPHVIRUDWRWDORI \DUGVLQFOXGLQJRQHWKDWZDVUHWXUQHG IRUDWRXFKGRZQDJDLQVW9LQWDJHQHHGHGRQO\HLJKWFDUULHVWRUXQIRU\DUGV DQGWZRWRXFKGRZQVDQGGHIHQVLYHO\UHFRUGHGQLQHVRORWDFNOHVDJDLQVW1DSD WDOOLHGWRWDOWDFNOHVDQGDOVRKDGDUHFHLYLQJWRXFKGRZQZDVDWUDFNDQGÀHOG VWDWHÀQDOLVWLQWKH[PDQG[PLQ PERSONAL: %RUQ LQ )UHVQR &DOLI VRQ RI 0LFKDHO :DONHU DQG .HQGUD 0RUULVKDVDWZLQEURWKHU0DO\NDQGWZRROGHUEURWKHUV6SHQFHUDQG3DWULFN KDVRQHVLVWHU$XQVFKHOH-DFNVRQDGPLUHVDWKOHWHV/H%URQ-DPHVDQG&DP 1HZWRQIRUWKHLUOHDGHUVKLSDELOLWLHVQRWKLQJH[FLWHVKLPPRUHRQWKHIRRWEDOO ÀHOGPRUHWKDQDJRDOOLQHVWDQGSODQVWRPDMRULQFULPLQDOMXVWLFHDW)UHVQR 6WDWH 60 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS 2016 SCHEDULE/RESULTS Date Opponent Result Score Overall Conference Time Attend Sept. 3, 2016 at Nebraska L 43-10 0-1 -- 3:26 90,013 Sept. 10, 2016 Sacramento State W 31-3 1-1 -- 3:03 31,817 Sept. 17, 2016 at Toledo L 52-17 1-2 -- 3:28 19,379 Sept. 24, 2016 Tulsa L 48-41 1-3 -- 3:59 23,273 Oct. 1, 2016 at UNLV* L 45-20 1-4 0-1 3:34 17,811 Oct. 8, 2016 at Nevada* L 27-22 1-5 0-2 3:18 22,411 Oct. 14, 2016 San Diego State* L 17-3 1-6 0-3 3:03 24,731 Oct. 22, 2016 at Utah State* L 38-20 1-7 0-4 3:48 15,067 Oct. 28, 2016 Air Force* L 31-21 1-8 0-5 3:22 25,197 Nov. 5, 2016 at Colorado State* L 37-0 1-9 0-6 3:00 23,187 Nov. 19, 2016 Hawai’i* L 14-13 1-10 0-7 3:17 26,951 Nov. 26, 2016 San Jose State* L 16-14 1-11 0-8 3:17 20,991 * MW game TEAM STATISTICS TEAM STATISTICS Fresno St. OPP Score by Quarters 1st 2nd 3rd 4th OT Total SCORING 212 371 Fresno State 48 65 43 56 0 212 Points Per Game 17.7 30.9 Opponents 55 120 82 107 7 371 Points Off Turnovers 38 37 FIRST DOWNS 206 261 FIELD GOALS FGM-FGA Pct. 01-19 20-29 30-39 40-49 50-59 Lg Blk Rushing 83 167 KROENING, Kody 15-17 88.2 0-0 7-7 2-3 6-7 0-0 49 1 Passing 102 80 Penalty 21 14 FG SEQUENCE Fresno St. Opponents RUSHING YARDAGE 1394 2972 Yards gained rushing 1728 3165 Nebraska 32, (26) - Yards lost rushing 334 193 Sacramento State (21) (44) Rushing Attempts 440 601 TOLEDO (42) (22), 45 Average Per Rush 3.2 4.9 Tulsa (25), (25) (37), (28), 42 Average Per Game 116.2 247.7 UNLV (42), (47) (38) TDs Rushing 11 25 Nevada (44), (25), (35) 24 PASSING YARDAGE 2557 2009 San Diego State (39) (47) Comp-Att-Int 210-405-13 159-270-5 Utah State (27), (49) (43) Average Per Pass 6.3 7.4 Air Force - 27, (27) Average Per Catch 12.2 12.6 Colorado State - (33) Average Per Game 213.1 167.4 Hawai’i (47), (27), 43 - TDs Passing 13 21 San Jose State - (28), (22), (23) TOTAL OFFENSE 3951 4981 SDUHQWKHVLVLQGLFDWH¿HOGJRDOZDVPDGH Total Plays 845 871 Average Per Play 4.7 5.7 PUNTING No. Yds Avg. Long TB FC I20 Blkd Average Per Game 329.2 415.1 CUSICK, Blake 78 2990 38.3 59 2 48 20 2 KICK RETURNS: #-Yards 41-877 34-603 TEAM 2 0 0.0 0 0 0 0 0 PUNT RETURNS: #-Yards 24-159 10-52 Total...... 80 2990 37.4 59 2 48 20 2 INT RETURNS: #-Yards 5-0 13-164 Opponents...... 68 2574 37.9 57 2 24 23 2 KICK RETURN AVERAGE 21.4 17.7 PUNT RETURN AVERAGE 6.6 5.2 KICKOFFS No. Yds Avg. TB OB Retn Ney YdLn INT RETURN AVERAGE 0.0 12.6 VAN VALKENBURG 29 1793 61.8 6 2 FUMBLES-LOST 13-5 14-4 CAMACHO, Jimmy 20 1217 60.8 6 1 PENALTIES-Yards 76-669 69-624 KROENING, Kody 1 53 53.0 0 0 Average Per Game 55.8 52.0 Total...... 50 3063 61.3 12 3 603 43.2 21 PUNTS-Yards 80-2990 68-2574 Opponents...... 70 4340 62.0 27 2 877 39.8 25 Average Per Punt 37.4 37.9 Net punt average 36.2 34.9 PUNT RETURNS No. Yds Avg. TD Long KICKOFFS-Yards 50-3063 70-4340 GLASS, Tyquwan 15 97 6.5 0 33 Average Per Kick 61.3 62.0 JOHNSON, KeeSean 6 36 6.0 0 10 Net kick average 43.2 39.8 TEAM 1 0 0.0 0 0 TIME OF POSSESSION/Game 28:49 31:11 HUGHES, Juju 1 11 11.0 0 11 3RD-DOWN Conversions 76/200 68/165 STANLEY, Robert 1 15 15.0 0 15 3rd-Down Pct 38% 41% Total...... 24 159 6.6 0 33 4TH-DOWN Conversions 8/23 9/13 Opponents...... 10 52 5.2 1 3 4th-Down Pct 35% 69% SACKS BY-Yards 14-94 31-186 KICK RETURNS No. Yds Avg. TD Long MISC YARDS 0 0 JORDAN, Jamire 12 253 21.1 0 28 TOUCHDOWNS SCORED 24 48 JOHNSON, KeeSean 11 227 20.6 0 29 FIELD GOALS-ATTEMPTS 15-17 12-16 O’NEAL, Dejonte 8 241 30.1 0 59 ON-SIDE KICKS 0-0 0-0 GLASS, Tyquwan 7 128 18.3 0 24 RED-ZONE SCORES (26-34) 76% (42-50) 84% ALLISON, Jeffrey 2 15 7.5 0 8 RED-ZONE TOUCHDOWNS (17-34) 50% (34-50) 68% KELLY, Anthoula 1 13 13.0 0 13 PAT-ATTEMPTS (23-23) 100% (45-47) 96% Total...... 41 877 21.4 0 59 ATTENDANCE 152960 187868 Games/Avg Per Game 6/25493 6/31311 Opponents...... 34 603 17.7 0 32 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 61 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS | ------PATs ------| RUSHING G Att. Gain Loss Net Avg. TD Long Avg/G SCORING TD FGs Kick Rush Rcv Pass DPX Saf Pts JAMES, Dontel 11 208 748 51 697 3.4 5 34 63.4 KLINE, Zach 7 48 204 70 134 2.8 1 32 19.1 KROENING, Kody 0 15-17 23-23 0-0 0 0-0 0 0 68 HOKIT, Josh 12 27 130 0 130 4.8 0 18 10.8 JOHNSON, KeeSean 6 0-0 0-0 0-0 0 0-0 0 0 36 VIRGIL, Chason 10 77 292 170 122 1.6 2 28 12.2 JAMES, Dontel 5 0-0 0-0 0-0 0 0-0 0 0 30 GREEN, Treyvon 11 24 111 3 108 4.5 0 18 9.8 JORDAN, Jamire 3 0-0 0-0 0-0 0 0-0 0 0 18 JORDAN, Jamire 12 17 105 22 83 4.9 1 14 6.9 PECK, Aaron 3 0-0 0-0 0-0 0 0-0 0 0 18 O’NEAL, Dejonte 4 16 66 9 57 3.6 1 17 14.2 VIRGIL, Chason 2 0-0 0-0 0-0 0 0-1 0 0 12 OGLESBY, Bryson 1 9 43 4 39 4.3 0 21 39.0 RICE, Jared 2 0-0 0-0 0-0 0 0-0 0 0 12 JOHNSON, KeeSean 12 3 14 1 13 4.3 0 10 1.1 CRONK, Christian 1 0-0 0-0 0-0 0 0-0 0 0 6 RICE, Justin 6 9 14 3 11 1.2 0 5 1.8 O’NEAL, Dejonte 1 0-0 0-0 0-0 0 0-0 0 0 6 CRONK, Christian 12 1 1 0 1 1.0 1 1 0.1 KLINE, Zach 1 0-0 0-0 0-0 0 0-0 0 0 6 ALLEN, Justin 11 1 0 1 -1 -1.0 0 0 -0.1 Total...... 24 15-17 23-23 0-0 0 0-1 0 0 212 Total...... 12 440 1728 334 1394 3.2 11 34 116.2 Opponents...... 48 12-16 45-47 1-1 0 0-0 0 0 371 Opponents...... 12 601 3165 193 2972 4.9 25 91 247.7 TOTAL OFFENSE G Plays Rush Pass Total Avg/G PASSING G EI¿F&RPS$WW,QW 3FW 62 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS | ------Tackles ------| | -Sacks- | | --- Pass Def --- | | - Fumbles - | Blkd DEFENSIVE LEADERS GP Solo Ast Total TFL/Yds No.-Yards Int-Yds BrUp QBH Rcv-Yds FF Kick Saf BROWN, Stratton 12 57 58 115 5.5-20 1.0-9 1-0 4 . . 1 . . CAMILLI, Jeff 11 53 55 108 9.0-41 4.0-29 . 2 1 . 1 . . BAILEY, James 12 32 27 59 5.0-11 0.5-3 . 4 1 1-0 . . . POTTS, DeShawn 12 29 30 59 1.0-1 . . 5 . 1-0 . 1 . GLASS, Tyquwan 11 40 17 57 1.5-6 . 2-0 9 . . 1 . . STANLEY, Robert 10 29 25 54 3.0-4 ...... 1 . ELLIS, Jamal 12 34 19 53 . . 2-0 5 . 1-0 . . . OKEKE, Tobenna 12 22 30 52 2.5-17 2.5-17 . . 2 . 1 . . OTUKOLO, Nela 10 27 21 48 5.5-10 1.5-3 . 1 . . 1 . . FORRESTER, Malik 11 21 17 38 5.0-12 1.0-6 ...... SOECHTING, Trent 12 17 19 36 2.0-9 ...... BELL, Mike 12 17 18 35 2.5-4 . . 1 . . . . . KRISTOFORS, Nick 12 19 9 28 1.0-15 1.0-15 . 1 1 1-0 . . . MADSEN, Nathan 12 11 11 22 1.5-11 1.5-11 . . 1 . . . . HUGHES, Brandon 6 10 11 21 4.0-11 . . . 1 . . . . ALLISON, Jeffrey 12 8 13 21 ...... HUGHES, Juju 12 8 10 18 1.5-7 ...... BELONY, Patrick 12 6 8 14 1.0-1 . . 1 . . . . . VAIMILI, Austin 10 7 5 12 0.5-1 . . . 1 . . . . WRIGHT, Alan 12 4 7 11 0.5-0 ...... HENDRICKSON, Kyle 9 2 8 10 0.5-1 ...... GREEN, Justin 12 6 2 8 2.0-4 1.0-1 ...... KELLY, Anthoula 7 6 2 8 . . . 2 . . . . . JONES, Dalen 9 4 3 7 ...... HOKIT, Josh 12 5 2 7 ...... HELMUTH, George 12 3 4 7 ...... BRYANT, Jaron 11 2 4 6 ...... PIPER, Elijah 9 3 1 4 ...... SMITH, Jalen 5 2 2 4 ...... MCBEE, Wyatt 7 1 2 3 1.0-4 ...... ALVAREZ, Ryan 3 . 3 3 ...... MARTENS, Michael 10 2 1 3 ...... FUERY, Darrell 10 1 1 2 ...... JOHNSON, KeeSean 12 2 . 2 ...... 1 . . VAN VALKENBURG, Nick 9 1 1 2 ...... GREEN, Treyvon 11 . 1 1 ...... TEAM 8 1 . 1 ...... JORDAN, Jamire 12 1 . 1 ...... VIRGIL, Chason 10 1 . 1 ...... PECK, Aaron 11 1 . 1 ...... MITCHELL, Aaron 12 1 . 1 ...... HAYNES, Jasad 5 . 1 1 ...... Total...... 12 496 448 944 56-190 14-94 5-0 35 8 4-0 6 2 . Opponents...... 12 460 358 818 86.0-305 31-186 13-164 47 21 5-0 6 3 . DEFENSE GAME-BY-GAME TACKLES UA-A Tot NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU BROWN, Stratton 57-58 115 2-4 2-0 6-4 9-1 3-2 3-3 6-8 3-10 4-11 5-4 7-3 7-8 CAMILLI, Jeff 53-55 108 3-7 DNP 3-4 14-1 6-4 5-5 2-8 1-7 5-6 2-6 6-1 6-6 BAILEY, James 32-27 59 0-1 8-0 1-4 6-1 4-3 0-2 1-5 2-2 5-1 1-6 1-1 3-1 POTTS, DeShawn 29-30 59 2-3 4-0 5-3 2-0 - 4-3 2-9 2-0 2-2 2-4 3-4 1-2 GLASS, Tyquwan 40-17 57 2-2 4-0 1-2 3-0 3-1 5-0 6-0 2-4 5-4 DNP 3-2 6-2 STANLEY, Robert 29-25 54 3-1 - 6-0 6-1 0-1 DNP DNP 1-5 5-6 3-1 1-2 4-8 ELLIS, Jamal 34-19 53 2-2 3-0 1-1 10-0 3-1 3-3 5-3 1-2 1-1 3-2 0-2 2-2 OKEKE, Tobenna 22-30 52 0-1 1-0 4-1 4-0 2-2 0-2 1-7 2-6 2-7 4-2 2-0 0-2 OTUKOLO, Nela 27-21 48 DNP 4-1 1-2 5-0 6-2 4-2 0-10 2-3 3-0 1-1 1-0 DNP FORRESTER, M. 21-17 38 1-3 DNP 1-1 3-1 3-2 4-2 3-3 1-0 2-2 0-1 - 3-2 SOECHTING, T. 17-19 36 3-4 1-0 0-2 - 1-1 1-1 - 1-0 3-7 3-2 - 4-2 BELL, Mike 17-18 35 0-1 - 1-0 1-0 1-1 2-2 2-2 1-6 2-3 5-1 1-0 1-2 KRISTOFORS, Nick 19-9 28 0-2 - 4-1 2-1 2-1 6-0 1-3 1-0 2-0 0-1 1-0 - MADSEN, Nathan 11-11 22 3-1 1-0 - 4-0 1-3 - 0-2 - 1-1 - 0-1 1-3 HUGHES, Brandon 10-11 21 2-5 2-1 1-4 3-0 2-0 0-1 DNP DNP DNP DNP DNP DNP ALLISON, J. 8-13 21 1-2 1-2 1-3 - 1-1 4-3 0-1 - - 0-1 - - HUGHES, Juju 8-10 18 - - - - - 1-1 0-2 0-1 2-3 3-3 1-0 1-0 BELONY, Patrick 6-8 14 0-1 1-1 1-1 2-0 - - 0-3 1-1 - 0-1 - 1-0 VAIMILI, Austin 7-5 12 0-1 2-1 0-1 5-0 - 0-1 DNP - - 0-1 - DNP WRIGHT, Alan 4-7 11 0-1 - 0-2 - 2-1 0-1 - - 0-1 2-1 - - HENDRICKSON, K. 2-8 10 DNP DNP 1-1 DNP - - 0-1 0-2 0-2 0-1 1-0 0-1 KELLY, Anthoula 6-2 8 1-0 - - DNP DNP DNP 1-1 - DNP 3-1 1-0 DNP GREEN, Justin 6-2 8 - 2-0 1-0 - 1-0 - - 1-0 0-2 1-0 - - HOKIT, Josh 5-2 7 - 3-0 1-0 - - - - 1-1 0-1 - - - JONES, Dalen 4-3 7 2-0 - 1-0 1-0 DNP DNP DNP 0-1 0-1 - - 0-1 HELMUTH, George 3-4 7 - - 1-0 - - - 0-1 1-0 - 1-3 - - BRYANT, Jaron 2-4 6 1-0 - - - DNP 0-1 - 0-1 0-1 0-1 1-0 - SMITH, Jalen 2-2 4 - - 1-2 1-0 - DNP DNP DNP DNP DNP DNP DNP PIPER, Elijah 3-1 4 - 1-0 - 1-0 - - 1-1 DNP - - DNP DNP 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 63 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS INDIVIDUAL GAME-BY-GAME RUSHING No-Yds/TD NEB SAC Toledo Tulsa UNLV Nevada SDSU USU AFA CSU UH SJSU JAMES, Dontel 208-697/5 12-20/0 27-121/1 13-40/0 21-65/1 18-53/0 27-169/1 15-34/0 29-80/1 19-24/0 DNP 15-49/0 12-42/1 KLINE, Zach 48-134/1 1-11/0 1-9/0 1-4/0 DNP DNP 4-23/0 DNP DNP DNP 17-26/0 10-52/0 14-9/1 HOKIT, Josh 27-130/0 ------18-97/0 9-33/0 VIRGIL, Chason 77-122/2 6--3/0 6-8/0 9--1/0 19-47/2 8--5/0 7-16/0 9-44/0 8-28/0 4--12/0 1-0/0 DNP DNP GREEN, Treyvon 24-108/0 1-3/0 5-34/0 - - - 6-29/0 - 1-3/0 3-3/0 DNP 3-15/0 5-21/0 JORDAN, Jamire 17-83/1 1-1/0 - - - 6-16/0 - - - 3-21/0 4-15/0 2--5/0 1--9/0 O’NEAL, Dejonte 16-57/1 4-0/0 4-28/1 4-8/0 4-21/0 DNP DNP DNP DNP DNP DNP DNP DNP OGLESBY, Bryson 9-39/0 DNP DNP DNP DNP DNP DNP DNP DNP DNP 9-39/0 DNP DNP JOHNSON, KeeSean 3-13/0 1--1/0 - - - - 1-10/0 - - - - 1-4/0 - RICE, Justin 9-11/0 DNP DNP DNP DNP DNP 3-8/0 - 1-3/0 1-1/0 3--3/0 1-2/0 DNP CRONK, C. 1-1/1 ------1-1/1 - ALLEN, Justin 1--1/0 ------DNP - 1--1/0 - RUSHING No-Yds/TD NEB SAC Toledo Tulsa UNLV Nevada SDSU USU AFA CSU UH SJSU JOHNSON, KeeSean 66-773/6 8-61/0 7-82/2 4-51/1 7-80/0 5-57/0 5-71/0 8-56/0 6-59/0 10-142/3 2-23/0 3-38/0 1-53/0 JORDAN, Jamire 45-713/2 5-52/0 7-100/0 1-85/1 6-108/1 2-10/0 3-50/0 1-49/0 10-67/0 4-115/0 3-64/0 2-2/0 1-11/0 PECK, Aaron 46-630/3 9-112/1 3-42/0 3-46/0 6-68/0 5-194/2 2-17/0 6-32/0 DNP 1-16/0 2-13/0 3-27/0 6-63/0 HARDAWAY, Delvon 10-122/0 - - - DNP 2-13/0 1-23/0 - 3-47/0 3-30/0 DNP 1-9/0 - OLSEN, Chad 6-85/0 2-18/0 1-31/0 1-16/0 2-20/0 - DNP DNP DNP DNP DNP DNP DNP MARTENS, Michael 6-81/0 - - - - 1-14/0 DNP DNP 1-5/0 - 2-36/0 1-17/0 1-9/0 ALLEN, Justin 4-36/0 - - - - 1-8/0 - - 1-8/0 DNP - 1-11/0 1-9/0 RIDDERING, Kyle 7-33/0 - - - - - 1-12/0 1-2/0 3-11/0 - 2-8/0 - - GREEN, Treyvon 2-23/0 - - - - - 2-23/0 - - - DNP - - O’NEAL, Dejonte 7-18/0 - 3-13/0 4-5/0 - DNP DNP DNP DNP DNP DNP DNP DNP RICE, Justin 2-15/0 DNP DNP DNP DNP DNP - - 1-4/0 - 1-11/0 - DNP VIRGIL, Chason 1-9/0 ------1-9/0 - DNP DNP JAMES, Dontel 3-9/0 - 1-6/0 - - - 1-0/0 - 1-3/0 - DNP - - RICE, Jared 4-6/2 - - - - - 1-1/1 - 1-1/1 - DNP 2-4/0 - KLINE, Zach 1-4/0 - - - DNP DNP - DNP DNP DNP - - 1-4/0 PASSING #10 ZACH KLINE AWW &RPS ,QW 3FW KICK RET No-Yds/TD NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU JORDAN, Jamire 12-253 - - 1-21 - 3-70 - - 2-42 2-40 1-19 2-42 1-19 O’NEAL, Dejonte 8-241 2-46 - 3-71 3-124 DNP DNP DNP DNP DNP DNP DNP DNP JOHNSON, KeeSean 11-227 2-43 - 2-31 1-21 1-20 - 1-27 2-27 2-58 - - - GLASS, Tyquwan 7-128 - - 1-10 1-20 2-34 - 3-64 - - DNP - - ALLISON, J. 2-15 ------2-15 - - - KELLY, Anthoula 1-13 1-13 - - DNP DNP DNP - - DNP - - DNP INT RET No-Yds/TD NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU ELLIS, Jamal 2-0 - 1-0 - 1-0 ------GLASS, Tyquwan 2-0 - 1-0 ------DNP 1-0 - BROWN, Stratton 1-0 ------1-0 FUMBLES LOST #Lost NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU N/A ------64 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS TKLS FOR LOSS UA-A Tot NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU CAMILLI, Jeff 8-2 9.0 - DNP 1.0-4 2.0-17 1.0-1 - 0.5-1 - 1.0-6 0.5-1 1.0-3 2.0-8 OTUKOLO, Nela 4-3 5.5 DNP 1.0-2 - 1.0-1 1.0-1 1.0-2 1.0-2 0.5-2 - - - DNP BROWN, Stratton 5-1 5.5 - - 1.5-4 - - - 1.0-1 - - 1.0-1 1.0-9 1.0-5 BAILEY, James 3-4 5.0 - 1.0-2 0.5-1 1.5-4 1.0-4 - - 0.5-0 - 0.5-0 - - FORRESTER, M. 4-2 5.0 - DNP - 0.5-3 1.0-1 - 2.0-3 1.0-2 - - - 0.5-3 HUGHES, Brandon 3-2 4.0 - 0.5-1 0.5-0 2.0-6 1.0-4 - DNP DNP DNP DNP DNP DNP STANLEY, Robert 2-2 3.0 - - - 1.0-1 - DNP DNP - 1.5-2 - - 0.5-1 BELL, Mike 1-3 2.5 ------0.5-0 0.5-1 - 1.0-3 - 0.5-0 OKEKE, Tobenna 2-1 2.5 - - - 1.0-11 - - 0.5-0 - - - 1.0-6 - SOECHTING, T. 1-2 2.0 1.0-7 - 0.5-1 - - - - - 0.5-1 - - - GREEN, Justin 2-0 2.0 - 1.0-1 ------1.0-3 - - GLASS, Tyquwan 1-1 1.5 ------0.5-1 - DNP 1.0-5 - MADSEN, Nathan 1-1 1.5 - 1.0-8 ------0.5-3 HUGHES, Juju 1-1 1.5 ------1.5-7 - - - KRISTOFORS, Nick 1-0 1.0 - - - - - 1.0-15 ------MCBEE, Wyatt 1-0 1.0 - DNP - DNP DNP DNP - DNP - - 1.0-4 - BELONY, Patrick 0-2 1.0 - 0.5-1 - - - - 0.5-0 - - - - - POTTS, DeShawn 1-0 1.0 - - 1.0-1 ------WRIGHT, Alan 0-1 0.5 - - 0.5-0 ------HENDRICKSON, Kyle 0-1 0.5 DNP DNP - DNP - - - - 0.5-1 - - - VAIMILI, Austin 0-1 0.5 - - 0.5-1 - - - DNP - - - - DNP SACKS UA-A Tot NEB SAC Toledo Tulsa UNLV Nev SDSU USU AFA CSU UH SJSU CAMILLI, Jeff 4-0 4.0 - DNP - 2.0-17 - - - - 1.0-6 - - 1.0-6 OKEKE, Tobenna 2-1 2.5 - - - 1.0-11 - - 0.5-0 - - - 1.0-6 - OTUKOLO, Nela 1-1 1.5 DNP 1.0-2 - - - - 0.5-1 - - - - DNP MADSEN, Nathan 1-1 1.5 - 1.0-8 ------0.5-3 BROWN, Stratton 1-0 1.0 ------1.0-9 - FORRESTER, M. 0-2 1.0 - DNP - 0.5-3 ------0.5-3 KRISTOFORS, Nick 1-0 1.0 - - - - - 1.0-15 ------GREEN, Justin 1-0 1.0 - 1.0-1 ------BAILEY, James 0-1 0.5 - - - 0.5-3 ------ LONG PLAYS (20 OR MORE YARDS) GAME-OPENING DRIVES FS Long Plays Opponent Long Plays [---Fresno State---] [------Opponent ------] Rush Pass Total Rush Pass Total Opponent Pts. 1st Dwns Yds. Pts. 1st Dwns Yds Nebraska 0 2 2 1 2 3 Nebraska 0 3 46 0 0 7 Sacramento St. 0 3 3 0 1 1 Sacramento State 0 0 5 0 0 5 Toledo 0 0 9 0 1 3 Toledo 1 3 4 1 6 7 Tulsa 7 1 44 0 0 -7 Tulsa 1 4 5 1 4 5 UNLV 0 2 34 0 2 37 UNLV 0 3 3 3 2 5 Nevada 3 3 59 0 1 21 Nevada 2 3 5 0 2 2 SDSU 0 0 3 0 5 75 SDSU 1 2 3 1 0 1 Utah State 0 0 2 7 3 60 Utah State 1 1 2 1 4 5 Air Force 0 0 7 0 3 45 Air Force 0 6 6 3 2 5 Colorado State 0 0 8 0 3 65 Colorado State 1 2 3 1 2 3 Hawai’i 0 0 4 0 0 -5 Hawai’i 0 0 0 0 3 3 San Jose State 0 2 89 0 3 34 San Jose State 1 2 3 2 0 2 Totals 8 31 39 14 28 42 SECOND HALF-OPENING DRIVES [---Fresno State---] [------Opponent ------] DRIVE SUPERLATIVES Opponent Pts. 1st Dwns Yds. Pts. 1st Dwns Yds Fresno State Opponent Nebraska 0 0 1 7 3 57 Most Yards (Result) 86 (TD) - Utah St. 90 (TD) - UNLV Sacramento State 0 0 1 0 0 8 Toledo 0 0 -14 7 3 53 Most Plays (Result) 18 (FG) - Utah St. 16 x2 (FG x2) - Tul/AFA Tulsa 3 4 67 7 4 65 Most Time (Result) 8:13 (TD) - Nevada 8:22 (TD) - CSU UNLV 3 2 52 0 0 4 Nevada 0 3 35 0 1 12 SDSU 3 3 54 0 3 40 FRESNO STATE POINTS OFF TURNOVERS Utah State 3 5 65 7 3 75 Air Force 0 1 14 3 6 64 Game TOs Gained TDs FG Pts FS (Fumbles Lost/INT) Colorado State 0 0 6 7 4 60 Nebraska 0 0 0 0 2 (2 INT) Hawai’i 0 3 35 0 0 0 Sacramento St. 2 (2 INT) 2 0 14 2 (1 FL/1 INT) San Jose State 0 0 3 3 4 59 Toledo 0 0 0 0 0 Tulsa 2 (1 INT. 1 FR) 1 0 7 2 (1 FL/1 INT) UNLV 0 0 0 0 1 (1 INT) PENALTY NUMBERS Nevada 1 (FR) 0 1 3 2 (2 FL) SDSU 0 0 0 0 3 (3 INT) FS Pen.-Yds. Opp. Pen.-Yds Nebraska 6-29 7-80 Utah State 0 0 0 0 0 Sacramento State 6-55 3-15 Air Force 1 (FR) 1 0 7 4 (4 INT) Toledo 12-138 6-45 Colorado State 0 0 0 0 1 (1 INT) Tulsa 5-40. 8-71 Hawai’i 1 (INT) 0 0 0 0 UNLV 6-50 4-45 San Jose State 2 (1 INT, 1 FR) 1 0 7 1 (1 FL) Nevada 5-57 3-35 SDSU 5-36 6-65 Totals 7 (4 INT, 3 FR) 5 1 38 18 (13 INT/5 FL) Utah State 10-80 5-40 Opponents 18 (13 INT/5 FR) 4 3 37 Air Force 8-55 6-47 Colorado State 4-35 7-82 Hawai’i 7-64 11-89 San Jose State 2-30 3-12 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 65 2016 YEAR IN REVIEW 2016 FRESNO STATE STATISTICS FRESNO STATE LONG PLAYS OPPONENT LONG PLAYS Yards Opponent Play Result Yards Opponent Play Result 85 Toledo Virgil pass to Jordan TD 91 UNLV Sneed run TD 80 UNLV Virgil pass to Peck TD 62 Toledo Julian pass to Yousey TD 65 Tulsa Virgil pass to Jordan TD 61 UNLV Sneed pass to Trosclair TD 59 Tulsa O’Neal kickoff return 1st-10 57 NEB Armstrong, Jr. pass to Moore TD 58 Air Force Virgil pass to Jordan 1st-10 53 Hawai’i Brown pass to Camanse-Stevens 1st-10 53 SJSU Kline pass to Johnson 1st-10 47 Toledo Woodside pass to Thompson 1st-Goal 52 UNLV Virgil pass to Peck 1st-10 45 Nevada Stewert to Demps 1st-10 52 Air Force Virgil pass to Johnson TD 44 SAC Ketteringham pass to Demps 1st-10 49 SDSU Virgil pass to Jordan 1st-10 44 CSU Stevens pass to Ruiz 1st-10 48 CSU Kline pass to Jordan 1st-10 42 UNLV Williams rush 1st-10 44 Tulsa Jordan rush TD 40 Tulsa Evans pass to Lucas TD 38 UNLV Virgil pass to Peck 1st-10 40 Tulsa Evans pass to Lucas TD 37 Tulsa O’Neal kickoff return 1st-10 39 UNLV Williams rush 1st-Goal 36 Air Force Virgil pass to Johnson TD 36 Toledo Woodside pass to Thompson TD 34 Tulsa Virgil pass to Jordan 1st-Goal 36 UNLV Sneed pass to Boyd 1st-10 34 Nevada James rush 1st-10 36 Nevada Celis pass to Demps TD 33 Toledo Glass punt return 1st-10 33 Toledo Woodside pass to Roberts 1st-10 33 Nevada Virgil pass to Johnson 1st-Goal 33 Air Force Romine pass to Cleveland TD 32 NEB Kline pass to Peck 1st-10 31 Toledo Woodside pass to Phillips 1st-10 32 SJSU Kline rush TD 31 Tulsa Flanders rush 1st-10 31 SAC Virgil pass to Olsen 3rd-5 31 Air Force Romine pass to Robinette 1st-10 29 Air Force Virgil pass to Jordan 1st-10 30 CSU Stevens pass to Gallup 1st-10 28 SDSU Virgil rush 1st-10 28 Toledo Woodside pass to Jones 1st-10 26 SAC Virgil pass to Jordan 1st-10 28 Utah St. Myers pass to Houston 1st-10 26 Tulsa Virgil pass to Jordan 1st-10 28 Utah St. Myers pass to Roberts 1st-Goal 25 NEB Kline pass to Peck 1st-10 28 CSU Kinsey rush 1st-10 25 Nevada Virgil pass to Jordan 1st-10 28 SJSU Potter rush 1st-10 25 CSU Kline pass to Johnson 1st-10 26 Air Force Davern rush 1st-10 25 SJSU Kline pass to Peck 1st-10 25 Utah St. Myers pass to Tarver TD 24 SAC Virgil pass to Johnson 1st-10 24 NEB Moore rush 1st-10 24 Nevada James run (fumble) turnover 24 Tulsa Evans pass to Atkinson TD 23 Toledo Virgil pass to Peck 1st-10 23 NEB Armstrong, Jr. pass to Moore 1st-10 23 Nevada Virgil pass to Hardaway 1st-10 23 Tulsa Evans pass to Hobbs TD 22 Toledo Virgil rush 1st-Goal 23 Air Force Worthman rush 1st-10 22 SDSU Virgil pass to Johnson 1st-10 23 SJSU Cooper rush 1st-10 22 Utah St. Virgil pass to Hardaway 1st-10 22 SDSU Pumphrey run 1st-10 21 Tulsa Virgil pass to Peck 1st-10 22 Hawai’i Brown pass to Ursua 1st-10 21 CSU Ogelsby rush 1st-10 21 Utah St. Myers pass to Roberts TD 21 Air Force Virgil pass to Jordan 1st-10 21 Hawai’i Brown pass to Ursua 1st-10 20 Toledo Virgil pass to Peck 1st-10 20 Toledo Thompkins rush 1st-Goal 20 Air Force Virgil pass to Hardaway 1st-10 20 Utah St. Lindsey rush 1st-10 20 Utah St. James rush 1st-10 20 Air Force Cleveland rush 1st-Goal Only KO returns of 35 yards or more or INT & PR of 25 yards or more are included Only KO returns of 35 yards or more or INT & PR of 25 yards or more are included 66 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW The Automated ScoreBook Fresno State Team Game-by-Game (as of May 17, 2017) All games TEAM STATISTICS Rushing Receiving Passing Kick Returns Punt Returns tot Date Opponent no. yds td lg no. yds td lg cmp-att-int yds td lg no. yds td lg no. yds td lg off Sep 03 at Nebraska 26 31 0 19 24 243 1 32 24-43-2 243 1 32 5 102 0 32 2 17 0 15 274 Sep 10 SACRAMENTO STATE 43 200 2 19 22 274 2 31 22-42-1 274 2 31 0 0 0 0 6 19 0 10 474 09/17/16 at TOLEDO 27 51 0 22 13 203 2 85 13-26-0 203 2 85 7 133 0 33 2 34 0 33 254 Sep 24 TULSA 44 177 4 14 21 276 1 65 21-45-1 276 1 65 5 165 0 59 3 37 0 24 453 Oct 01 at UNLV 32 64 0 19 16 296 2 80 16-45-1 296 2 80 6 124 0 28 3 15 0 11 360 Oct 08 at Nevada 48 255 1 34 16 197 1 33 16-28-0 197 1 33 0 0 0 0 0 0 0 0 452 Oct 14 SAN DIEGO STATE 24 78 0 28 16 139 0 49 16-27-3 139 0 49 4 91 0 27 0 0 0 0 217 Oct 22 at Utah State 39 114 1 20 27 205 1 22 27-44-0 205 1 22 4 69 0 22 0 0 0 0 319 Oct 28 AIR FORCE 30 37 0 14 19 312 3 58 19-38-4 312 3 58 6 113 0 29 2 1 0 1 349 Nov 05 at Colorado State 34 77 0 21 12 155 0 48 12-25-1 155 0 48 1 19 0 19 1 10 0 10 232 Nov 19 HAWAI'I 52 214 1 18 13 108 0 18 13-23-0 108 0 18 2 42 0 24 3 9 0 8 322 Nov 26 SAN JOSE STATE 41 96 2 32 11 149 0 53 11-19-0 149 0 53 1 19 0 19 2 17 0 10 245 Fresno State 440 1394 11 34 210 2557 13 85 210-405-13 2557 13 85 41 877 0 59 24 159 0 33 3951 Opponents 601 2972 25 91 159 2009 21 62 159-270-5 2009 21 62 34 603 0 32 10 52 1 3 4981 Games: 12 Avg/rush: 3.2 Avg/catch: 12.2 Pass effic: 109.06 KR avg: 21.4 PR avg: 6.6 All purpose avg/game: 415.6 Total offense avg/gm: 329.2 Tackles Sacks Fumble Pass Defense blkd PAT Attempts off Date Opponent ua a total tfl-yds no-yds ff fr-yds int-yds qbh brup kick kick rush rcv saf t/o pts Sep 03 at Nebraska 29 42 71 1.0-7 0.0-0 0 0-0 0-0 0 2 1 1-1 0 0 0 0 10 Sep 10 SACRAMENTO STATE 41 6 47 5.0-15 3.0-11 0 0-0 2-0 0 2 0 4-4 0 0 0 14 31 09/17/1 at TOLEDO 44 40 84 6.0-12 0.0-0 0 0-0 0-0 2 5 0 2-2 0 0 0 0 17 Sep 24 TULSA 83 8 91 9.0-43 4.0-34 2 1-0 1-0 0 4 0 5-5 0 0 0 7 41 Oct 01 at UNLV 42 28 70 5.0-11 0.0-0 0 0-0 0-0 0 5 1 2-2 0 0 0 0 20 Oct 08 at Nevada 42 34 76 2.0-17 1.0-15 1 1-0 0-0 0 2 0 1-1 0 0 0 3 22 Oct 14 SAN DIEGO STATE 33 70 103 6.0-7 1.0-1 1 0-0 0-0 1 3 0 0-0 0 0 0 0 3 Oct 22 at Utah State 24 52 76 3.0-6 0.0-0 0 0-0 0-0 3 3 0 2-2 0 0 0 0 20 Oct 28 AIR FORCE 45 64 109 5.0-17 1.0-6 1 1-0 0-0 0 1 0 3-3 0 0 0 7 21 Nov 05 at Colorado State 40 46 86 4.0-8 0.0-0 0 0-0 0-0 2 1 0 0-0 0 0 0 0 0 Nov 19 HAWAI'I 32 16 48 5.0-27 2.0-15 0 0-0 1-0 0 4 0 1-1 0 0 0 0 13 Nov 26 SAN JOSE STATE 41 42 83 5.0-20 2.0-12 1 1-0 1-0 0 3 0 2-2 0 0 0 7 14 Fresno State 496 448 944 56.0-190 14.0-94 6 4-0 5-0 8 35 2 23-23 0 0 0 38 212 Opponents 460 358 818 86.0-305 31.0-186 6 5-0 13-164 21 47 3 45-47 1 0 0 37 371 Punting Field Goals Kickoffs Date Opponent no. yds avg long blkd tb fc 50+ i20 md-att long blkd no. yds avg tb ob Sep 03 at Nebraska 6 210 35.0 48 0 1 1 0 1 1-2 26 0 2 130 65.0 1 0 Sep 10 SACRAMENTO STATE 8 286 35.8 59 0 0 2 2 6 1-1 21 0 6 386 64.3 3 0 09/17/1 at TOLEDO 12 461 38.4 47 0 0 11 0 1 1-1 42 0 4 243 60.8 1 0 Sep 24 TULSA 8 341 42.6 57 0 0 6 1 3 2-2 25 0 8 484 60.5 1 1 Oct 01 at UNLV 8 334 41.8 54 0 1 4 1 0 2-2 47 0 5 307 61.4 0 1 Oct 08 at Nevada 2 73 36.5 43 0 0 2 0 2 3-3 44 0 6 384 64.0 4 0 Oct 14 SAN DIEGO STATE 5 197 39.4 43 0 0 4 0 1 1-1 39 0 2 122 61.0 0 0 Oct 22 at Utah State 6 168 28.0 51 1 0 3 1 0 2-2 49 0 5 301 60.2 2 0 Oct 28 AIR FORCE 3 112 37.3 45 0 0 2 0 1 0-0 0 0 4 240 60.0 0 0 Nov 05 at Colorado State 7 253 36.1 43 0 0 4 0 1 0-0 0 0 1 65 65.0 0 0 Nov 19 HAWAI'I 8 334 41.8 51 0 0 6 1 3 2-3 47 1 4 216 54.0 0 1 Nov 26 SAN JOSE STATE 7 221 31.6 50 1 0 3 1 1 0-0 0 0 3 185 61.7 0 0 Fresno State 80 2990 37.4 59 2 2 48 7 20 15-17 49 1 50 3063 61.3 12 3 Opponents 68 2574 37.9 57 2 2 24 6 23 12-16 47 0 70 4340 62.0 27 2 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 67 2016 YEAR IN REVIEW The Automated ScoreBook Fresno State Opponent Game-by-Game (as of May 17, 2017) All games OPPONENT STATISTICS Rushing Receiving Passing Kick Returns Punt Returns tot Date Opponent no. yds td lg no. yds td lg cmp-att-int yds td lg no. yds td lg no. yds td lg off Sep 03 at Nebraska 51 292 5 24 6 114 1 57 6-13-0 114 1 57 1 32 0 32 0 0 0 0 406 Sep 10 SACRAMENTO STATE 33 96 0 14 9 89 0 44 9-25-2 89 0 44 3 43 0 16 1 0 0 0 185 09/17/16 at TOLEDO 55 318 2 20 16 301 5 62 16-28-0 301 5 62 3 27 0 21 0 0 0 0 619 Sep 24 TULSA 66 336 2 31 24 281 4 40 24-34-1 281 4 40 6 98 0 25 1 -1 0 0 617 Oct 01 at UNLV 54 364 5 91 8 129 1 61 8-16-0 129 1 61 4 86 0 31 1 1 0 0 493 Oct 08 at Nevada 49 226 1 17 14 163 3 45 14-23-0 163 3 45 2 34 0 18 0 0 0 0 389 Oct 14 SAN DIEGO STATE 61 292 2 22 7 72 0 14 7-12-0 72 0 14 2 41 0 25 1 0 0 0 364 Oct 22 at Utah State 40 204 1 20 17 188 3 28 17-29-0 188 3 28 3 47 0 20 2 23 1 3 392 Oct 28 AIR FORCE 73 327 2 26 5 97 1 33 5-9-0 97 1 33 4 69 0 20 1 -1 0 0 424 Nov 05 at Colorado State 48 257 3 28 18 237 2 44 18-25-0 237 2 44 1 23 0 23 1 0 0 0 494 Nov 19 HAWAI'I 23 49 2 10 20 227 0 53 20-31-1 227 0 53 2 40 0 21 0 0 0 0 276 Nov 26 SAN JOSE STATE 48 211 0 28 15 111 1 14 15-25-1 111 1 14 3 63 0 25 2 30 0 0 322 Opponents 601 2972 25 91 159 2009 21 62 159-270-5 2009 21 62 34 603 0 32 10 52 1 3 4981 Fresno State 440 1394 11 34 210 2557 13 85 210-405-13 2557 13 85 41 877 0 59 24 159 0 33 3951 Games: 12 Avg/rush: 4.9 Avg/catch: 12.6 Pass effic: 143.35 KR avg: 17.7 PR avg: 5.2 All purpose avg/game: 483.3 Total offense avg/gm: 415.1 Tackles Sacks Fumble Pass Defense blkd PAT Attempts off Date Opponent ua a total tfl-yds no-yds ff fr-yds int-yds qbh brup kick kick rush rcv saf t/o pts Sep 03 at Nebraska 39 26 65 7.0-27 4.0-21 0 0-0 2-8 5 3 0 5-5 1 0 0 7 43 Sep 10 SACRAMENTO STATE 51 20 71 8.0-28 2.0-19 0 1-0 1--1 1 2 0 0-0 0 0 0 3 3 09/17/1 at TOLEDO 30 28 58 11.0-54 5.0-35 0 0-0 0-0 6 2 0 7-7 0 0 0 0 52 Sep 24 TULSA 59 4 63 9.0-20 2.0-9 2 1-0 1-0 0 10 0 6-6 0 0 0 0 48 Oct 01 at UNLV 35 36 71 4.0-27 2.0-20 0 0-0 1-59 0 5 0 6-6 0 0 0 0 45 Oct 08 at Nevada 43 36 79 3.0-7 1.0-4 2 2-0 0-0 0 4 0 3-4 0 0 0 7 27 Oct 14 SAN DIEGO STATE 21 40 61 4.0-14 2.0-12 0 0-0 3-20 0 3 0 2-2 0 0 0 3 17 Oct 22 at Utah State 27 64 91 2.0-9 1.0-6 0 0-0 0-0 2 4 1 5-5 0 0 0 0 38 Oct 28 AIR FORCE 36 32 68 8.0-24 2.0-11 0 0-0 4-65 1 8 0 4-4 0 0 0 14 31 Nov 05 at Colorado State 30 30 60 10.0-36 5.0-26 1 0-0 1-13 6 3 0 4-5 0 0 0 0 37 Nov 19 HAWAI'I 56 18 74 6.0-18 1.0-6 0 0-0 0-0 0 0 1 2-2 0 0 0 0 14 Nov 26 SAN JOSE STATE 33 24 57 14.0-41 4.0-17 1 1-0 0-0 0 3 1 1-1 0 0 0 3 16 Opponents 460 358 818 86.0-305 31.0-186 6 5-0 13-164 21 47 3 45-47 1 0 0 37 371 Fresno State 496 448 944 56.0-190 14.0-94 6 4-0 5-0 8 35 2 23-23 0 0 0 38 212 Punting Field Goals Kickoffs Date Opponent no. yds avg long blkd tb fc 50+ i20 md-att long blkd no. yds avg tb ob Sep 03 at Nebraska 5 145 29.0 43 1 0 2 0 0 0-0 0 0 7 444 63.4 2 0 Sep 10 SACRAMENTO STATE 13 483 37.2 49 0 0 2 0 1 1-1 44 0 1 65 65.0 1 0 09/17/1at TOLEDO 519939.84901002 1-2220954560.611 Sep 24 TULSA 7 292 41.7 53 0 0 2 1 1 2-3 37 0 8 493 61.6 3 0 Oct 01at UNLV 727539.35211112 1-1380850463.020 Oct 08 at Nevada 3 114 38.0 43 0 0 1 0 1 0-1 0 0 5 314 62.8 4 1 Oct 14SAN DIEGO STATE414536.25700213 1-1470425664.000 Oct 22 at Utah State 4 131 32.8 38 0 0 4 0 2 1-1 43 0 7 429 61.3 3 0 Oct 28AIR FORCE 411729.23900102 1-2270633155.200 Nov 05 at Colorado State 3 130 43.3 48 0 0 2 0 2 1-1 33 0 7 455 65.0 6 0 Nov 19HAWAI'I 834042.55000513 0-000318060.010 Nov 26 SAN JOSE STATE 5 203 40.6 57 0 0 2 2 4 3-3 28 0 5 324 64.8 4 0 Opponents 68 2574 37.9 57 2 2 24 6 23 12-16 47 0 70 4340 62.0 27 2 Fresno State 80 2990 37.4 59 2 2 48 7 20 15-17 49 1 50 3063 61.3 12 3 68 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW 2016 FRESNO STATE PARTICIPATION # Name GP/GS # Name GP/GS # Name GP/GS 79 AIBUEDEFE, Nick ...... 4/- 62 HUGHES, Logan ...... 11/6 22 SOECHTING, T...... 12/- 13 ALLEN, Justin ...... 11/- 28 JAMES, Dontel ...... 11/10 73 ST. ANDREW, M...... 12/12 51 ALLISON, J...... 12/- 3 JOHNSON, KeeSean ...... 12/12 32 STANLEY, Robert ...... 10/9 36 ALVAREZ, Ryan ...... 3/- 5 JONES, Dalen ...... 9/- 88 TANGIPA, David ...... 10/- 7 BAILEY, James ...... 12/12 1 JORDAN, Jamire ...... 12/9 17 VAIMILI, Austin ...... 10/- 4 BELL, Mike ...... 12/1 6 KELLY, Tank ...... 7/1 49 VAN VALKENBURG ...... 9/- 94 BELONY, Patrick ...... 12/1 70 KINNINGER, Zack ...... 2/- 44 VAN HOOK, S...... 7/- 15 BROWN, Stratton ...... 12/12 10 KLINE, Zach ...... 7/2 75 VAZQUEZ, Jacob ...... 10/7 38 BRYANT, Jaron ...... 11/- 99 KRISTOFORS, Nick ...... 12/12 57 VERRELL, Justin...... 12/- 3 CAMACHO, Jimmy ...... 8/- 48 KROENING, Kody ...... 11/- 5 VIRGIL, Chason ...... 10/10 42 CAMILLI, Jeff ...... 11/11 91 MADSEN, Nathan ...... 12/11 20 WRIGHT, Alan ...... 12/- 55 CARTER, Jaleel ...... 1/- 87 MARTENS, Michae ...... 10/- 58 CRONK, C...... 12/12 92 MCBEE, Wyatt ...... 7/1 47 CUSICK, Blake ...... 12/- 27 MILTON, KaLonn ...... 1/- 19 DALENA, Frank ...... 6/- 77 MITCHELL, Aaron ...... 12/12 2 ELLIS, Jamal ...... 12/12 11 O’NEAL, Dejonte ...... 4/- 4 FINCH, Jackson ...... 1/- 23 OGLESBY, Bryson ...... 1/- 97 FORRESTER, M...... 11/11 56 OKEKE, Tobenna ...... 12/7 18 FUERY, Darrell ...... 10/- 46 OLSEN, Chad ...... 5/4 25 GLASS, Tyquwan ...... 11/11 10 OTUKOLO, Nela ...... 10/4 40 GREEN, Justin ...... 12/- 78 PATTERSON, D...... 12/12 29 GREEN, Treyvon ...... 11/- 7 PECK, Aaron ...... 11/10 6 HARDAWAY, Delvon ...... 10/2 58 PIPER, Elijah ...... 9/- 93 HAYNES, Jasad ...... 5/- 74 POPOLIZIO, Ryan ...... 9/- 34 HELMUTH, George ...... 12/- 11 POTTS, DeShawn ...... 12/11 86 HENDRICKSON, K...... 9/- 16 RICE, Jared ...... 11/- 33 HOKIT, Josh ...... 12/2 22 RICE, Justin ...... 6/1 19 HUGHES, Brandon ...... 6/5 89 RIDDERING, Kyle ...... 12/9 23 HUGHES, Juju ...... 12/- 41 SMITH, Jalen ...... 5/- 2016 GAME-BY-GAME OFFENSIVE STARTERS DATE | OPPONENT | LT | LG | C | RG | RT | QB | RB | WR | WR | WR | TE 9/3 at Nebraska Cronk Mitchell Vazquez St. Andrew Patterson Virgil James Peck Johnson Olsen (TE) Riddering 9/10 Sacramento State Cronk Mitchell Vazquez St. Andrew Patterson Virgil James Peck Johnson Olsen (TE) Riddering 9/17 at Tulsa Cronk Mitchell Vazquez St. Andrew Patterson Virgil James Peck Johnson Olsen (TE) Riddering 9/24 Tulsa Cronk Mitchell Vazquez St. Andrew Patterson Virgil James Peck Johnson Jordan Hokit (FB) 10/1 at UNLV* Cronk Vazquez Mitchell St. Andrew Patterson Virgil James Peck Johnson Jordan Olsen 10/8 at Nevada* Cronk Vazquez Mitchell St. Andrew Patterson Virgil James Peck Johnson Jordan Riddering 10/14 San Diego State* Cronk L. Hughes Mitchell St. Andrew Patterson Virgil James Peck Johnson Jordan Riddering 10/22 at Utah State* Cronk L. Hughes Mitchell St. Andrew Patterson Virgil James Hardaway Johnson Jordan Riddering 10/28 Air Force* Cronk L. Hughes Mitchell St. Andrew Patterson Virgil James Hardaway Johnson Jordan Riddering 11/5 at Colorado State* Cronk L. Hughes Mitchell St. Andrew Patterson Virgil Ju. Rice Peck Johnson Jordan Riddering 11/19 Hawai’i* Cronk L. Hughes Mitchell St. Andrew Patterson Kline James Peck Johnson Jordan Riddering 11/26 San Jose State* Cronk Vazquez Mitchell St. Andrew Patterson Kline Hokit Peck Johnson Jordan L. Hughes 2016 GAME-BY-GAME DEFENSIVE STARTERS DATE | OPPONENT | DE | NG | DE | OLB | ILB | ILB | OLB | CB | S | S | CB 9/3 at Nebraska Madsen Forrester Kristofors Bailey Stanley Camilli B. Hughes Ellis Potts Brown Glass 9/10 Sacramento State Madsen Belony Kristofors Bailey Stanley Otukolo B. Hughes Ellis Potts Brown Glass 9/17 at Tulsa Madsen Forrester Kristofors Bailey Stanley Camilli B. Hughes Ellis Potts Brown Glass 9/24 Tulsa Madsen Forrester Kristofors Bailey Stanley Camilli Okeke Ellis Potts Brown Glass 10/1 at UNLV* Madsen Forrester Kristofors Bailey Stanley Camilli B. Hughes Ellis Potts Brown Glass 10/8 at Nevada* Madsen Forrester Kristofors Bailey Otukolo Camilli B. Hughes Ellis Potts Brown Glass 10/14 San Diego State* Madsen Forrester Kristofors Bailey Otukolo Camilli Okeke Ellis Potts Brown Glass 10/22 at Utah State* Madsen Forrester Kristofors Bailey Otukolo Camilli Okeke Ellis Potts Brown Glass 10/28 Air Force* Madsen Forrester Kristofors Bailey Stanley Camilli Okeke Ellis Potts Brown Glass 11/5 at Colorado State* Madsen Forrester Kristofors Bailey Stanley Camilli Okeke Ellis Potts Brown Kelly 11/19 Hawai’i* Madsen Forrester Kristofors Bailey Stanley Camilli Okeke Ellis Potts Brown Glass 11/26 San Jose State* McBee Forrester Kristofors Bailey Stanley Camilli Okeke Ellis Bell Brown Glass 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 69 2016 YEAR IN REVIEW Game #1 Game #2 Nebraska 43, Fresno State 10 Fresno State 31, Sacramento State 3 6HSW0HPRULDO6WDGLXP/LQFROQ1HE$WWHQGDQFH 6HSW%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT FINAL Fresno State 0 10 0 0 - 10 Record (0-1) Sacramento State 0 3 0 0 - 3 Record (0-2) Nebraska 7 7 7 22 - 43 Record (1-0) Fresno State 7 3 0 21 - 31 Record (1-1) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score NEB 1st 00:43 Ozigbo 1 yd run (Brown kick) 13-80 6:25 0-7 FS 1st 01:02 O’NEAL 8 yd run (KROENING kick) 7-48 2:38 0-7 NEB 2nd 12:34 Ozigbo 6 yd run (Brown kick) 4-38 1:27 0-14 )6 QG .52(1,1*\G¿HOGJRDO FS 2nd 05:38 PECK 7 yd pass from VIRGIL (KROENING kick) 7-32 2:37 7-14 6$& QG 'HYRQ0HGHLURV\G¿HOGJRDO )6 QG .52(1,1*\G¿HOGJRDO FS 4th 14:24 JAMES 17 yd run (KROENING kick) 5-64 1:39 3-17 NEB 3rd 09:59 Armstrong 9 yd run (Brown kick) 9-57 4:03 10-21 FS 4th 10:45 JOHNSON 4 yd pass from VIRGIL (KROENING kick) 5-42 1:32 3-24 NEB 4th 14:51 Moore 57 yd pass from Armstrong (Darlington rush) 2-62 0:56 10-28 FS 4th 05:03 JOHNSON11 yd pass from VIRGIL (KROENING kick) 8-51 2:24 3-31 NEB 4th 09:50 Armstrong 4 yd run (Brown kick) 8-63 4:17 10-36 NEB 4th 04:20 Bryant 3 yd run (Lindsay kick) 10-67 4:03 10-43 TEAM STATS Fresno St. Sac State INDIVIDUAL LEADERS First Downs 27 7 Rushing (att-yds-TD): Rushing Att-Yards 43-200 33-96 FS - Dontel James (27-121-1) TEAM STATS Fresno St. Nebraska INDIVIDUAL LEADERS Passing Cmp-Att-Yds 22-42-274 9-25-89 SAC - D. Warren (8-27-0) First Downs 17 20 Rushing (att-yds-TD): Total Plays-Yards 85-474 58-185 Passing (cmp-att-int-yds-TD): Rushing Att-Yards 26-31 51-292 FS - Dontel James (12-20-0) Fumbles-Lost 3-1 1-0 FS - Chason Virgil (22-42-1-274-2) Passing Cmp-Att-Yds 24-43-243 6-13-114 NEB - Devine Ozigbo (17-103-2) Penalties-Yards 6-55 3-15 SAC - N. Ketteringham (9-25-2-89-0) Total Plays-Yards 69-274 64-406 Passing (cmp-att-int-yds-TD): Punts-Yards 8-286 13-483 Receiving Yards (no-yds-TD): Fumbles-Lost 0-0 1-0 FS - Chason Virgil (17-32-1-133-1) Average 35.8 37.2 FS - Jamire Jordan (7-100-0) Penalties-Yards 6-29 7-80 NEB - Tommy Armstrong, Jr. (5-10-0-108-1) Net 35.8 35.7 SAC - Cody Demps (2-50-0) Punts-Yards 6-210 5-145 Receiving Yards (no-yds-TD): Punt Returns (#-Yds-TD) 6-19-0 1-0-0 Defense (ST-AT-TT-TFL-Sack): Average 35.0 29.0 FS - Aaron Peck (9-112-1) Kickoff Returns (#-Yds-TD) 0-0-0 3-43-0 FS - James Bailey (8-0-8-1-0) Net 31.7 25.6 NEB - Alonzo Moore (3-92-1) Interceptions-Yards-TD 2-0-0 1--1-0 SAC - Tyler Meeter (10-3-13-3-0) Punt Returns (#-Yds-TD) 2-17-0 0-0-0 Defense (ST-AT-TT-TFL-Sack): Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Kickoff Returns (#-Yds-TD) 5-102-0 1-32-0 FS - Jeff Camilli (3-7-10-0.0-0.0) Time of Possession 31:50 28:10 FS - Jamel Ellis (1-0-0) Interceptions-Yards-TD 0-0-0 2-8-0 NEB - Kieron Williams (6-4-10-1.0-0.0) 3rd Downs 7-of-17 3-of-16 Tyquwan Glass (1-0-0) Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): 4th Downs 0-of-0 0-of-0 SAC - Nick Crouch (1--1-0) Time of Possession 28:07 31:53 FS - None Sacks By 3-11 2-19 3rd Downs 5-of-14 5-of-11 NEB - Kieron Williams (1-0-0) 4th Downs 1-of-2 1-of-1 Sacks By 0-0 4-21 FRESNO, Calif. – The Fresno State football team used a 21-point fourth quarter in front of an announced crowd of 31,817 at Bulldog Stadium Saturday night to LINCOLN, Neb. - Down two scores in the second separate itself from a pesky Sacramento State Hornets quarter to Nebraska, Fresno State fought back in front squad for a 31-3 win in their 2016 home opener. of 90,013 fans at Memorial Stadium to pull within The Bulldog defense highlighted the game, holding four points heading into halftime at 14-10, but it was Sacramento State to 185 total yards offense, the lowest the Huskers who prevailed 43-10 after the home team output from an opponent since 2008 when Fresno separated itself with 22 points in the fourth quarter. State held New Mexico State to 183. In his return to the Bulldog football team after missing 7KH GHIHQVLYH EDFN¿HOG GXR RI 7\TXZDQ *ODVV DQG the 2015 season to an injury suffered in fall camp, Jamal Ellis each posted interceptions, giving the ‘Dogs Aaron Peck set career highs in receptions and yards, a win in the last nine-straight games when recording catching nine passes for 112 yards and a touchdown. multiple interceptions in a game. The ‘Dogs also recorded three sacks between Justin Green, Nathan Madsen On the defensive side of the ball Jeff Camilli led the and Nela Otukolo while James Bailey led the team with eight tackles. XQLWZLWKKLV¿IWKFDUHHUJDPHFRPSLOLQJGRXEOHGLJLW tackles (10). :LWKKLV¿UVWFDUHHUWRXFKGRZQ'HMRQWH2¶1HDOVWDUWHGWKHVFRULQJ6DWXUGD\ZLWKDQHLJKW\DUG7'LQWKH¿UVW quarter with 1:02 remaining. Those points were produced thanks to Ellis’ interception that set the ‘Dogs up in ,QWKH¿UVWTXDUWHUWKH%XOOGRJVVWDUWLQJTXDUWHUEDFN&KDVRQ9LUJLOFRPSOHWHGKLV¿UVW¿YHSDVVDWWHPSWVRQ Hornets territory at the 48-yard line. the Bulldogs’ opening possession, until missing the sixth on a third-and-3 from the Nebraska 15-yard line. Kody Kroening missed the ensuing 32-yard attempt and the Huskers grabbed the games momentum back. After that Ellis interception the defense forced four-straight three-and-outs, of the eight amassed on the night. In WKDWVSDQWKHµ'RJVWDFNHGRQWKUHHPRUHSRLQWVDIWHU.RG\.URHQLQJNQRFNHGKRPHD\DUG¿HOGJRDOGXULQJ Nebraska drove the ball 80 yards on 13 plays to open the scoring, 7-0, following the ‘Dogs miss at getting the the second quarter. As time expired on the half, the Hornets scored three points with a 44-yard kick, which was JDPHV¿UVWSRLQWV$IWHUDWKUHHDQGRXWE\WKH%XOOGRJVRQWKHQH[WSRVVHVVLRQWKH&RUQKXVNHUVJDYHWKHEDOO set up by a line drive punt that bounced off a Bulldog and was recovered by Sacramento State defender on the to Devin Ozigbo four straight times as he put them up 14-0 early in the second quarter. In back-to-back drives, Fresno State 27-yard line with six seconds left on the clock. the Cornhuskers rushed 16 times in their 17 plays that totaled 107 yards. Neither team was able to put points on the board in the third. A period the ‘Dogs outgained the Hornets 106 Fresno State turned the tide when linebacker Robert Stanley shot through a gap on special teams and blocked to 39. a Cornhusker punt. The play ignited the Bulldog offense, earning points off the block by going seven plays for \DUGVFDSSHGE\D9LUJLOWR3HFN\DUG7'9LUJLOFRQQHFWHGRQ¿YHRIVL[DWWHPSWVRQWKHVFRULQJGULYH ,W ZDV WKH IRXUWK ZKHQ WKH %XOOGRJV EURNH WKURXJK DQG SXW WKH JDPH DZD\ VFRULQJ RQ WKHLU ¿QDO WKUHH possessions. :LWKXQGHUIRXUPLQXWHVUHPDLQLQJLQWKH¿UVWKDOIDQGWKH%XOOGRJVEDFNHGXSDJDLQVWWKHLURZQHQG]RQH a late hit to Virgil by Nebraska’s Luke Gifford on a third-and-13, which was eventually called a targeting Dontel James crossed the plane on a 17-yard run for a touchdown with 14:24 left in the fourth to put the SHQDOW\H[WHQGHGWKH%XOOGRJV¶GULYH=DFK.OLQHHQWHUHGWKHJDPHIRU9LUJLODQGGURYHWKHEDOOGRZQ¿HOG Bulldogs on top 17-3. That run put James over the 100-yard threshold on a night he posted 121 on the ground without a hiccup, going 4-of-5 for 50 yards. He led the ‘Dogs as far as the Nebraska 8-yard-line with 0:02 left – the most by a Fresno State running back since Marteze Waller opened the 2015 season with 154 against LQWKHKDOI.URHQLQJNQRFNHGKRPHD\DUG¿HOGJRDOWROHDYH)UHVQR6WDWHWUDLOLQJDVWLPHH[SLUHG Abilene Christian. In the second half the Bulldogs’ offense posted 128 total yards of their 274 compiled in the game and could not Back-to-back touchdown connections between Chason Virgil and KeeSean Johnson followed the James score, ¿QGWKHHQG]RQHZKLOH1HEUDVNDDPDVVHGWRWDO\DUGVLQWKHVHFRQGKDOIWKDWOHGWRSRLQWV which put a stamp on the Bulldogs’ win. Entering the game, Johnson owned two career TDs before the two scores in the fourth. Quotable +HDG&RDFK7LP'H5X\WHURQWKH¿QDOVFRUH 9LUJLO¿QLVKHGWKHJDPHRIIRU\DUGVDQGWZRVFRUHV7KHUHGVKLUWIUHVKPDQTXDUWHUEDFNVHWFDUHHU ³ Game #3 Game #4 Toledo 52, Fresno State 17 Tulsa 48, Fresno State 41 6HSW*ODVV%RZO7ROHGR2KLR$WWHQGDQFH 6HSW%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT OT2 FINAL Fresno State 0 0 7 10 - 17 Record (1-2) Tulsa 0 21 7 13 0 7 48 Record (3-1) Toledo 14 10 14 14 - 52 Record (3-0) Fresno State 21 10 3 7 0 0 41 Record (1-3) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score TOL 1st 09:45 THOMPSON 36 yd pass from WOODSIDE (VEST kick) 4-64 1:41 0-7 FS 1st 13:24 JORDAN 44 yd run (KROENING kick) 1-44 0:10 0-7 TOL 1st 05:36 ROBERTS 9 yd pass from WOODSIDE (VEST kick) 6-60 2:32 0-14 FS 1st 09:47 VIRGIL 14 yd run (KROENING kick) 4-23 0:52 0-14 TOL 2nd 13:40 HUNT 7 yd run (VEST kick) 7-55 2:48 0-21 FS 1st 04:01 JAMES 2 yd run (KROENING kick) 11-69 4:48 0-21 72/ QG 9(67\G¿HOGJRDO )6 QG .52(1,1*\G¿HOGJRDO TOL 3rd 10:36 JOHNSON 18 yd pass from WOODSIDE (VEST kick) 7-53 2:54 0-31 FS 2nd 10:16 JORDAN 65 yd pass from VIRGIL (KROENING kick) 1-65 1:19 0-31 TOL 3rd 05:37 ROBERTS 6 yd pass from WOODSIDE (VEST kick) 8-69 3:27 0-38 TLS 2nd 08:52 HOBBS 23 yd pass from EVANS (JONES kick) 6-68 1:14 7-31 FS 3rd 02:02 JOHNSON 9 yd pass from VIRGIL (KROENING kick) 7-66 3:27 7-38 TLS 2nd 06:48 LUCAS 40 yd pass from EVANS (JONES kick) 6-71 1:07 14-31 )6 WK .52(1,1*\G¿HOGJRDO TLS 2nd 04:19 LUCAS 40 yd pass from EVANS (JONES kick) 5-60 1:35 21-31 TOL 4th 12:06 THOMPKINS 1 yd run (VEST kick) 7-75 2:45 10-45 )6 UG .52(1,1*\G¿HOGJRDO FS 4th 06:41 JORDAN 85 yd pass from VIRGIL (KROENING kick) 1-85 0:10 17-45 TLS 3rd 04:59 ATKINSON 24 yd pass from EVANS (JONES kick) 9-65 3:13 28-34 TOL 4th 04:03 YOUSEY 62 yd pass from JULIAN (VEST kick) 5-82 2:34 17-52 TLS 4th 13:38 FLANDERS 2 yd run (JONES kick) 11-88 2:14 35-34 7/6 WK -21(6\G¿HOGJRDO TEAM STATS Fresno St. Toledo INDIVIDUAL LEADERS FS 4th 05:02 VIRGIL 1 yd run (VAN VALKENBURG kick) 8-59 3:11 38-41 First Downs 7 27 Rushing (att-yds-TD): 7/6 WK -21(6\G¿HOGJRDO Rushing Att-Yards 27-51 55-318 FS - Dontel James (13-40-0) TLS OT 15:00 EVANS 18 yd run (JONES kick) 3-25 0:00 48-41 Passing Cmp-Att-Yds 13-26-203 15-28-301 TOL - Kareem Hunt (19-123-1) Total Plays-Yards 53-254 83-619 Passing (cmp-att-int-yds-TD): Fumbles-Lost 0-0 0-0 FS - Chason Virgil (12-23-0-190-2) TEAM STATS Tulsa Fresno St. INDIVIDUAL LEADERS Penalties-Yards 12-138 6-45 TOL - Logan Woodside (15-26-0-239-4) First Downs 34 20 Rushing (att-yds-TD): Punts-Yards 12-461 5-199 Receiving Yards (no-yds-TD): Rushing Att-Yards 68-344 44-177 TLS - D’Angelo Brewer (46-252-0) Average 38.4 39.8 FS - KeeSean Johnson (4-51-1) Passing Cmp-Att-Yds 22-32-273 21-45-276 FS - Dontel James (21-65-1) Net 38.4 29.0 TOL - Cody Thompson (4-102-1) Total Plays-Yards 100-617 89-453 Passing (cmp-att-int-yds-TD): Punt Returns (#-Yds-TD) 2-34-0 0-0-0 Defense (ST-AT-TT-TFL-Sack): Fumbles-Lost 2-1 2-1 TLS - Dane Evans (22-32-1-273-4) Kickoff Returns (#-Yds-TD) 7-133-0 3-27-0 FS - Stratton Brown (6-4-10-1.5-0.0) Penalties-Yards 8-71 5-40 FS - Chason Virgil (21-45-1-276-1) Interceptions-Yards-TD 0-0-0 0-0-0 TOL - Treyvon Hester (3-2-5-2.5-2.0) Punts-Yards 7-292 8-341 Receiving Yards (no-yds-TD): Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Average 41.7 42.6 TLS - Josh Atkinson (10-107-1) Time of Possession 23:44 36:16 FS - None Net 36.4 42.8 FS - Jamire Jordan (6-108-1) 3rd Downs 0-of-13 8-of-15 TOL - None Punt Returns (#-Yds-TD) 1--1-0 3-37-0 Defense (ST-AT-TT-TFL-Sack): 4th Downs 0-of-0 0-of-0 Kickoff Returns (#-Yds-TD) 6-98-0 5-165-0 TLS - Craig Suits (9-1-10-1.5-0) Sacks By 0-0 5-35 Interceptions-Yards-TD 1-0-0 1-0-0 FS - Jeff Camilli (14-1-15-2.0-2.0) Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Time of Possession 27:07 32:53 TLS - Jeremy Brady (1-0-0) TOLEDO, Ohio ± ,Q LWV ¿UVW WULS WR WKH *ODVV 3rd Downs 7-of-19 8-of-21 FS - Jamal Ellis (1-0-0) Bowl since 2008, Fresno State was unable to recreate 4th Downs 2-of-2 2-of-3 the magic from that day as the Bulldogs fell 52-17 on Sacks By 2-9 4-34 Saturday afternoon. FRESNO, Calif. – On a sunny Saturday afternoon $IWHUKROGLQJWKH5RFNHWVRQWKHLU¿UVWSRVVHVVLRQRI at Bulldog Stadium, the Fresno State football team WKHJDPH7ROHGRVFRUHGRQIRXURILWVQH[W¿YHGULYHV raced out to a 31-0 lead over the Tulsa Golden ZKLOH WKH %XOOGRJV¶ RIIHQVH VWUXJJOHG WR ¿QG WKHLU +XUULFDQHLQWKH¿UVWKDOIRQO\WRVHHLWHYDSRUDWHLQD 48-41 defeat in double overtime. stride. In the second period of extra time after neither team Toledo held a 24-0 advantage at the half and outgained VFRUHGLQWKH¿UVW7XOVD¶V'DQH(YDQVVFRUHGIURP yards out, but the Bulldogs had their chance to push Fresno State 267-73 in that span. LW WR D WKLUG$Q LQFRPSOHWH SDVV RQ ¿UVW GRZQ ZDV followed with a sack that dropped the ‘Dogs to a third- 7KLUG GRZQ HI¿FLHQF\ ZDV WKH URRW RI WKH %XOOGRJV and-17, which was followed by a failed fourth-and-17 that capped the Golden Hurricane comeback. WU\LQJ¿UVWKDOIDVWKH\ZHQWIRURYHUWKH¿UVWWZRTXDUWHUVDQGIRULQWKHJDPH The game saw 1,070 total yards on 189 total plays, In the second half, Fresno State bounced back with producing 181 yards of offense while scoring 17 points. A but like the score, Tulsa topped Fresno State with 617 large chunk of that yardage came when Chason Virgil connected with Jamire Jordan for an 85-yard touchdown yards offense on 100 plays. down the stretch, which set career long plays for the duo (throw and reception). 1RWWREHORVWWKH%XOOGRJVÀRXULVKHGRIIHQVLYHO\SDUWLFXODUO\LQWKH¿UVWKDOIDVWKH\WRRNDOHDGLQWR halftime. It was the most points scored in an opening half by a Bulldog team since the 2013 team scored 42 at Virgil also linked up with KeeSean Johnson for a 9-yard score, the third time in the last two games those two San Jose State on Nov. 29. have connected for scores. Fresno State took a 21-0 lead to the second quarter after three rushing scores by three different Bulldogs – Jordan (44 yards), Chason Virgil (14 yards) and Dontel James (2 yards). Kody Kroening then capped a nine- Toledo amassed 619 total yards in the game, the most by a Bulldog opponent since Wyoming manufactured SOD\\DUGGULYHZLWKD\DUG¿HOGJRDOLQWRWKHVHFRQGTXDUWHUEHIRUH-RUGDQFDXJKWD\DUGSDVV from Virgil to put the ‘Dogs up 31-0. 694 in 2014. From that point forward, Tulsa began seizing momentum with three-straight touchdown drives (Evans’ passes Key stat of 23, 40 and 40 yards) while the Bulldogs went three-and-out on their next three drives – putting Tulsa behind 31-21 going into the second half. 7ROHGRRXWJDLQHG)UHVQR6WDWHE\\DUGVLQWKH¿UVWKDOIDVLWWRRNDOHDGLQWRWKHORFNHUURRP )UHVQR6WDWHUHVSRQGHGZLWKLWV¿UVWSRVVHVVLRQLQWKHVHFRQGKDOIE\HDWLQJXSPLQXWHVVHFRQGVRIFORFN Quotable RQDSOD\\DUGGULYHWKDWUHVXOWVLQD\DUG.URHQLQJ¿HOGJRDOWRRSHQWKLUGTXDUWHU +HDGFRDFK7LP'H5X\WHU¶VLQLWLDOSRVWJDPHWKRXJKWV« Tulsa countered by outscoring Fresno State 27-7 the rest of the way. The three scores in regulation were drives “We got beat physically. We blew assignments. We got outplayed and outcoached. There’s no excuse for it. of nine, 11, 11 and 16. It’s going to change. We’ve got a bunch of guys who have pride, but we’ve got to play much better than we 'HVSLWHWKH*ROGHQ+XUULFDQHVXFFHVVWKH%XOOGRJVZHUHQRWJRLQJGRZQZLWKRXWD¿JKW7KH¿QDOVHYHQSRLQWV did today.” the Bulldogs would score was a fourth quarter TD that put the ‘Dogs up 41-38 with 5:02 remaining in the game. +HDGFRDFK7LP'H5X\WHU¶VRQZKDWWKHWHDPQHHGVWRKHDUZKHQWKH\UHWXUQWRSUDFWLFH6XQGD\« 7XOVD¶VSOD\GULYHWKDWVHQWWKHJDPHWRRYHUWLPHHQGHGZLWKD\DUG¿HOGJRDORQDGULYHWKDWWKH*ROGHQ Hurricane went 3-of-4 on third downs. “We have to be more physical. That’s the big thing. We did not match their physicality early and late we had some blown coverage’s where it got away from us. But we have to do a much better job being physical.” Quotable +HDG&RDFK7LP'H5X\WHURQORVLQJWKHOHDG« 4XDUWHUEDFN&KDVRQ9LUJLORQWKLUGGRZQHI¿FLHQF\« “We did not have any anticipation that we were going to shut Tulsa out. We kept telling our guys on the sideline, µ+H\WKLVWHDPLVJRLQJWR¿JKWEDFNWKH\DUHJRLQJWRFRXQWHUSXQFK¶7KH\ZHUHDEOHWRUXQWKHEDOOZKLOH ³,WFRPHVEDFNWRXVGRLQJZKDWZHKDYHWRGRRQ¿UVWGRZQDQGVHFRQGGRZQWRSXWRXUVHOYHVLQDPRUH UXQQLQJWKHVDPHSOD\VWKDWZHSUDFWLFHGWKLVZHHNWKHVDPHSOD\VWKDWWKH\UDQWKH¿UVWIRXUVHULHV7KH\ PDQDJHDEOH WKLUG GRZQ (DUO\ RQ ZH ZHUH JHWWLQJ VWXFN LQ ¿UVW DQG ORQJ DQG VHFRQG DQG ORQJ WKDW MXVW executed better than we did. We didn’t tackle very well. We tried to switch the coverage and we had a guy not EHFRPHVWKLUGDQGORQJ:HZHUH¿JKWLQJIURPEHKLQGWKHVWLFNVIURPWKHVWDUW7REHJRRGRQWKLUGGRZQV see it on a fourth down. Again, you make a stop there and they don’t score. There are a half dozen plays that were critical in that ball game that put us into overtime. I don’t want it to sound bad, but we caused a lot of them you have to put yourself in a manageable situations.” DQGWKHUHDUHWKLQJVLQRXUFRQWUROWKDWZHQHHGWR¿[´ Notables Notables -HII&DPLOOLGHÀHFWHGDSDVVDQGPDGHDVDFNWRIRUFHDDQGRXWRQ7XOVD¶VRSHQLQJSRVVHVVLRQ±LQDOOIRXU 6DIHWLHV6WUDWWRQ%URZQ DQG'H6KDZQ3RWWV HDFKFROOHFWHGDFDUHHUKLJKLQWDFNOHV JDPHVWKLVVHDVRQWKHµ'RJVKDYHKHOGWKHLURSSRQHQWVFRUHOHVVRQWKHLURSHQLQJGULYHDQGDOORZHGRQH¿UVW .HH6HDQ-RKQVRQFDXJKWKLVWKLUGWRXFKGRZQRIWKHVHDVRQ+HRQO\KDGWZRGXULQJWKHVHDVRQ down in those games. -DPLUH-RUGDQFDXJKWKLV¿UVWWRXFKGRZQRIWKHVHDVRQDFDUHHUORQJRI\DUGV 7KH%XOOGRJVVFRUHGRQWKHLU¿UVWRIIHQVLYHSRVVHVVLRQWKH¿UVWWLPHVLQFH2FWYV81/9ZLWKD 44-yard rush by Jamire Jordan. 'HMRQWH2¶1HDODQG7\TXZDQ*ODVVHDFKKDGFDUHHUEHVWUHWXUQVRILGHQWLFDOJDLQVRI\DUGV2¶1HDO¶VZDV 7KHODVWJDPHWKHµ'RJVVFRUHGLQWKH¿UVWTXDUWHUZDVDW$LU)RUFHRQ2FW of the kick return variety, while Glass’ coming on a punt return. 7KHODVWWLPHWKHµ'RJVOHGDJDPHLQWKH¿UVWTXDUWHUZDVRQ1RYYV+DZDL¶L 7ROHGRUHJLVWHUHGVHYHQH[SORVLYHSOD\VRIRUPRUH(QWHULQJWKHJDPHWKHµ'RJVKDGDOORZHGIRXUWRWDO (QWHULQJWKHJDPH-HII&DPLOOLKDGRQHFDUHHUVDFNKHKDGWZRLQWKH¿UVWTXDUWHUYV7XOVD -DPLUH-RUGDQ¶V\DUG7'PDUNHGWKHVHYHQWK7'RXWRIHLJKWFDUHHUWRXFKGRZQVWRJRIRUPRUHWKDQ ,WZDVWKH¿UVWWLPHWKH%XOOGRJVZHUHVKXWRXWLQWKH¿UVWKDOIVLQFHWKH0RXQWDLQ:HVW&KDPSLRQVKLS yards. game versus Boise State. 'HMRQWH2¶1HDOUHFRUGHGD\DUGNLFNRIIUHWXUQLQWKHWKLUGTXDUWHU7KHORQJHVWNLFNUHWXUQVLQFH'D¶PDUL Scott returned a kick 66 yards vs. San Jose State on Sept. 26, 2015. -DPDO(OOLVHQWHUHGWKHVHDVRQZLWKFDUHHU,17KH¶VJRWWZRLQIRXUJDPHVLQ 7KH%XOOGRJV¶IRXUVDFNVDUHWKHPRVWVLQFHUHFRUGLQJVL[YV81/9LQ2FW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 71 2016 YEAR IN REVIEW Game #5, MW Game #1 Game #6, MW Game #2 UNLV 45, Fresno State 20 Nevada 27, Fresno State 22 2FW6DP%R\G6WDGLXP/DV9HJDV1HY$WWHQGDQFH 2FW0DFND\6WDGLXP5HQR1HY$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT FINAL Fresno State 0 7 10 3 - 20 Record (1-4, 0-1) Fresno State 6 0 7 9 - 22 Record (1-5, 0-2) UNLV 0 21 10 14 - 45 Record (2-3, 1-0) Nevada 7 14 0 6 - 27 Record (3-3, 1-1) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score LV 2nd 10:11 THOMAS 1 yd run (PANTELS kick) 14-70 5:55 0-7 )6 VW .52(1,1*\G¿HOGJRDO FS 2nd 08:40 PECK 15 yd pass from VIRGIL (KROENING kick) 4-76 1:25 7-7 NV 1st 04:48 DEMPS 36 yd pass from CELIS (ZUZO kick) 10-82 4:20 3-7 LV 2nd 05:44 WILLIAMS 5 yd run (PANTELS kick) 7-69 2:46 7-14 )6 VW .52(1,1*\G¿HOGJRDO LV 2nd 02:56 TROSCLAIR 61 yd pass from SNEED (PANTELS kick) 2-67 0:27 7-21 NV 2nd 04:22 STEWART 4 yd run (ZUZO kick) 10-44 3:33 6 14 )6 UG .52(1,1*\G¿HOGJRDO NV 2nd 00:12 DEMPS 3 yd pass from STEWART (ZUZO kick) 9-84 1:21 6-21 LV 3rd 07:38 SNEED 91 yd run (PANTELS kick) 3-90 1:01 10-28 FS 3rd 01:26 RICE 1 yd pass from VIRGIL (KROENING kick) 15-65 8:13 13-21 /9 UG 3$17(/6\G¿HOGJRDO )6 WK .52(1,1*\G¿HOGJRDO FS 3rd 01:17 PECK 80 yd pass from VIRGIL (KROENING kick) 1-80 0:14 17-31 NV 4th 07:56 DEMPS 8 yd pass from STEWART (ZUZO kick failed) 14-75 5:41 16-27 )6 WK .52(1,1*\G¿HOGJRDO FS 4th 05:08 JAMES 5 yd run (VIRGIL pass failed) 9-75 2:48 22-27 LV 4th 02:29 GREENE 9 yd run (PANTELS kick) 3-56 1:08 20 38 LV 4th 01:32 GREENE 16 yd run (PANTELS kick) 2-24 0:17 20-45 TEAM STATS Fresno St. Nevada INDIVIDUAL LEADERS First Downs 15 15 Rushing (att-yds-TD): TEAM STATS Fresno St. UNLV INDIVIDUAL LEADERS Rushing Att-Yards 48-255 49-226 FS - Dontel James (27-169-0) First Downs 15 19 Rushing (att-yds-TD): Passing Cmp-Att-Yds 16-28-197 14-23-163 NV - James Butler (37-175-0) Rushing Att-Yards 32-64 54-364 FS - Dontel James (18-53-0) Total Plays-Yards 76-452 72-389 Passing (cmp-att-int-yds-TD): Passing Cmp-Att-Yds 16-45-296 8-16-129 LV - Charles Williams (18-153-1) Fumbles-Lost 3-2 1-1 FS - Chason Virgil (16-27-0-197-1) Total Plays-Yards 77-360 70-493 Passing (cmp-att-int-yds-TD): Penalties-Yards 5-57 3-35 NV - Tyler Stewart (13-20-0-127-2) Fumbles-Lost 1-0 2-0 FS - Chason Virgil (16-45-1-296-2) Punts-Yards 2-73 3-114 Receiving Yards (no-yds-TD): Penalties-Yards 6-50 4-45 LV - Dalton Sneed (8-16-0-129-1) Average 36.5 38.0 FS - KeeSean Johnson (5-71-0) Punts-Yards 8-334 7-275 Receiving Yards (no-yds-TD): Net 36.5 38.0 NV - Wyatt Demps (9-124-3) Average 41.8 39.3 FS - Aaron Peck (5-194-2) Punt Returns (#-Yds-TD) 0-0-0 0-0-0 Defense (ST-AT-TT-TFL-Sack): Net 39.1 34.3 LV - Devonte Boyd (3-46-0) Kickoff Returns (#-Yds-TD) 0-0-0 2-34-0 FS - Jeff Camilli (5-5-10-0-0) Punt Returns (#-Yds-TD) 3-15-0 1-1-0 Defense (ST-AT-TT-TFL-Sack): Interceptions-Yards-TD 0-0-0 0-0-0 NV - Alex Bertrando (4-10-14-0-0) Kickoff Returns (#-Yds-TD) 6-124-0 4-86-0 FS - Jeff Camilli (6-4-10-1.0-0.0) Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Interceptions-Yards-TD 0-0-0 1-59-0 LV - Tau Lotulelei (6-4-10-2.0-1.0) Time of Possession 32:08 27:52 FS - None Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): 3rd Downs 6-of-14 4-of-11 NV - None Time of Possession 27:43 32:17 FS - None 4th Downs 2-of-3 3-of-3 3rd Downs 7-of-20 7-of-15 LV - Darius Mouton (1-59-0) Sacks By 1-15 1-4 4th Downs 0-of-2 0-of-0 Sacks By 0-0 2-20 RENO, Nev. – A career night of 169 yards on the ground from junior running back Dontel James was not LAS VEGAS – Despite a career night from senior enough for Fresno State as Nevada held on to a 27-22 wide receiver Aaron Peck, Fresno State fell 45-20 to OHDGZLWKDGHIHQVLYHVWDQGLQWKH¿QDOPLQXWHRISOD\ UNLV on Saturday night at Sam Boyd Stadium. Peck Saturday night at Mackay Stadium. accounted for 194 of the Bulldogs’ 360 yards of total offense. James’ 169 yards (27 carries) were the most single game rushing yards by a Bulldog since Robbie Rouse Chason Virgil threw for 296 yards and two scores for ran for 261 yards at Nevada on Nov. 10, 2012. It was the ‘Dogs, but the Rebels’ ground attack amassed 364 the junior’s second 100-yard rushing game this season. \DUGVDQG¿YHWRXFKGRZQV 2Q WKH %XOOGRJV¶ ¿UVW SOD\ IURP VFULPPDJH -DPHV $IWHU QHLWKHU WHDP FRXOG ¿QG WKHLU IRRWLQJ WKURXJK started his career night by breaking off the longest run the opening 14 minutes, UNLV then began a 14-play of his career, a 34-yard burst down the left side of the drive, with 13 coming on the ground, which ended in a ¿HOG7KDWVWDUWHGDSOD\\DUGGULYHWKDWUHVXOWHGLQ 1-yard touchdown by Lexington Thomas. The Bulldogs D\DUG¿HOGJRDOE\.RG\.URHQLQJ quickly responded with a 52-yard pass to Peck on the ensuing drive. Virgil connected with the senior two Aided by Fresno State miscues, a sack turned personal foul, and a 19-yard gain on 3rd-and-20 followed by a plays later for a 15-yard score to knot-up the game. WKDQGFRQYHUVLRQ1HYDGDDQVZHUHGWKH%XOOGRJV¶VFRUHZLWKDWRXFKGRZQWRWDNHLWV¿UVWOHDG7KH scoring play came via a backward pass from quarterback Tyler Stewert to wide receiver Andrew Celis, Celis The Rebels took a 14-7 lead on the ensuing possession with a seven-play 69-yard drive. After forcing the WKHQWKUHZGRZQ¿HOGWR:\DWW'HPSVIRUD\DUGWRXFKGRZQ Bulldogs to punt, UNLV quarterback Dalton Sneed tossed a 61-yard touchdown pass to Elijah Trosclair, to double the home team’s lead. The Bulldogs responded the very next possession with a drive that Kroening capped for the ‘Dogs, making it a JDPHDWWKHHQGRIWKH¿UVWTXDUWHUZLWKD\DUG¿HOGJRDO7KHMXQLRU¶V¿UVWTXDUWHU¿HOGJRDOVZHUHKLV )UHVQR6WDWHFXWLWVGH¿FLWWRZLWKD\DUG¿HOGJRDOIURP.RG\.URHQLQJZLWKWRSOD\LQWKHWKLUG eighth and ninth consecutive makes this season. quarter. James Bailey then nearly forced a fumble deep in UNLV territory, but the play was overturned. Sneed then escaped the pocket on the following play and rushed for a 91-yard score to give the Rebels a 28-10 Despite allowing a 14-yard drive to the Wolf Pack to open the second, Fresno State’s special teams unit came advantage. XSELJDV0DOLN)RUUHVWHUEORFNHG%UHQW=X]R¶V\DUG¿HOGJRDODWWHPSW=DFK.OLQHZKRVDZDFWLRQIRUWKH third time this season, fumbled three plays later and Nevada turned it into points with a 4-yard touchdown run With the score sitting at 31-10, Virgil and Peck made it a 31-17 game late in the third quarter as the two hooked from Stewart. Nevada scored again to close the second as Stewart found Demps for a 3-yard touchdown pass up for an 80-yard touchdown, the longest of Peck’s career. The Bulldogs then forced a quick three-and-out and to take a 21-6 lead into the half. SXWWRJHWKHUDSOD\GULYHWKDW.URHQLQJFDSSHGRIIZLWKDFDUHHUORQJ\DUG¿HOGJRDOWRSXOOWKHµ'RJV within 11. The Bulldogs narrowed Nevada’s lead to a one score game with just over a minute remaining in the third quarter as they capitalized on a 15-play drive. A drive that Virgil found Jared Rice on a 4th-and-goal from the 1-yard )UHVQR6WDWHZDVXQDEOHWRSXOODQ\FORVHUDQG81/9WDFNHGRQSRLQWVGXULQJWKH¿QDOWKUHHPLQXWHVRI OLQHIRUWKHVFRUH,WZDV5LFH¶V¿UVWFDUHHUFDWFKDQGWRXFKGRZQ the game. 7ZRSOD\VODWHUDIRUFHGIXPEOHE\6WUDWWRQ%URZQDQGUHFRYHU\E\1LFN.ULVWRIRUVOHGWR.URHQLQJ¶VWKLUG¿HOG Key Play goal of the night to close the gap to 21-16. Trailing by 11 midway through the third quarter, Bailey appeared to force a fumble that Nathan Madsen picked up inside the Rebel’s 10-yard line, but the play was ultimately overturned. UNLV then scored on a 91-run on Nevada answered with a 14-play scoring drive to take a 27-16 advantage, with nine plays coming from James the next play to push its lead to 28-10. Butler on the ground, with 7:56 to play. Quotable 7KH%XOOGRJVZRXOGQRWJRTXLHWO\9LUJLOHQJLQHHUHGD\DUGGULYHWKDW-DPHV¿QLVKHGRIIZLWKWKLV¿UVW7'RI Head coach Tim DeRuyter on the execution being a one-play snap shot of the season… the night to bring the score to 27-22 in Nevada’s favor with 5:08 left in the game. The Fresno State defense held “Absolutely. Both sides of the ball. We didn’t protect our quarterback well at times. We dropped footballs when WRXJKIRUFLQJDWKUHHDQGRXWDQGJDYHWKHRIIHQVHRQH¿QDOVKRWIRUWKHFRPHIURPEHKLQGZLQ EDOOVKLWXV2XUTXDUWHUEDFNGLGQ¶WKLWUHFHLYHUVZKHQWKH\ZHUHRSHQ2QWKHGHIHQVLYHVLGHZHZHUH¿WWLQJ gaps, but we didn’t have multiple guys to the ball and we had guys miss tackles. The blame is everywhere.” With less than three minutes on the clock, the Bulldogs pushed the ball down to as far as Nevada’s 4-yard line, but the ‘Dogs were unable to get the ball into the end zone on four passing plays that fell incomplete. Notables $DURQ3HFNDFFRXQWHGIRURI)UHVQR6WDWH¶V\DUGVRQLWV¿UVWVFRULQJGULYLQJ3HFNKDXOHGLQD\DUG Key Stat score after catching a 52-yard pass. In the second quarter, Fresno State fumbled twice and punted once on their three possessions, while Nevada )UHVQR6WDWHFRQYHUWHGVHYHQRIWKLUGGRZQV)LYHRIWKHVHYHQZHUHRQSOD\VZLWKQHHGLQJQLQHRUPRUH scored two touchdowns on its three possessions. The Wolf Pack outgained the Bulldogs 175-75 in that frame. yards. )UHVQR6WDWHDQG81/9HTXDOO\RZQHGWKUHHWKUHHDQGRXWV Quotable )UHVQR6WDWHDOORZHGSOXV\DUGVUXVKLQJIRUWKHWKLUGFRQVHFXWLYHJDPH +HDGFRDFK7LP'H5X\WHURQWKH¿QDOVHULHVRIWKHJDPH« 81/9DWWHPSWHGSDVVHVWKH%XOOGRJVGLGQRWPDNHDVDFNRQRQHRIWKRVHDWWHPSWV,WPDUNVWKHWKLUGJDPH ³:HRQO\KDGRQHWLPHRXWOHIW2QFHZHJRWWKH¿UVWGRZQWKHFORFNZDVUXQQLQJDQGZHWKRXJKWZHKDGD this year without a quarterback sack. good matchup with Aaron (Peck), so we threw the fade. At that point we probably could have run the ball, .RG\.URHQLQJKLWDFDUHHUORQJ\DUG¿HOGJRDOLQWKHORVV.URHQLQJKDVVXFFHVVIXOO\PDGHVHYHQVWUDLJKW but we thought we had some plays that we practiced all week down there in the red zone and we just didn’t NLFNVVLQFHPLVVLQJKLV¿UVWDWWHPSWRIWKHVHDVRQ execute. Give Nevada credit, their kid knocked the ball out of Aaron’s hand and they executed in the red zone -HII&DPLOOLOHGWKHWHDPLQWDFNOHVIRUWKHVHFRQGVWUDLJKWJDPHKHOHGWKHWHDPZLWKDW81/9 better than we did.” -DPHV%DLOH\UHJLVWHUHGWKUHHSDVVEUHDNXSVKHRZQHGWKUHHFDUHHUSDVVEUHDNXSVHQWHULQJWKHJDPH $DURQ3HFNUHFRUGHGDFDUHHUKLJK\DUGVLWZDVWKHWKPRVWUHFHLYLQJ\DUGVLQDVLQJOHJDPHLQVFKRRO Notables history. -HII&DPLOOLKLWGRXEOHGLJLWWDFNOHVIRUWKHIRXUWKWLPHWKLVVHDVRQ±KHKDVSOD\HGLQ¿YHRIVL[JDPHVWKLV\HDU 7KHUHZHUHJDPHVLQVFKRROKLVWRU\ZLWKDSDVVFRPSOHWLRQRIRYHU\DUGVHQWHULQJWKHVHDVRQ -HIIUH\$OOLVRQVXUSDVVHGKLVVHDVRQKLJKRIIRXUWDFNOHVDW7ROHGRZLWKVHYHQ Peck’s 80-yard TD catch at UNLV marked the 18th in school history after Jamire Jordan recorded an 85-yard 1LFN.ULVWRIRUVSRVWHGDFDUHHUKLJKLQWDFNOHVDWVL[ KDGHLJKWWDFNOHVDOORI TD pass play at Toledo earlier this season. )UHVQR6WDWHQHWWHG\DUGVUXVKLQJLWZDVWKHPRVW\DUGVUXVKLQJIRUWKH%XOOGRJVVLQFHWKHWHDPUHJLVWHUHG $DURQ3HFN¶V\DUGJDPHPDUNHGWKHIRXUWK)UHVQR6WDWH\DUGJDPHIRUDZLGHRXWWKHPRVWVLQFH 389 on the ground on Sept. 20, 2013 (Southern Utah). the 2013 season. &KDVRQ9LUJLOZDVRI SHUFHQW KLVWRSWKURZLQJSHUFHQWDJHRIWKHVHDVRQ )UHVQR6WDWHKDVQRWDOORZHGDQRSHQLQJVHULHVVFRUHLQDOO¿YHJDPHV81/9JDLQHGWZR¿UVWGRZQVRQLWV RSHQLQJGULYHHTXDOLQJWKUHH¿UVWGRZQVDOORZHGDOOVHDVRQWRRSSRQHQWV 72 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW Game #7, MW Game #3 Game #8, MW Game #4 San Diego State 17, Fresno State 3 Utah State 38, Fresno State 28 2FW%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH 2FW0DYHULFN6WDGLXP/RJDQ8WDK$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT FINAL San Diego State 3 7 7 0 - 17 Record (5-1, 2-0) Fresno State 7 7 3 3 - 20 Record (1-7, 0-4) Fresno State 0 0 3 0 - 3 Record (1-6, 0-3) Utah State 7 10 7 14 - 38 Record (3-4, 1-3) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score 6'68VW %$521\G¿HOGJRDO USU 1st 10:23 ROBERTS 21 yd pass from MYERS (WARREN kick) 7-60 3:08 0-7 SDSU 2nd 09:15 PUMPHREY 2 yd run (BARON kick) 11 5:34 10-0 FS 1st 01:28 JAMES 3 yd run (KROENING kick) 15-86 6:02 7-7 )6 UG .52(1,1*\G¿HOGJRDO USU 2nd 06:22 CHENEY, Austin 0 yd punt return (WARREN kick) 7-14 SDSU 3rd 00:09 PUMPHREY 13 yd run (BARON kick) 9 3:28 17-3 868 QG :$55(1\G¿HOGJRDO FS 2nd 00:24 RICE 1 yd pass from VIRGIL (KROENING kick) 13-77 3:15 14-17 USU 3rd 11:50 HOUSTON 5 yd pass from MYERS (WARREN kick) 8-75 3:10 14-24 TEAM STATS San Diego St. Fresno St. INDIVIDUAL LEADERS )6 UG .52(1,1*\G¿HOGJRDO First Downs 25 10 Rushing (att-yds-TD): USU 4th 14:25 TARVER 25 yd pass from MYERS (WARREN kick) 6-59 1:17 17-31 Rushing Att-Yards 61-292 24-78 SDSU - Donnell Pumphrey (38-220-2) )6 WK .52(1,1*\G¿HOGJRDO Passing Cmp-Att-Yds 7-12-72 15-27-139 FS - Chason Virgil (9-44-0) USU 4th 07:14 HOBBS 4 yd run (WARREN kick) 11-75 4:27 20-38 Total Plays-Yards 73-364 51-217 Passing (cmp-att-int-yds-TD): Fumbles-Lost 2-0 0-0 SDSU - Christ Chapman (7-12-0-72-0) TEAM STATS Fresno St. Utah St. INDIVIDUAL LEADERS Penalties-Yards 6-65 5-36 FS - Chason Virgil (16-26-2-139-0) First Downs 23 24 Rushing (att-yds-TD): Punts-Yards 4-145 5-197 Receiving Yards (no-yds-TD): Rushing Att-Yards 39-114 40-204 FS - Dontel James (29-80-1) Average 36.2 39.4 SDSU - David Wells (3-30-0) Passing Cmp-Att-Yds 27-44-205 17-29-188 USU - Tonny Lindsey (23-66-0) Net 36.2 39.4 FS - KeeSean Johnson (8-56-0) Total Plays-Yards 83-319 69-392 Passing (cmp-att-int-yds-TD): Punt Returns (#-Yds-TD) 1-0-0 0-0-0 Defense (ST-AT-TT-TFL-Sack): Fumbles-Lost 0-0 0-0 FS - Chason Virgil (27-44-0-205-1) Kickoff Returns (#-Yds-TD) 2-41-0 4-91-0 SDSU - (4-6-10-0-0) Penalties-Yards 10-80 5-40 USU - Kent Myers (17-29-0-188-3) Interceptions-Yards-TD 3-20-0 0-0-0 FS - Stratton Brown (6-8-14-1.0-0) Punts-Yards 6-168 4-131 Receiving Yards (no-yds-TD): Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Average 28.0 32.8 FS - Jamire Jordan (10-67-0) Time of Possession 37:19 22:41 SDSU - Kameron Kelly (1-20-0) Net 16.5 32.8 USU - Ron’Quavion Tarver (3-54-1) 3rd Downs 7-of-13 5-of-14 FS - None Punt Returns (#-Yds-TD) 0-0-0 2-23-1 Defense (ST-AT-TT-TFL-Sack): 4th Downs 0-of-1 0-of-2 Kickoff Returns (#-Yds-TD) 4-69-0 3-47-0 FS - Stratton Brown (3-10-13-0-0) Sacks By 2-12 1-1 Interceptions-Yards-TD 0-0-0 0-0-0 USU - Devin Centers (4-6-10-0-0) Fumble Ret-Yards-TD 1-0-0 2-0-0 Interceptions (no-yds-TD): Time of Possession 33:30 26:30 FS - None 3rd Downs 8-of-20 5-of-11 USU - None FRESNO, Calif. – On homecoming, Fresno State 4th Downs 2-of-3 1-of-1 held the ball for just under 23 minutes as San Sacks By 0-0 1-6 Diego State controlled the clock in a 17-3 game on Friday at Bulldog Stadium. LOGAN, Utah –The Fresno State football team held The Aztecs held the narrowest of margins WLJKWLQWKH¿UVWKDOIRQWKHURDGDW8WDK6WDWHWUDLOLQJ by three at the break, but the Aggies outscored the throughout the game: 3-0 after one quarter, 10-0 %XOOGRJV LQ VHFRQG KDOI WR SURGXFH WKH ¿QDO at halftime and 17-3 following three quarters of deceit of 38-20 on Saturday night at Maverick play. It was a combination of an Aztec defense Stadium. It was the ‘Dogs seventh loss of the season, WKDWOLPLWHGWKH%XOOGRJVWR¿UVWGRZQVDQG eliminating them from bowl game contention. yards offense and San Diego State’s ground attack WKDWNHSWWKHPRIIWKH¿HOG &KDVRQ9LUJLO¿QLVKHGWKHJDPHFRPSOHWLQJRI 44 passes for 205 yards and one touchdown. The Behind a combined 53 carries from Donnell redshirt freshman had a stretch of 14 consecutive Pumphrey and Rashaad Penny, San Diego State used its run game to control the game, holding a near completions that spanned from the second quarter 15-minute advantage in time of possession. The running back duo accounted for 269 of the Aztecs’ into third. Dontel James added 80 yards and a 364 yards. touchdown on the ground. Fresno State’s defense held tight on the opening drive, a possession Jeff Camilli and Tobenna Okeke After Utah State scored a touchdown on its opening drive of the game to take an early lead, the Bulldog stuffed Pumphrey on a fourth-and-goal from the 1-yard line. The Aztecs accounted for 92 yards offense defense held tough on the Aggies’ next two drives before the Fresno State offense put together a 15- WRWKH%XOOGRJV¶LQWKHRSHQLQJTXDUWHUEXWRQO\PXVWHUHGDOHDGDIWHUWKH¿UVWPLQXWHV SOD\GULYHZKLFK-DPHV¿QLVKHGRIIZLWKDWKUHH\DUGUXQWRWLHWKHJDPHDW0LGZD\WKURXJKWKH second quarter, Austin Cheney gave the Aggies a 10-point lead as he blocked a Blake Cusick punt that was Behind a 2-yard TD run, Pumphrey gave the Aztecs a 10-0 lead as he capped an 11-play drive with 9:15 recovered in the end zone, to swing the games’ momentum. to play in the second quarter. The Bulldogs made a charge late in the half in part to a 28-yard rush by Chason Virgil and an 15-yard unsportsmanlike conduct penalty against the Aztecs that moved the ball Fresno State battled through the special teams set back, trailing 17-7. Virgil orchestrated a 77-yard to the opponents’’ 38-yard line. The drive was halted on a fourth-and-8 fake punt from the 36-yard line VFRULQJGULYHWKDWHQGHGZLWKDRQH\DUGSDVVWR-DUHG5LFHWRFORVHRXWWKH¿UVWKDOI,WZDV5LFH¶VVHFRQG in which punter Blake Cusick’s pass was intercepted. touchdown and second reception of his career. Virgil went 8-of-8 on the drive that closed the half to pull the ‘Dogs within three. )RUWKH¿UVWRIWKUHHVHFRQGKDOIWRXFKGRZQVWKH$JJLHVH[WHQGHGLWVOHDGWRWRVWDUWWKHVHFRQGKDOI For the third time in the last four games, the Bulldogs opened the second half by putting points on the VFRUHERDUGDV.RG\.URHQLQJFRQQHFWHGIRUD\DUG¿HOGJRDOWRFDSDSOD\\DUGGULYHWR 7KH%XOOGRJVFRXQWHUHGZLWKWKHLUORQJHVWGULYHRIWKHVHDVRQ SOD\V ZLWKWKHLU¿UVWSRVVHVVLRQLQWKH begin the third quarter. WKLUGTXDUWHUEXWWKHµ'RJVGULYHUHVXOWHGLQD\DUG¿HOGJRDOZKLFKSXWWKHPZLWKLQVHYHQ868ZRXOG WDFNRQWZRPRUHWRXFKGRZQVFRUHVWKDWZHUHRQO\DQVZHUHGE\DQDGGLWLRQDO%XOOGRJ¿HOGJRDODOEHLWLW The Aztecs continued to pound the ball on the ground in the second half and broke through late in the was a career-long 49-yard kick by Kody Kroening. third quarter with a 13-yard run by Pumphrey. His second score of the night to make it a 17-3 game. Quotables 3XPSKUH\¿QLVKHGZLWK\DUGVRQFDUULHV +HDGFRDFK7LP'H5X\WHURQWKHORVV« Our guys are right there. At some point, we’re going to make those plays. We just have to keep chopping )UHVQR6WDWHZLOOWUDYHOWR8WDK6WDWHIRULWV¿UVW0RXQWDLQ:HVWSDLULQJLQ/RJDQVLQFHMRLQLQJWKH wood. Guys are crushed. You put everything you have to win a football game. To have it there in the conference. The game will be aired on the CBS Sports Network on Saturday, Oct. 22 at 7:30 p.m. PT. second half. Going to the fourth quarter, we felt it was exactly what we wanted. It was a one score game… We have to continue to coach with detail and play with detail. There’s too many little things that we aren’t Quotables doing to win a football game on the road… Defensively, we have to tackle better… The bottom line is: we Head coach Tim DeRuyter on tonight’s performance against San Diego State… didn’t make enough plays and they (Utah State) did. “We played an excellent San Diego State team that is very well-coached, veteran group. They run the ball as well as anyone in the country and defensively they play very hard and their scheme presents 4XDUWHUEDFN&KDVRQ9LUJLORQWKHSURJUHVVWKHWHDPLVPDNLQJ« SUREOHPV,DPSURXGRIRXUJX\V¶HIIRUWEXWZHQHHGWR¿QGDZD\WRJHWRYHUWKHWRSDQG¿QGDZD\ “Obviously, with us losing, we don’t feel like we played our best game. We know that we can play a lot to win. Give San Diego State credit, they are an excellent football team.” better…. We’re just trying to work through it. It’s a long season for us, a tough season for us. We’re just trying to work through it. Every week, we get better at something. So we just have to all put it together.” Notables Notables .HH6HDQ-RKQVRQPDWFKHGDFDUHHUKLJKRIHLJKWUHFHSWLRQV±DPDUNKHVHW6HSWDW1HEUDVND -DPLUH-RUGDQEHFDPHWR¿UVW%XOOGRJWRUHFRUGFDWFKHVVLQFH-RVK+DUSHUGLGVRLQWKH0RXQWDLQ $DURQ3HFNKLWWKHPDUNRIDWOHDVWVL[UHFHSWLRQVLQDVLQJOHJDPHIRUWKHWKLUGWLPHWKLVVHDVRQ :HVW&KDPSLRQVKLSJDPHYV%RLVH6WDWHLQLWEHVWHGDFDUHHUKLJKRIVHYHQ YV6DFUDPHQWR6WDWH &KDVRQ9LUJLOWKUHZDVLQJOHJDPHFDUHHUKLJKWZRLQWHUFHSWLRQV &KDVRQ9LUJLOUHFRUGHGDFDUHHUKLJKRIFRPSOHWLRQV .RG\.URHQLQJKDVQRZPDGHFRQVHFXWLYH¿HOGJRDODWWHPSWV .RG\.URHQLQJVHWDFDUHHUORQJZLWKD\DUG¿HOGJRDOLQFUHDVLQJKLVQDWLRQOHDGLQJVWUHDNWR )UHVQR6WDWHZDVKHOGXQGHU\DUGVUXVKLQJIRUWKHIRXUWKWLPHWKLVVHDVRQ straight makes as he went 2-for-2 on the night. %ODNH&XVLFNKDGRQHSXQWUHWXUQHGIRU]HUR\DUGV&XVLFNKDV\HWWRKDYHDQRSSRQHQWJDLQD\DUG )UHVQR6WDWHRZQHGDWRDGYDQWDJHLQWLPHRISRVVHVVLRQ on 49 punts this season. )UHVQR6WDWHUDQPRUHSOD\VWKDQ8WDK6WDWH 6DQ'LHJR6WDWHUHJLVWHUHG\DUGVSDVVLQJ,WZDVWKHVHFRQGWLPHWKLVVHDVRQD%XOOGRJRSSRQHQW 8WDK6WDWHSURGXFHG¿YHFKXQNSOD\VWR)UHVQR6WDWH¶VWZR was held to less than 100 yards passing. 7KH%XOOGRJVDYHUDJH\DUGVSHUSOD\ZDVYV8WDK6WDWH¶V 7KH%XOOGRJVZHUHOLPLWHGWR¿UVWGRZQVYV6DQ'LHJR6WDWH7KHVHFRQGIHZHVWWKLVVHDVRQ± )UHVQR6WDWHZDVRXWVFRUHGLQWKHVHFRQGKDOI Toledo (7). )UHVQR6WDWHKDV]HURVDFNVIRUWKHIRXUWKWLPHWKLVVHDVRQ )UHVQR6WDWHWKUHZDVHDVRQKLJKWKUHHLQWHUFHSWLRQV,WZDVWKHPRVWLQDVLQJOHJDPHE\)UHVQR6WDWH 6WUDWWRQSRVWHGDWHDPKLJKWDFNOHVKHKDVUHJLVWHUHGGRXEOHGLJLWWDFNOHVLQIRXURIWKHVL[JDPHV since they traveled to Hawai’i on Nov. 14, 2015. )UHVQR6WDWHZDVRIRQWKLUGGRZQVDQGRIRQIRXUWKGRZQV 6DQ'LHJR6WDWHSRVVHVVHGWKHEDOO,WZDVWKHPRVWDQRSSRQHQWFRQWUROOHGWKHEDOOVLQFH$LU 7KH JDPH YV 8WDK 6WDWH PDUNHG WKH VHFRQG JDPH IRU )UHVQR 6WDWH WKLV VHDVRQ WKDW QHLWKHU WHDP Force held possession for 42:38 on Oct. 24, 2015. manufactured a turnover. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 73 2016 YEAR IN REVIEW Game #9, MW Game #5 Game #10, MW Game #6 Air Force 31, Fresno State 21 Colorado State 37, Fresno State 0 2FW%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH 1RY+XJKHV6WDGLXP)RUW&ROOLQV&ROR$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT FINAL Air Force 0 7 10 14 - 31 Record (5-3, 2-3) Fresno State 0 0 0 0 - 0 Record (1-9, 0-6) Fresno State 7 7 7 0 - 21 Record (1-8, 0-5) Colorado State 10 13 14 0 - 37 Record (5-4, 3-2) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score FS 1st 07:55 JOHNSON 36 yd pass from VIRGIL (KROENING kick) 4-59 1:02 0-7 &68 VW %5<$1\G¿HOGJRDO FS 2nd 12:19 JOHNSON 2 yd pass from VIRGIL (KROENING kick) 10-80 4:03 0-14 CSU 1st 01:06 KINSEY 5 yd run (BRYAN kick) 4-66 1:17 0-10 AFA 2nd 00:41 CLEVELAND 33 yd pass from ROMINE (STREBEL kick) 5-51 1:05 7-14 CSU 2nd 12:29 GALLUP 18 yd pass from STEVENS (BRYAN kick failed) 5-62 1:45 0-16 $)$ UG 675(%(/\G¿HOGJRDO CSU 2nd 01:25 MATTHEWS 1 yd run (DAVIS kick) 15-84 8:22 0-23 AFA 3rd 08:24 HEALY 35 yd interception return (STREBEL kick) 17-14 CSU 3rd 11:10 HAWKINS 14 yd pass from STEVENS (DAVIS kick) 8-60 1:59 0-30 FS 3rd 06:25 JOHNSON 52 yd pass from VIRGIL (KROENING kick) 6-69 1:52 17-21 CSU 3rd 07:27 MATTHEWS 1 yd run (DAVIS kick) 6-60 2:40 0-37 AFA 4th 13:02 WORTHMAN 2 yd run (STREBEL kick) 9-53 3:34 24-21 AFA 4th 02:34 WORTHMAN 4 yd run (STREBEL kick) 2-7 0:15 31-21 TEAM STATS Fresno St. CSU INDIVIDUAL LEADERS First Downs 12 28 Rushing (att-yds-TD): TEAM STATS Air Force Fresno St. INDIVIDUAL LEADERS Rushing Att-Yards 34-77 48-257 FS - Bryson Oglesby (9-39-0) First Downs 23 18 Rushing (att-yds-TD): Passing Cmp-Att-Yds 12-25-155 18-25-237 CSU - Marvin Kinsey (10-83-1) Rushing Att-Yards 73-327 30-37 AFA - Arion Worthman (20-102-2) Total Plays-Yards 59-232 73-494 Passing (cmp-att-int-yds-TD): Passing Cmp-Att-Yds 5-9-97 19-38-312 FS - Chason Virgil (19-24-0) Fumbles-Lost 1-0 0-0 FS - Zach Kline (11-24-1-147-0) Total Plays-Yards 82-424 68-349 Passing (cmp-att-int-yds-TD): Penalties-Yards 4-35 7-80 CSU - Nick Stevens (18-23-0-237-2) Fumbles-Lost 2-1 1-0 AFA - Nate Romine (5-9-0-97-1) Punts-Yards 7-253 3-130 Receiving Yards (no-yds-TD): Penalties-Yards 6-47 8-55 FS - Chason Virgil (18-37-4-303-3) Average 36.1 43.3 FS - Jamire Jordan (3-64-0) Punts-Yards 4-117 3-112 Receiving Yards (no-yds-TD): Net 36.1 CSU - Michael Gallup (9-126-1) Average 29.2 37.3 AFA - Jalen Robinette (3-54-0) Punt Returns (#-Yds-TD) 1-10-0 1-0-0 Defense (ST-AT-TT-TFL-Sack): Net 29.0 37.7 FS - KeeSean Johnson (10-142-3) Kickoff Returns (#-Yds-TD) 1-19-0 1-23-0 FS - Stratton Brown (5-4-9-1.0-0) Punt Returns (#-Yds-TD) 1--1-0 2-1-0 Defense (ST-AT-TT-TFL-Sack): Interceptions-Yards-TD 0-0-0 1-13-0 CSU - Patrick Elsenbast (4-2-6-0-0) Kickoff Returns (#-Yds-TD) 4-69-0 6-113-0 AFA - Claude Alexander III (5-4-9-1.0-1.0) Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Interceptions-Yards-TD 4-65-1 0-0-0 FS - Stratton Brown (4-11-15-0-0) Time of Possession 27:36 32:24 FS - None Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): 3rd Downs 7-of-17 6-of-11 CSU - Jordan Vaden (1-13-0) Time of Possession 35:01 24:59 AFA - Brodie Hicks (2-30-0z) 4th Downs 0-of-3 0-of-1 3rd Downs 9-of-17 7-of-14 FS - None Sacks By 0-0 5-26 4th Downs 1-of-2 1-of-3 Sacks By 2-11 1-6 FORT COLLINS, Colo. – The Fresno State football team lost to Colorado State 37-0 on FRESNO, Calif. – In a 31-21 Fresno State loss on Saturday afternoon at Hughes Stadium. It was the Friday night at Bulldog Stadium to Air Force, the ¿UVWWLPHWKH%XOOGRJVKDYHEHHQVKXWRXWVLQFH1RY Bulldogs’ air attack came up short against the Falcons’ 19, 2010. ground game. KeeSean Johnson and Jamire Jordan combined for 257 yards receiving, becoming the %XOOGRJV¶ ¿UVW SDLU RI \DUG UHFHLYHUV VLQFH WKH 7KH %XOOGRJV¶ RIIHQVH VWUXJJOHG WR ¿QG WKHLU 2013 Mountain West Championship game, while the UK\WKP HDUO\ JRLQJ WKUHHDQGRXW ZLWK LWV ¿UVW Air Force rush attack amassed 327 yards on 73 carries. three drives. All while the Rams could do no wrong despite falling short on a fourth-and-1 at the 11- Johnson, who had a career-high 142 yards, became \DUGOLQHGXULQJWKHLU¿UVWGULYH-HII&DPLOOLDQG WKH¿UVW%XOOGRJWRFDWFKWKUHHWRXFKGRZQVLQDJDPH James Bailey converged on Izzy Matthews for a since Davante Adams on Nov. 29, 2013 and Jordan joined Johnson with a 100-yard receiving game (115), 1-yard loss to stop a 12-play, 65-yard drive. his second of the season. )URPWKDWSRLQWIRUZDUG&RORUDGR6WDWHVFRUHGRQLWVQH[WVL[SRVVHVVLRQV±¿YHWRXFKGRZQVDQGRQH 7KHTXDUWHUEDFN&KDVRQ9LUJLOQRWFKHGKLV¿UVW ¿HOGJRDO7KH5DPVUHJLVWHUHG\DUGVRQWKHLUVL[VFRULQJGULYHV \DUGSDVVLQJJDPHDQGWKUHHWRXFKGRZQJDPHRIKLV\RXQJFDUHHUDVKH¿QLVKHGZLWK\DUGVEXWLWDOVRFDPH with a career-high four interceptions. Fresno State meanwhile turned to quarterback Zach Kline after Chason Virgil exited the game with a Virgil and his receivers started clicking during their second drive as the redshirt freshman lofted a 21-yard pass VKRXOGHULQMXU\IROORZLQJWKHµ'RJV¶¿UVWGULYH WR-RUGDQEHIRUH¿QGLQJ-RKQVRQVWUHDNLQJGRZQWKHPLGGOHRIWKH¿HOGIRUD\DUGWRXFKGRZQ$WWKHHQGRI WKH¿UVWTXDUWHU9LUJLOEHJDQRUFKHVWUDWLQJDSOD\\DUGGULYHLQZKLFKKHZDVRIDQGFRQQHFWHGZLWK 7KH RIIHQVH UHFRUGHG WRWDO \DUGV LQ WKH ¿UVW KDOI DQG WUDLOHG LQ WKH ¿UVW GRZQV PDUJLQ DW Johnson for a two-yard score to put the Bulldogs up 14-0. KDOIWLPH7KHµ'RJVSRVWHG\DUGVLQWKLUGTXDUWHUDQG\DUGVLQWKH¿QDOIUDPHUHVXOWLQJLQD season-low 232 yards offense. $QLQWHUFHSWLRQE\$LU)RUFH¶V%URGLH+LFNVODWHLQWKH¿UVWKDOIOHGWRWKH)DOFRQ¶V¿UVWVFRUH7KH)DOFRQV marched 51 yards, with 33 of them coming on a touchdown pass from Nate Romine to Ronald Cleveland with 41 seconds to go to pull within seven, 14-7. .OLQH¿QLVKHGZLWK\DUGVSDVVLQJJRLQJRI+HFRQQHFWHGZLWK-DPLUH-RUGDQIRUD\DUG pitch-and-catch in the fourth quarter – the Bulldogs’ longest play from scrimmage in the game. Kline 7KH)DOFRQVZRXOGWDFNRQD¿HOGJRDORQLWVRSHQLQJGULYHWRVWDUWWKHVHFRQGKDOI7KUHHSOD\VODWHU$LU also gained 26 yards on the ground with 17 carries. )RUFHJUDEEHGLWV¿UVWOHDGRIWKHJDPHDV3DWULFN+HDO\UHWXUQHGDQLQWHUFHSWLRQ\DUGVIRUDWRXFKGRZQ Unaffected, Virgil found Johnson open deep on the ensuing Fresno State possession for a 52-yard score, his Stratton Brown led Fresno State in tackles for the fourth-straight game. He posted nine stops. third of the game. As the Falcons were driving heading into the fourth, four straight runs from Arion Worthman set them up inside Fresno State (1-9, 0-6 MW) dropped its eighth-straight game, marking the longest losing streak in WKH¿YH\DUGOLQH7ZRSOD\VODWHUWKHTXDUWHUEDFNSURYLGHGWKHJRDKHDGVFRUHIRUWKHYLVLWRUV school history. With under four minutes remaining, Air Force looked to put the game away, but the Bulldog defense held strong Quotables with a goal-line stand. The offense though could only manage three yards on its next possession and turned the Interim head coach Eric Kiesau on Colorado State... ball over-on-downs at the seven-yard line. Worthman would make it a 31-21 advantage for the Falcons two “You’ve got to give a lot of credit to Colorado State. They did a very good job. They played a very plays later. physical brand of football. They gave us some pressures and we had them picked up, but they played Key Stat really physical. You have to give a lot of credit to them.” $LU)RUFHUXVKHGIRU\DUGVDQGWZRWRXFKGRZQVRQFDUULHVZKLOHKROGLQJWKHEDOOIRULQWKH¿QDO quarter. Interim head coach Eric Kiesau on Zach Kline’s performance off the bench… “It’s tough. He had a lot of pressure around him. There were a few times he should have settled his feet Quotables down and thrown the ball. Without looking at the tape and really looking at it, I don’t want to speak Interim head coach Eric Kiesau on the game… “Tonight was a tough game. I thought our players played extremely hard and I give them a lot of credit. I’m prematurely, but he had a few mistakes obviously, he had a lot of stress around. I think he was giving really proud of their effort and how they played tonight. We just came up short.” it everything he had and he gave great effort. It just wasn’t our night tonight.” “There is a huge buy-in factor right now and I know the points aren’t there but that will come. I truly believe that Key Stat it will come. We’ve been talking about relentless effort and tonight the kids were shouting it back at us. These .QRZQIRUVWULNLQJIDVW&RORUDGR6WDWHKDGVFRUHGSRLQWVLQWKH¿UVWTXDUWHUHQWHULQJWKHJDPH kids will come back on Sunday and work hard at practice.” the most out of any frame. That average was built on as the Rams took a 10-0 lead and outgained Notables )UHVQR6WDWHLQWKH¿UVWTXDUWHU&RORUDGR6WDWHSRVVHVVHGWKHEDOOWR)UHVQR6WDWH¶V .HH6HDQ-RKQVRQVXUSDVVHG\DUGVIRUWKH¿UVWWLPHLQKLVFDUHHUWRWDOLQJ\DUGVWKH\DUGDJHPDUNZDV the most by a Bulldog since Aaron Peck topped out at 194 on Oct. 8, 2016. Notables -DPLUH-RUGDQ DQG.HH6HDQ-RKQVRQ DUHWKH¿UVW)UHVQR6WDWH:5GXRWRKDYH\DUGJDPHV 5%-XVWLQ5LFHDQG'%7DQN.HOO\HDUQHGWKHLU¿UVWFDUHHUVWDUWVDW&RORUDGR6WDWH¿OOLQJWKHKROHV since Davante Adams and Isaiah Burse (Dec. 7, 2013). missing from injuries to RB Dontel James and DB Tyquwan Glass. .HH6HDQ-RKQVRQ¶VFDUHHUKLJKWKUHHWRXFKGRZQVZHUHWKHPRVWLQDVLQJOHJDPHE\D%XOOGRJVLQFH'DYDQWH 5%%U\VRQ2JOHVE\SOD\HGLQKLV¿UVWFDUHHUJDPHKLV¿UVWFDUHHUUXVKZDVD\DUGUXQLQWKLUG Adams on Nov. 29, 2013 vs. San Jose State. &KDVRQ9LUJLOWKUHZIRU\DUGV IRUWKH¿UVWWLPHLQKLVFDUHHULWZDVWKH¿UVWJDPH)UHVQR6WDWHZHQW TXDUWHUWKDWSXWWKHµ'RJVLQWR&RORUDGR6WDWHWHUULWRU\IRUWKH¿UVWWLPHLQWKHFRQWHVW RYHUWKH\DUGSDVVLQJPDUNWKLVVHDVRQ,WZDVWKH¿UVWWLPHD%XOOGRJTXDUWHUEDFNZHQWRYHUWKH\DUG &RORUDGR6WDWHSLWFKHGLWV¿UVWVKXWRXWVLQFH1RYDZLQRYHU+DZDL¶L mark since Brian Burrell on Dec. 6, 2014 vs. Boise State. 7KH%XOOGRJVZHUHVKXWRXWIRUWKH¿UVWWLPHVLQFH1RYDORVVWR1R%RLVH6WDWH )UHVQR6WDWHKDGVL[FKXQNSOD\VLQWKHJDPH DOOSDVVLQJ WKDWQXPEHUVXUSDVVHV¿YHFROOHFWHGLQWKHWZR &RORUDGR6WDWHVFRUHGSRLQWVDQGKDG¿UVWGRZQVEHIRUH)UHVQR6WDWHSRVWHGLWV¿UVW¿UVWGRZQ previous games combined. .OLQHSLFNHGXSWKH¿UVWGRZQDWWKHPDUNLQWKHVHFRQGTXDUWHURQDQ\DUGVFUDPEOH Stratton Brown’s 15 tackles were a career-high, matching Jeff Camilli’s team-high of 15 set vs. Tulsa on Sept. 24. -HII&DPLOOLUHJLVWHUHG¿YHRIKLVHLJKWWDFNOHVLQWKH¿UVWTXDUWHU )UHVQR6WDWHZDVKHOGWR\DUGVUXVKLQJLWVVHFRQGORZHVWWRWDOWKLVVHDVRQ7KH%XOOGRJVKDYHEHHQKHOG XQGHU\DUGVUXVKLQJ¿YHWLPHVLQ 6DWXUGD\ZDVWKHVL[WKJDPH RI WKDWWKH%XOOGRJVGLGQRWIRUFHDWXUQRYHULQDJDPH $LU)RUFHSRVWHG¿UVWGRZQVWRWKH%XOOGRJV¶ 6DWXUGD\¶VJDPHPDUNHGWKH¿IWKWLPHWKLVVHDVRQWKDW)UHVQR6WDWHGLGQRWUHFRUGDVDFN )UHVQR6WDWHZDVRXWVFRUHGLQWKHVHFRQGKDOI)UHVQR6WDWHZDVRXWVFRUHGLQWKHVHFRQGKDOIODVW week at Utah State. 74 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2016 YEAR IN REVIEW Game #11, MW Game #7 Game #12, MW Game #8 Hawai’i 14, Fresno State 13 San Jose State 16, Fresno State 14 1RY%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH 1RY%XOOGRJ6WDGLXP)UHVQR&DOLI$WWHQGDQFH SCORE BY QUARTERS 1 2 3 4 OT FINAL SCORE BY QUARTERS 1 2 3 4 OT FINAL Hawai’i 0 7 0 7 - 14 Record (5-7, 4-4) San Jose State 7 0 6 3 - 16 Record (4-8, 3-5) Fresno State 0 7 3 3 - 13 Record (1-10, 0-7) Fresno State 0 14 0 0 - 14 Record (1-11, 0-8) SCORING SUMMARY Plays TOP Score SCORING SUMMARY Plays TOP Score UH 2nd 05:43 LAKALAKA 1 yd run (SANCHEZ kick) 5-58 2:42 7-0 SJ 1st 00:41 CRAWLEY 8 yd pass from POTTER (CRAWFORD kick) 2-11 0:25 7-0 FS 2nd 00:10 CRONK 1 yd run (KROENING kick) 14-76 5:26 7-7 FS 2nd 08:40 JAMES 1 yd run (KROENING kick) 13-48 6:00 7-7 )6 UG .52(1,1*\G¿HOGJRDO FS 2nd 05:45 KLINE 32 yd run (KROENING kick) 3-56 0:56 7-14 )6 WK .52(1,1*\G¿HOGJRDO 6- UG &5$:)25'\G¿HOGJRDO UH 4th 00:59 LAKALAKA 2 yd run (SANCHEZ kick) 12-76 2:34 14-13 6- UG &5$:)25'\G¿HOGJRDO 6- WK &5$:)25'\G¿HOGJRDO TEAM STATS Hawai’i Fresno St. INDIVIDUAL LEADERS TEAM STATS San Jose St. Fresno St. INDIVIDUAL LEADERS First Downs 11 20 Rushing (att-yds-TD): First Downs 20 12 Rushing (att-yds-TD): Rushing Att-Yards 23-49 52-214 UH - Paul Harris (8-33-0) Rushing Att-Yards 48-211 41-96 FS - Dontel James (8-42-1) Passing Cmp-Att-Yds 20-31-227 13-23-108 FS - Josh Hokit (18-97-0) Passing Cmp-Att-Yds 15-25-111 11-19-149 SJ - Deontae Cooper (26-126-0) Total Plays-Yards 54-276 75-322 Passing (cmp-att-int-yds-TD): Total Plays-Yards 73-322 60-245 Passing (cmp-att-int-yds-TD): Fumbles-Lost 0-0 0-0 UH - Dru Brown (20-31-1-227-0) Fumbles-Lost 2-1 1-1 FS - Zach Kline (10-17-0-145-0) Penalties-Yards 11-89 7-64 FS - Zach Kline (13-23-0-108-0) Penalties-Yards 3-12 2-30 SJ - Kenny Potter (15-25-1-111-1) Punts-Yards 8-340 8-334 Receiving Yards (no-yds-TD): Punts-Yards 5-203 7-221 Receiving Yards (no-yds-TD): Average 42.5 41.8 UH - Marcus Kemp (8-65-0) Average 40.6 31.6 FS - Aaron Peck (6-63-0) Net 41.4 41.8 FS - KeeSean Johnson (3-38-0) Net 37.2 27.3 SJ - Justin Holmes (5-43-0) Punt Returns (#-Yds-TD) 0-0-0 3-9-0 Defense (ST-AT-TT-TFL-Sack): Punt Returns (#-Yds-TD) 2-30-0 2-17-0 Defense (ST-AT-TT-TFL-Sack): Kickoff Returns (#-Yds-TD) 2-40-0 2-42-0 UH - Jahlani Tavai (9-3-12-3.0-1.0) Kickoff Returns (#-Yds-TD) 3-63-0 1-19-0 FS - Stratton Brown (7-8-15-1.0-0.0) Interceptions-Yards-TD 0-0-0 1-0-0 FS - Stratton Brown (3-7-10-1.0-1.0) Interceptions-Yards-TD 0-0-0 1-0-0 SJ - Isaiah Irving (5-1-6-2.0-4.5) Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Fumble Ret-Yards-TD 0-0-0 0-0-0 Interceptions (no-yds-TD): Time of Possession 26:08 33:52 UH - None Time of Possession 33:19 26:41 FS - Stratton Brown (1-0-0) 3rd Downs 1-of-11 11-of-21 FS - Tyquwan Glass (1-0-0) 3rd Downs 6-of-15 5-of-14 SJ - None 4th Downs 1-of-1 0-of-0 4th Downs 0-of-1 0-of-2 Sacks By 1-6 3-19 Sacks By 4-17 2-12 FRESNO, Calif. – $\DUG¿HOGJRDOE\6DQ-RVH6WDWH FRESNO, Calif. – +DZDL¶L WRRN LWV ¿QDO GULYH in the fourth quarter turned out to be the difference on 76 yards on 12 plays for a go-ahead touchdown, 6DWXUGD\DIWHUQRRQDV)UHVQR6WDWHGURSSHGLWV¿QDOJDPH leaving Fresno State with the ball trailing 14-13 and of the season 16-14 to the Spartans at Bulldog Stadium. 59 seconds left in the game. Quarterbacked by Zach Kline, the Bulldogs drove the ball to the Hawai’i 26- 7KH %XOOGRJV 0: ¿QLVKHG ZLWK WRWDO yards of offense with 149 coming through the air and 96 yard line only to see Kody Kroening’s 43-yard game- on the ground. SJSU (4-8, 3-5 MW) countered with 322 winning attempt blocked as time expired on Saturday total yards, 211 on the ground and 111 passing. night’s game at Bulldog Stadium. Senior quarterback Zach Kline, making his second start The loss dropped Fresno State to 1-10 (0-7 MW) while RI WKH VHDVRQ ¿QLVKHG IRU SDVVLQJ IRU \DUGV Hawai’i kept its bowl chances alive, improving to 5-7 and added a 32-yard touchdown run. Junior running back (4-4 MW). Dontel James led the ‘Dogs with 42 yards rushing and a touchdown while freshman Josh Hokit added 33 yards. Prior to the Rainbow Warriors’ taking the lead with under a minute remaining, the Bulldogs punched Senior wide receiver Aaron Peck, playing in his 44th WKURXJKD\DUG¿HOGJRDOWRLQFUHDVHLWVOHDGWRVL[ DQG¿QDOFDUHHUJDPHDVD%XOOGRJOHGDOO)UHVQR6WDWH 13-7, capping a 15-play, 78-yard drive that lasted six receivers with six catches for 63 yards. Sophomore KeeSean Johnson added one reception, a career-long 53-yard JUDELQWKH¿UVWTXDUWHU minutes and six seconds. The Bulldogs’ drive started with 9:09 on the clock in the fourth quarter and pushed its lead to six, giving way to the ‘Bows’ offense with 3:03 remaining in the game. 'HIHQVLYHO\WKHVHQLRUGXRRI6WUDWWRQ%URZQDQG-HII&DPLOOL¿QLVKHGWKHLUFDUHHUVZLWKVWDQGRXWSHUIRUPDQFHV DV%URZQKDGWDFNOHVVHYHQVRORRQHWDFNOHIRUDORVVDSDVVEUHDNXSDQGKLV¿UVWFDUHHULQWHUFHSWLRQ&DPLOOL Fresno State limited Hawai’i to 276 yards offense and held the visiting team to 49 yards on the ground. The DGGHGVWRSVWZRWDFNOHVIRUDORVVDQGDVDFN-XQLRUOLQHEDFNHU5REHUW6WDQOH\DOVR¿QLVKHGZLWKGRXEOHGLJLW Bulldogs had allowed their opponent to rush for more than 200 yards in eight-straight games leading into tackles, a career-best 12, and half-a-sack. Saturday’s game. $IWHUDQHDUO\VFRUHOHVV¿UVWTXDUWHUWKH6SDUWDQVSXWDVWRSWRWKDWE\EORFNLQJDSXQWODWHLQWKHIUDPHJDLQLQJ The Bulldogs also stopped a six-game streak without an interception as Tyquwan Glass picked off his second possession at the Fresno State 11-yard line. SJSU broke through on the scoreboard with an 8-yard strike from pass of the season. quarterback Kenny Potter to Tim Crawley with 41 seconds remaining in the quarter to take a 7-0 lead. A game that saw a slow start, as nearly a quarter and half passed in which neither team could sustain a drive of Special teams swung in the favor of the Bulldogs next, thanks to a Fresno State punt that bounced off of a Spartan PRUHWKDQVL[SOD\V+DZDL¶LEURNHWKHGHDGORFNZLWKD¿YHSOD\\DUGWRXFKGRZQGULYHZLWKOHIWLQWKH defender and landed into the hands of sophomore DeShawn Potts at the SJSU 48-yard line. ¿UVWKDOI5XQQLQJEDFN6WHYHQ/DNDODNDHQGHGWKHGULYHZLWKD\DUGUXQ )UHVQR6WDWHSRVVHVVHGWKHEDOOIRUWKHVL[PLQXWHVDQGVHYHQVHFRQGVHQGLQJLQD'RQWHO-DPHV\DUGUXVKKLV¿IWK On the ensuing Fresno State possession, it was the Bulldogs who put points on the board. The ‘Dogs drove the rushing score of the season. The 13-play drive featured a 12-yard strike from Kline to Peck and an 11-yard pass to Jamire Jordan along with eight rushes for 14 yards. ball 75 yards (13 plays) and with 10 seconds remaining in the half and on the 1-yard line, the Bulldogs capped the drive with some trickery as Kline rolled to right and threw back to his left side, behind the line of scrimmage, 7KH%XOOGRJVZRXOGVFRUHDJDLQQH[WWDNLQJDOHDGZLWKOHIWLQWKH¿UVWKDOIDOWKRXJKLWZRXOGEHWKH¿QDO to offensive lineman Christian Cronk for a 1-yard rushing TD. Nine of the 13 plays during the possession went time the Bulldogs would score in Saturday’s game. After forcing the Spartans to turn the ball over on downs, the to Josh Hokit, who rushed for 48 yards on the drive. ‘Dogs took over at their own 44-yard line with 6:41 left in the frame. A nine-yard pass to senior Michael Martens and a 15-yard rush by Hokit put the ball into Spartans territory before Kline scampered for a career-long run of 32 The Bulldogs posted the only points of the third quarter, again aided by the rushing attack, Fresno State went to \DUGVIRUKLV¿UVWWRXFKGRZQUXQDVD%XOOGRJ 'RQWHO-DPHVVHYHQWLPHVEHIRUH.RG\.URHQLQJFRQQHFWHGRQD¿HOGJRDOIURP\DUGVRXW 7KH6SDUWDQVORRNHGDVLIWKH\ZHUHJRLQJWRFRXQWHUWKH%XOOGRJV¶WRXFKGRZQWRHQGWKH¿UVWKDOIEXW%URZQFDPH .URHQLQJ¶V\DUGHUZDVWKH/RX*UR]D$ZDUGVHPL¿QDOLVWV¶WKVWUDLJKWPDGH¿HOGJRDODQGWKH\DUG XSZLWKDWLPHO\LQWHUFHSWLRQKLV¿UVWFDUHHULQWKHHQG]RQHWRNHHSWKHµ'RJVLQWKHOHDGJRLQJLQWRWKHEUHDNWKH ¿HOGLQWKHIRXUWKWLHG.HYLQ*RHVVOLQJ¶VVHDVRQUHFRUGRIPDNLQJVWUDLJKWWULHV fourth time this season Fresno State has been in the lead at the half. A quick three-and-out by the Bulldogs started the third quarter, which signaled how the frame would play out. The Quotables Spartans controlled the clock in the third quarter, possessing the ball for 11:31 compared to 3:29 for the ‘Dogs. A 12- Interim head coach Eric Kiesau on how this loss feels compared to the others… SOD\\DUGGULYHE\6-68DWHXSDV%U\FH&UDZIRUGQDLOHGD\DUG¿HOGJRDOWRFXWWKH%XOOGRJVOHDGWR “This one is probably one of the tougher ones. Obviously the way that it revealed itself at the end. It burns 7KHHQVXLQJ)UHVQR6WDWHSRVVHVVLRQZDVDIXPEOHRQWKH¿UVWSOD\RIWKHGULYHDWWKH)UHVQR6WDWH\DUGOLQH because these kids are working really hard and I would like for it to pay off for them on just one Saturday afternoon. I am really proud of them, they had great effort and they fought. Even when we had our backs against 6DQ-RVH6WDWHFDSLWDOL]HGRQWKHWXUQRYHUEXWZLWKD¿HOGJRDO$VHYHQSOD\\DUGGULYHVWDOOHGDWWKH\DUG the wall with a minute left, they fought all the way down. It was unfortunate and it was just how the day went OLQHZKHQ&DPLOOLVWXIIHGWKH6SDUWDQVRQDWKLUGDQGWRIRUFH&UDZIRUGLQWRD\DUG¿HOGJRDOWKDWWULPPHGWKH today. I thought our guys played with a lot of class. There were some things in that game that were going on that ‘Dogs lead to 14-13 with 4:24 left in the third. they really represented themselves well, especially when it got a little feisty in there. I am proud of these kids.” After trading possessions without much action, a Fresno State punt from its own 12-yard line, which traveled 25 yards to the Fresno State 37-yard line set up San Jose State’s next three points, which turned out to be the decisive 4XDUWHUEDFN=DFK.OLQHRQJHWWLQJKLV¿UVWVWDUW« three points. “I’ve had a really long road. So I’ve waited my whole career for this. When I got the nod, I just felt like everything happens for a reason. God works in mysterious ways and he’s taught me a lot. These are the types The Spartans ran six consecutive runs for 32 yards down to the 5-yard line, but again stalled at the goal-line. of moments that change the culture of an entire university and program. These are the learning moments. We’re &UDZIRUGFRQQHFWHGRQD\DUG¿HOGJRDOZKLFKZRXOGWXUQRXWWREHWKHJDPHZLQQHUZLWKUHPDLQLQJLQ going to get out there and put it all on the line again, look up at the scoreboard and see what happens.” the game, for the 16-14 advantage. Quotables Notable Interim head coach Eric Kiesau on what he’s going to take away from this season… 4XDUWHUEDFN=DFK.OLQHSLFNHGXSKLV¿UVWFDUHHUVWDUW)UHVQR6WDWHQRZKDV¿UVWWLPHFDUHHUVWDUWHUVWKLVVHDVRQ “The best thing that I’m taking away from this season are the relationships I’ve built with the players. Even during 6L[GLIIHUHQW%XOOGRJVUHFRUGHGFDUULHVLQWKH¿UVWTXDUWHUE\URVWHUVSRWWKH\ZHUHTXDUWHUEDFN=DFK.OLQH a hard time, they really took to the message we were trying to instill in this program. I went from being the new wide receivers KeeSean Johnson, Jamire Jordan and Justin Allen, linebacker Josh Hokit and running back guy coming in to being placed into the head coaching role, they really bought in and brought great effort. Wins and Dontel James. For the game, nine registered carries. losses aside, this is a team I will never forget. There are some really great guys on this team, especially the seniors. 6WUDWWRQ%URZQOHGWKHWHDPLQWDFNOHV IRUWKH¿IWKVWUDLJKWJDPH%URZQKDVUHFRUGHGGRXEOHGLJLWWDFNOH I’m so glad that our paths crossed.” games in seven out of the last nine games. Notable 6WUDWWRQ%URZQQRZOHDGVWKHWHDPZLWKWDFNOHV7KHODVW%XOOGRJVWRUHFRUGWULSOHGLJLWWDFNOHVVLQFH%HQ 6WUDWWRQ%URZQSRVWHGKLVVL[WKVWUDLJKWJDPHZLWKGRXEOHGLJLWWDFNOHV+H¿QLVKHGZLWKWDFNOHV7KHPRVW Jacobs recorded 106 tackles in 2009. since 2007 when Marcus Riley recorded 132. +DZDL¶LZDVKHOGWR¿UVWGRZQVWKHOHDVWDPRXQWRI¿UVWGRZQVE\D%XOOGRJV¶RSSRQHQWVLQFH%RLVH6WDWH -HII&DPLOOL¿QLVKHGZLWKWDFNOHVLQ+HMRLQV6WUDWWRQ%URZQWREHFRPHWKH¿UVW)UHVQR6WDWHGXRWRKDYH totaled 11 in the 2014 Mountain West Championship. triple-digit tackles in a season since Tim Skipper (107) and Orlando Huff (105) did so in 2000. 7KLUGGRZQFRQYHUVLRQV)UHVQR6WDWHZDVRI ZKLOH+DZDL¶LZDVRI,WZDVWKH¿UVWWLPHWKLV )UHVQR6WDWHORVWJDPHVLQDVLQJOHVHDVRQIRUWKH¿UVWWLPHLQVFKRROKLVWRU\ VHDVRQ)UHVQR6WDWHKDVEHHQRYHUSHUFHQWLQWKLUGGRZQFRQYHUVLRQVWKLVVHDVRQDQG¿UVWWLPHEHWWHUWKDQ ,QWKUHHVHDVRQVDW)UHVQR6WDWH6WUDWWRQ%URZQUHFRUGHGRIKLVFDUHHUWDFNOHVLQ percent overall since vs. UNLV on Oct .16, 2015. )UHVQR6WDWHSRVWHGJDPHVZLWKLQWHUFHSWLRQVLQEDFNWREDFNJDPHVIRUWKH¿UVWWLPHVLQFH1RY±1RY &KULVWLDQ&URQNZDVWKH¿UVW%XOOGRJV¶RIIHQVLYHOLQHPDQWRVFRUHDWRXFKGRZQVLQFH$XVWLQ:HQWZRUWKYV )UHVQR6WDWHUHJLVWHUHG¿UVWGRZQVYV6DQ-RVH6WDWHIRUWKHVHDVRQ)UHVQR6WDWHDYHUDJHGSHUJDPH Cal Poly on Sept. 7, 2013. $DURQ3HFNSRVWHGKLVKLJKHVWUHFHSWLRQWRWDO VLQFH2FWYV6DQ'LHJR6WDWH )UHVQR6WDWHZDVOLPLWHGWRWZR¿UVWGRZQVDQG\DUGVWRWDORIIHQVHLQWKHVHFRQGKDOI 6DQ-RVH6WDWHKDGQRWZRQDJDPHZKHQWUDLOLQJDWKDOIWLPHVLQFHWUDLOLQJ:\RPLQJLQ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 75 RECORDS & HISTORY OFFENSIVE TEAM RECORDS RUSHING TOTAL OFFENSE MISCELLANEOUS Most rushes: Most plays (passing and rushing) 0RVW¿UVWGRZQV Game: ...... YV3DFL¿F6DQ-RVH6WDWH Game: ...... YV8WDK6WDWH Game: ...... YV,GDKR 6HDVRQ ...... 6HDVRQ ...... 6HDVRQ ...... 368, 2013 Most net yards gained: Most yards gained 0RVW¿UVWGRZQVUXVKLQJ Game: ...... 503, vs. Hawai`i, 2004 Game: ...... YV1HZ0H[LFR Game: ...... YV3DFL¿F 6HDVRQ ...... 6HDVRQ ...... 7,101, 2013 6HDVRQ ...... Most net yards lost: ...... YV%RZOLQJ*UHHQ Highest average per play 0RVW¿UVWGRZQVSDVVLQJ Game: ...... YV&RORUDGR Game: ...... YV81/9 Highest average per rush 6HDVRQ ...... 7.2, 2007 6HDVRQ ...... 221, 2013 Game: ...... YV1HZ0H[LFR 6HDVRQ ...... Highest average per game 0RVW¿UVWGRZQVSHQDOW\ ...... YV6DQ-RVH6WDWH Highest average per game 6HDVRQ ...... 546.2, 2013 6HDVRQ ...... Most penalties PUNTING Game: ...... YV6DQ-RVH6WDWH Most touchdowns 6HDVRQ ...... Most punts Game: ...... YV+DZDL¶L Game: ...... YV1R1HEUDVND ...... YV1HZ0H[LFR Most penalty yards ...... YV/RQJ%HDFK6WDWH 6HDVRQ ...... Game: ...... YV6DQ-RVH6WDWH 6HDVRQ ...... 87, 2003 6HDVRQ ...... PASSING Most yards Most fumbles Most attempts Game: ...... YV1R1HEUDVND 6HDVRQ ...... Game: ...... YV5XWJHUV 6HDVRQ ...... 3,432, 2014 6HDVRQ ...... 675, 2013 Most fumbles lost Highest average per punt Game: ...... YV6DQ'LHJR6WDWH Most completions Game: ...... YV6DQ-RVH6WDWH Game: ...... YV5XWJHUV 6HDVRQ ...... 6HDVRQ ...... 6HDVRQ ...... 461, 2013 Fewest fumbles lost (season): ...... RI Most had intercepted PUNT RETURNS Game: ...... YV,GDKR6WDWH+XPEROGW6WDWH SCORING 6HDVRQ ...... DQG Most punt returns Game: ...... YV%RZOLQJ*UHHQ Most touchdowns Game: ...... YV1HZ0H[LFR Most yards gained 6HDVRQ ...... [DQG 5XVKLQJ ...... YV1HZ0H[LFRYV+DZDLCL Game: ...... YV1HZ0H[LFR ...... YV3DFL¿F Most yards returned 3DVVLQJ ...... YV1HZ0H[LFR ...... YV6DQ'LHJR6WDWH Game: ...... YV:HEHU6WDWH 6HDVRQ ...... 71, 2013 6HDVRQ ...... 5,134, 2013 6HDVRQ ...... 636, 2001 Most points after touchdown Highest pct. Game: ...... YV1HZ0H[LFR Highest average per return Game: ...... YV$LU)RUFH 6HDVRQ ...... 71, 2013 6HDVRQ ...... 682, 2013 Game: ...... YV8WDK 6HDVRQ ...... IRU 0RVW¿HOGJRDOV Most yards per game Game: ...... YV8WDK6WDWH 6HDVRQ ...... KICKOFF RETURNS 6HDVRQ ...... 23, 2001 Most touchdowns Most kickoff returns Game: ...... YV1HZ0H[LFR Game: ...... YV%RLVH6WDWH 0RVWFRQVHFXWLYH¿HOGJRDOV ...... ...... DW6DQ-RVH6WDWH 6HDVRQ ...... 80, 2011 ...... 15, 2016 ...... YV/RQJ%HDFK6WDWH Most points by half ...... YV6DQ-RVH6WDWH Most yards returned )LUVWKDOI ...... YV1HZ0H[LFR ...... YV8WDK6WDWH Game: ...... YV1HZ0H[LFR6WDWH 6HFRQGKDOI ...... YV:DVKEXUQ 6HDVRQ ...... 50, 2013 6HDVRQ ...... 1,643, 2011 Fewest sacks allowed Most total points Highest average per return 6HDVRQ ...... 11, 2013 Game: ...... YV1HZ0H[LFR 6HDVRQ ...... IRU ...... 12, 2006 6HDVRQ ...... 564, 2013 DEFENSIVE TEAM RECORDS RUSHING TOTAL DEFENSE PUNTING Fewest rushes by opponent Fewest rushing and pass plays by opponent Most times opponent forced to punt Game: ...... 15, vs. Hawai`i, 2002 Game: ...... YV:KLWWLHU Game: ...... 'UDNH 6HDVRQ ...... 6HDVRQ ...... ...... &6)XOOHUWRQ ...... 6DFUDPHQWR6WDWH Fewest net yards by opponent Fewest yards gained by opponent 6HDVRQ ...... Game: ...... YV6DQ'LHJR6WDWH Game: ...... YV:KLWWLHU 6HDVRQ ...... 6HDVRQ ...... Lowest average per punt by opponent *DPH PLQ ...... 1HEUDVND Lowest average per rush by opponent Lowest average per play by opponent 6HDVRQ ...... Game: ...... LQDWWHPSWV YV6DFUDPHQWR6WDWH Game: ...... YV:KLWWLHU 6HDVRQ ...... IRU\GV 6HDVRQ ...... IRU RETURNS Fewest punt returns allowed by opponent (season): ...... 7, 2005 Fewest rushing touchdowns by opponent (season): ...... Fewest yards per game by opponent: ...... Fewest punt yards returned allowed by opponent (season): .... Fewest avg. rushing yards per game by opponent (season): ...... ...... 27, 2004 PASSING SCORING Lowest average kickoff per return by opponent (season): ...... Fewest attempts by opponent Fewest points allowed Game: ...... E\PDQ\ Game: ...... PDQ\WLPHV MISCELLANEOUS 6HDVRQ ...... 6HDVRQ ...... )HZHVWWRWDO¿UVWGRZQVE\RSSRQHQW Game: ...... YV)RUG2UG Fewest completions by opponent Fewest touchdowns allowed* (season): ...... Game: ...... E\PDQ\ VLQFH Most penalties by opponent 6HDVRQ ...... Game: ...... YV1HYDGD INTERCEPTIONS 6HDVRQ ...... Passes intercepted Game: ...... YV%RZOLQJ*UHHQ Game: ...... YV,GDKR6WDWH 6HDVRQ ...... Most yards penalized by opponent 6HDVRQ ...... Game: ...... YV/RQJ%HDFK6WDWH MOST INT RETURN FOR TD 6HDVRQ ...... Fewest passing yards per game by opponent Game: ...... IRXUWLPHV 6HDVRQ ...... 6HDVRQ ...... 6, 2012 Most fumbles by opponent (season): ...... ...... 4, 2004 , 2002 Most fumbles recovered: ...... Lowest completion percentage by opponent ...... Most fumbles by opponent (game): ...... YV%RLVH6WDWH 6HDVRQ ...... Fewest touchdowns passes by opponent (season): ...... E\PDQ\ 76 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY <($5%<<($57($067$76(since 1991) Scoring Rushing Passing Total Offense Year W-L-T TDs FGs Points Avg. 1st Downs Rush Yards TDs Avg/Gm Pass Comp. Att. Int. TD Yards Avg/Gm Total Plays Yards Avg/Gm Pen Yards <($5%<<($523321(1767$76(since 1991) Scoring Rushing Passing Total Offense Year Games TDs FGs Points Avg. 1st Downs Rush Yards TDs Avg/Gm Pass Comp. Att. Int. TD Yards Avg/Gm Total Plays Yards Avg/Gm Pen Yards 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 77 RECORDS & HISTORY ANNUAL LEADERS Annual Passing Yardage Leaders Annual Rushing Yardage Leaders 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 79 RECORDS & HISTORY ANNUAL LEADERS Annual Tackle Leaders Annual Sacks Leaders Annual Interception Leaders 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 81 RECORDS & HISTORY CHRONOLOGICAL LISTS $XJ 0LFKDHO3LWWPDQ 2UHJRQ 1RY 5\DQ0DWKHZV 8WDK6WDWH 6HSW 0LFKDHO*UD\ +DZDL¶L 1RY &OLIWRQ6PLWK DW1R+DZDL¶L 6HSW 0LFKDHO3LWWPDQ +DZDL¶L 1RY $QWKRQ\+DUGLQJ .DQVDV6WDWH 2FW 0LFKDHO3LWWPDQ DW81/9 1RY $QWKRQ\+DUGLQJ DW1HZ0H[LFR6WDWH 1RY 0LFKDHO3LWWPDQ %RLVH6WDWH 'HF &OLIWRQ6PLWK YV*HRUJLD7HFK 1RY 0LFKDHO3LWWPDQ &RORUDGR6WDWH 6HSW 5\DQ0DWKHZV DW5XWJHUV 1RY 0LFKDHO3LWWPDQ $LU)RUFH 6HSW 5\DQ0DWKHZV DW8&/$ $XJ -RH7XUQHU 3RUWODQG6WDWH 2FW /RQ\DH0LOOHU +DZDL¶L 6HSW 0LFKDHO3LWWPDQ %D\ORU 2FW $QWKRQ\+DUGLQJ +DZDL¶L 6HSW 0LFKDHO3LWWPDQ DW2UHJRQ 2FW /RQ\DH0LOOHU ,GDKR 2FW 0LFKDHO3LWWPDQ 8WDK 1RY $QWKRQ\+DUGLQJ 1HZ0H[LFR6WDWH 2FW 0LFKDHO3LWWPDQ DW1R$LU)RUFH 'HF $QWKRQ\+DUGLQJ YV&RORUDGR6WDWH 1RY 0LFKDHO3LWWPDQ DW6DQ-RVH6WDWH 'HF /RQ\DH0LOOHU YV&RORUDGR6WDWH 1RY 0LFKDHO3LWWPDQ :\RPLQJ 6HSW 5\DQ0DWKHZV 8&'DYLV 6HSW -DLPH.LPEURXJK DW1R&RORUDGR 6HSW 5\DQ0DWKHZV DW:LVFRQVLQ 6HSW -DLPH.LPEURXJK 1HYDGD 6HSW 5\DQ0DWKHZV 1R%RLVH6WDWH 2FW -DLPH.LPEURXJK 87(3 6HSW 5\DQ0DWKHZV DW1R&LQFLQQDWL 2FW -DLPH.LPEURXJK DW1HZ0H[LFR 2FW 5\DQ0DWKHZV DW+DZDL¶L 1RY -DLPH.LPEURXJK +DZDL¶L 2FW 5\DQ0DWKHZV 6DQ-RVH6WDWH 1RY -DLPH.LPEURXJK 6DQ-RVH6WDWH 2FW 5\DQ0DWKHZV DW1HZ0H[LFR6WDWH 6HSW 'HUULFN:DUG DW1HYDGD 2FW 5\DQ0DWKHZV 8WDK6WDWH 2FW 'HUULFN:DUG &RORUDGR6WDWH 1RY 5\DQ0DWKHZV DW,GDKR 1RY 'HUULFN:DUG 5LFH 'HF 5\DQ0DWKHZV DW,OOLQRLV 1RY 3DULV*DLQHV DW+DZDL¶L 'HF 5\DQ0DWKHZV YV:\RPLQJ 1RY -RVK/HYL 6DQ-RVH6WDWH 6HSW $-(OOLV DW8WDK6WDWH 6HSW -RVK/HYL DW7XOVD 2FW 5REELH5RXVH 1HZ0H[LFR6WDWH 6HSW 3DULV*DLQHV /RXLVLDQD7HFK 2FW 5REELH5RXVH DW6DQ-RVH6WDWH 2FW 3DULV*DLQHV DW&RORUDGR6WDWH 1RY 5REELH5RXVH DW/RXLVLDQD7HFK 1RY 3DULV*DLQHV 6DQ-RVH6WDWH 1RY 5REELH5RXVH 1HYDGD 6HSW 5RGQH\'DYLV DW1R2UHJRQ 6HSW 5REELH5RXVH DW1R1HEUDVND 2FW 5RGQH\'DYLV &RORUDGR6WDWH 6HSW 5REELH5RXVH 1RUWK'DNRWD 2FW 5RGQH\'DYLV 608 6HSW 5REELH5RXVH DW,GDKR 2FW 5RGQH\'DYLV +DZDL¶L 2FW 5REELH5RXVH 2OH0LVV 1RY 5RGQH\'DYLV 7XOVD 2FW 5REELH5RXVH 8WDK6WDWH 'HF 5RGQH\'DYLV DW/RXLVLDQD7HFK 2FW 5REELH5RXVH DW1HYDGD 'HF 5RGQH\'DYLV YV*HRUJLD7HFK 1RY 5REELH5RXVH DW+DZDL¶L 6HSW 'ZD\QH:ULJKW /RXLVLDQD7HFK 1RY 5REELH5RXVH 6DQ-RVH6WDWH 6HSW 'ZD\QH:ULJKW 3RUWODQG6WDWH 6HSW 5REELH5RXVH :HEHU6WDWH 1RY 'ZD\QH:ULJKW 6DQ-RVH6WDWH 6HSW 5REELH5RXVH DW1R2UHJRQ 6HSW 'ZD\QH:ULJKW DW:DVKLQJWRQ 6HSW 5REELH5RXVH &RORUDGR 6HSW %U\VRQ6XPOLQ 3RUWODQG6WDWH 6HSW 5REELH5RXVH DW7XOVD 6HSW :HQGHOO0DWKLV 3RUWODQG6WDWH 2FW 5REELH5RXVH DW&RORUDGR6WDWH 2FW :HQGHOO0DWKLV DW/RXLVLDQD7HFK 2FW 5REELH5RXVH DW1HZ0H[LFR 2FW %U\VRQ6XPOLQ 87(3 1RY 5REELH5RXVH +DZDL¶L 1RY %U\VRQ6XPOLQ +DZDL¶L 1RY 5REELH5RXVH DW1HYDGD 1RY :HQGHOO0DWKLV +DZDL¶L 1RY 5REELH5RXVH $LU)RUFH 1RY %U\VRQ6XPOLQ 1HYDGD 2FW 0DUWH]H:DOOHU DW,GDKR 1RY :HQGHOO0DWKLV 1HYDGD 1RY -RVK4XH]DGD 1HYDGD 1RY %U\VRQ6XPOLQ DW6DQ-RVH6WDWH 1RY -RVK4XH]DGD DW:\RPLQJ 1RY :HQGHOO0DWKLV DW6DQ-RVH6WDWH 6HSW 0DUWH]H:DOOHU 6RXWKHUQ8WDK 'HF :HQGHOO0DWKLV YV1R9LUJLQLD 6HSW 0DUWH]H:DOOHU DW1HZ0H[LFR 6HSW %U\VRQ6XPOLQ 7ROHGR 2FW 0DUWH]H:DOOHU DW81/9 2FW %U\VRQ6XPOLQ DW1HZ0H[LFR6WDWH 2FW 0DUWH]H:DOOHU DW%RLVH6WDWH 2FW :HQGHOO0DWKLV DW1HZ0H[LFR6WDWH 1RY 0DUWH]H:DOOHU :\RPLQJ 2FW :HQGHOO0DWKLV DW,GDKR 1RY 0DUWH]H:DOOHU 6DQ-RVH6WDWH 2FW :HQGHOO0DWKLV DW+DZDL¶L 1RY -RVK4XH]DGD 6DQ-RVH6WDWH 1RY :HQGHOO0DWKLV 6DQ-RVH6WDWH 1RY -RVK4XH]DGD DW1HYDGD 1RY :HQGHOO0DWKLV %RLVH6WDWH 1RY 0DUWH]H:DOOHU +DZDLCL 1RY :HQGHOO0DWKLV DW1R86& 6HSW 0DUWH]H:DOOHU $ELOHQH&KULVWLDQ 'HF :HQGHOO0DWKLV YV7XOVD 2FW 0DUWH]H:DOOHU 81/9 6HSW 'ZD\QH:ULJKW 1HYDGD 1RY 0DUWH]H:DOOHU &RORUDGR6WDWH 6HSW 'ZD\QH:ULJKW 1R2UHJRQ 6HSW 'RQWHO-DPHV 6DFUDPHQWR6WDWH 6HSW 'ZD\QH:ULJKW DW:DVKLQJWRQ 2FW 'RQWHO-DPHV DW1HYDGD 2FW 'ZD\QH:ULJKW DW8WDK6WDWH 2FW /RQ\DH0LOOHU +DZDL¶L Chronological List of 300-Yard Passing Games (94) 1RY 'ZD\QH:ULJKW 1HZ0H[LFR6WDWH 'DWH &PS 82 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY CHRONOLOGICAL LISTS 'HF -HII7HGIRUG YV%RZOLQJ*UHHQ 6HSW 'HUHN&DUU %RLVH6WDWH 6HSW .HYLQ6ZHHQH\ %RZOLQJ*UHHQ 6HSW 'HUHN&DUU DW+DZDL¶L 2FW .HYLQ6ZHHQH\ 6DQ-RVH6WDWH 2FW 'HUHN&DUU DW,GDKR 6HSW .HYLQ6ZHHQH\ 1HZ0H[LFR6WDWH 2FW 'HUHN&DUU 81/9 2FW .HYLQ6ZHHQH\ 8WDK6WDWH 1RY 'HUHN&DUU 1HYDGD 1RY .HYLQ6ZHHQH\ 0RQWDQD6WDWH 1RY 'HUHN&DUU DW:\RPLQJ 1RY .HYLQ6ZHHQH\ DW3DFL¿F 1RY 'HUHN&DUU 1HZ0H[LFR 6HSW .HYLQ6ZHHQH\ 0RQWDQD6WDWH 1RY 'HUHN&DUU DW6DQ-RVH6WDWH 6HSW .HYLQ6ZHHQH\ 2UHJRQ6WDWH 'HF 'HUHN&DUU YV8WDK6WDWHA 2FW .HYLQ6ZHHQH\ DW6DQ-RVH6WDWH 6HSW %ULDQ%XUUHOO DW1HZ0H[LFR 2FW 'DYH7HOIRUG DW3DFL¿F 2FW %ULDQ%XUUHOO DW81/9 1RY 'DYH7HOIRUG &6)XOOHUWRQ 1RY %ULDQ%XUUHOO DW1HYDGD 1RY 'DYH7HOIRUG DW8WDK6WDWH 'HF %ULDQ%XUUHOO DW%RLVH6WDWHA 6HSW 0DUN%DUVRWWL 1HZ0H[LFR 2FW &KDVRQ9LUJLO $LU)RUFH 6HSW 0DUN%DUVRWWL DW8WDK A 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH 1RY 0DUN%DUVRWWL DW81/9 6HSW 0DUN%DUVRWWL DW:DVKLQJWRQ6WDWH Chronological List of 100-Yard Receiving Games (188) 2FW 0DUN%DUVRWWL DW1HZ0H[LFR6WDWH 'DWH 5HF 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 83 RECORDS & HISTORY CHRONOLOGICAL LISTS 6HSW $QGUH$OHQDQGHU 0F1HHVH6WDWH 6HSW 0DUTXH'DYLV 2UHJRQ6WDWH 2FW 'ZLJKW3LFNHQV 8WDK6WDWH 1RY %HUQDUG%HUULDQ1R%RLVH6WDWH 1RY &UDLJ-RQHV 7( 3DFL¿F 1RY 0DUTXH'DYLV DW87(3 'HF $QGUH$OH[DQGHU YV:HVWHUQ0LFKLJDQ 6HSW 3DXO:LOOLDPV DW2UHJRQ 2FW 6WHSKHQ6KHOOH\ 8WDK6WDWH 1RY 3DXO:LOOLDPV 6DQ-RVH6WDWH 1RY 6WHSKHQ6KHOOH\ DW1HZ0H[LFR 1RY 3DXO:LOOLDPV %RLVH6WDWH 6HSW &KULV*DZOH\ DW8WDK 1RY -RH)HUQDQGH] DW1HYDGD 2FW 7\GXV:LQDQV DW1HZ0H[LFR6WDWH 2FW 0DUORQ0RRUH +DZDL¶L 6HSW 0DOFROP6HDEURQ DW2UHJRQ6WDWH 1RY 0DUORQ0RRUH .DQVDV6WDWH 1RY 0DOFROP6HDEURQ 8WDK 1RY 0DUORQ0RRUH DW1HZ0H[LFR6WDWH 1RY 0DOFROP6HDEURQ DW6DQ'LHJR6WDWH 6HSW 6H\L$MLURWXWX DW5XWJHUV 1RY &KDUOLH-RQHV DW87(3 1RY 6H\L$MLURWXWX DW/RXLVLDQD7HFK 6HSW &KDUOLH-RQHV DW%D\ORU 6HSW 'HYRQ:\OLH DW:LVFRQVLQ 6HSW /HH+DUULV DW%D\ORU 2FW 6H\L$MLURWXWX 8WDK6WDWH 6HSW &KDUOLH-RQHV 8WDK6WDWH 1RY 0DUORQ0RRUH DW1HYDGD 2FW $QWKRQ\'DLJOH 5% DW&RORUDGR6WDWH 6HSW -DPHO+DPOHU DW2OH0LVV 2FW &KDUOLH-RQHV DW%<8 6HSW 0DWW/LQGVD\ DW2OH0LVV 1RY &KDUOLH-RQHV +DZDL¶L 1RY -DPHO+DPOHU DW/RXLVLDQD7HFK 'HF 'DYLG'XQQ YV1R&RORUDGR 6HSW -DOHQ6DXQGHUV 1RUWK'DNRWD 6HSW &KDUOLH-RQHV 6DQ-RVH6WDWH 6HSW -DOHQ6DXQGHUV DW,GDKR 6HSW %ULDQ5REHUVRQ 6DQ-RVH6WDWH 2FW -DOHQ6DXQGHUV 2OH0LVV 2FW &KDUOLH-RQHV 1R%<8 2FW 'HYRQ:\OLH DW1HYDGD 2FW &KDUOLH-RQHV :\RPLQJ 1RY 'HYRQ:\OLH /RXLVLDQD7HFK 1RY %ULDQ5REHUVRQ DW87(3 1RY -DOHQ6DXQGHUV DW1HZ0H[LFR6WDWH 1RY %ULDQ5REHUVRQ DW6DQ'LHJR6WDWH 1RY ,VDLDK%XUVH 6DQ-RVH6WDWH 6HSW %ULDQ5REHUVRQ 1(/RXLVLDQD 'HF -DOHQ6DXQGHUV DW6DQ'LHJR6WDWH 6HSW &KDUOLH-RQHV DW8&/$ 6HSW 'DYDQWH$GDPV :HEHU6WDWH 2FW -DKLQH$UQROG DW6DQ'LHJR6WDWH 6HSW ,VDLDK%XUVH &RORUDGR 2FW -DKLQH$UQROG $LU)RUFH 6HSW -RVK+DUSHU DW7XOVD 1RY -DKLQH$UQROG DW+DZDL¶L 6HSW -RVK+DUSHU 6DQ'LHJR6WDWH 1RY &KDUOLH-RQHV DW+DZDL¶L 6HSW 'DYDQWH$GDPV 6DQ'LHJR6WDWH 1RY &KDUOLH-RQHV 87(3 6HSW 5DVKDG(YDQV 6DQ'LHJR6WDWH 1RY &KDUOLH-RQHV DW:\RPLQJ 2FW 'DYDQWH$GDPV DW1HZ0H[LFR 1RY %ULDQ5REHUVRQ %<8 1RY 'DYDQWH$GDPV DW1HYDGD 6HSW %ULDQ5REHUVRQ DW8WDK 1RY ,VDLDK%XUVH $LU)RUFH 6HSW %ULDQ5REHUVRQ +DZDL¶L 1RY 'DYDQWH$GDPV $LU)RUFH 2FW %ULDQ5REHUVRQ 6DQ-RVH6WDWH 'HF 'DYDQWH$GDPV YV608 1RY %ULDQ5REHUVRQ %RLVH6WDWH $XJ 'DYDQWH$GDPV 5XWJHUV 1RY %ULDQ5REHUVRQ $LU)RUFH $XJ ,VDLDK%XUVH 5XWJHUV 1RY %ULDQ5REHUVRQ DW6DQ'LHJR6WDWH 6HSW ,VDLDK%XUVH %RLVH6WDWH 6HSW &KDUOHV6PLWK 1HYDGD 6HSW 'DYDQWH$GDPV %RLVH6WDWH 2FW &KDUOHV6PLWK DW8WDK 6HSW -RVK+DUSHU DW+DZDL¶L 1RY &KDUOHV6PLWK +DZDL¶L 2FW 'DYDQWH$GDPV DW,GDKR 6HSW &KDUOHV6PLWK DW1HYDGD 2FW 'DYDQWH$GDPV 81/9 2FW 5RGQH\:ULJKW DW608 1RY -RVK+DUSHU 1HYDGD 2FW 5RGQH\:ULJKW 87(3 1RY -RVK+DUSHU DW:\RPLQJ 1RY 5RGQH\:ULJKW 6DQ-RVH6WDWH 1RY 'DYDQWH$GDPV 1HZ0H[LFR 6HSW 5RGQH\:ULJKW &DOLIRUQLD 1RY -RVK+DUSHU 1HZ0H[LFR 2FW %HUQDUG%HUULDQ 1HYDGD 1RY ,VDLDK%XUVH 1HZ0H[LFR 2FW %HUQDUG%HUULDQ 7XOVD 1RY 'DYDQWH$GDPV DW6DQ-RVH6WDWH 1RY %HUQDUG%HUULDQ +DZDL¶L 'HF ,VDLDK%XUVH YV8WDK6WDWHA 1RY %HUQDUG%HUULDQ DW1R7&8 'HF 'DYDQWH$GDPV YV8WDK6WDWHA 1RY &KDUOHV6PLWK DW6DQ-RVH6WDWH 6HSW 'D¶0DUL6FRWW 6RXWKHUQ8WDK 'HF %HUQDUG%HUULDQ YV$LU)RUFH 2FW -RVK+DUSHU DW81/9 'HF 3DULV*DLQHV 5% YV$LU)RUFH 'HF -RVK+DUSHU DW%RLVH6WDWHA 6HSW 5RGQH\:ULJKW 1R2UHJRQ6WDWH 6HSW -DPLUH-RUGDQ 1R8WDK 6HSW %HUQDUG%HUULDQ DW1R:LVFRQVLQ 6HSW $DURQ3HFN DW1HEUDVND 6HSW %HUQDUG%HUULDQ DW7XOVD 6HSW -DPLUH-RUGDQ 6DFUDPHQWR6WDWH 2FW 5RGQH\:ULJKW DW&RORUDGR6WDWH 6HSW -DPLUH-RUGDQ 7XOVD 2FW 5RGQH\:ULJKW %RLVH6WDWH 2FW $DURQ3HFN DW81/9 2FW 5RGQH\:ULJKW DW+DZDL¶L 2FW .HH6HDQ-RKQVRQ $LU)RUFH 2FW %HUQDUG%HUULDQ DW+DZDL¶L 2FW -DPLUH-RUGDQ $LU)RUFH 1RY 5RGQH\:ULJKW 5LFH A 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH 1RY %HUQDUG%HUULDQ DW1HYDGD 1RY %HUQDUG%HUULDQ 6DQ-RVH6WDWH Chronological List of Interceptions Returned for TDs (50) 'HF %HUQDUG%HUULDQ 8WDK6WDWH 'DWH 84 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY CHRONOLOGICAL LISTS 2FW 0LFKDHO6WHZDUW DW8WDK6WDWH 6HSW 1DWH5D\ 3RUWODQG6WDWH 6HSW 5RG:HEVWHU DW:DVKLQJWRQ6WDWH 1RY &KDVWLQ:HVW DW%RLVH6WDWH 2FW .HLWK0F&R\ 81/9 1RY $--HIIHUVRQ 8WDK6WDWH 2FW -DPHV:LOOLDPV 8WDK6WDWH 1RY $--HIIHUVRQ DW1R+DZDL¶L 'HF 5RQ&R[ YV%DOO6WDWH 1RY $--HIIHUVRQ 1HYDGD 2FW -DPHV%XUWRQ 1HZ0H[LFR 1RY 7RQ\%URZQ &6)XOOHUWRQ Chronological List of Punts Returned for TDs (36) 6HSW 6DP:DWVRQ &RORUDGR6WDWH 'DWH 86 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY SELECT CIRCLES 6HSW +DZDL¶L 5XVKHU0LFKDHO*UD\ \DUG5XVKHU %RZO*DPH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 87 RECORDS & HISTORY INDIVIDUAL RUSHING RECORDS Rushing Yards (Career) Rushing Touchdowns (Career) Rushing Yards Per Carry (Career) 5REELH5RXVH 5\DQ0DWKHZV Minimum 200 Attempts 5RQ5LYHUV 5REELH5RXVH 5RQ5LYHUV 5\DQ0DWKHZV $QWKRQ\'DLJOH 0DUWH]H:DOOHU %U\VRQ6XPOLQ Rushing Yards Per Carry (Season) 0LFKDHO3LWWPDQ 0LFKDHO3LWWPDQ Minimum 50 Attempts 'ZD\QH:ULJKWµ 'HDQ3KLOSRWW 'RQ'ULVFRO 'HDQ3KLOSRWW 5RQ5LYHUV /RUHQ]R1HDO :HQGHOO0DWKLV Rushing Yards Per Carry (Game) %U\VRQ6XPOLQ /RUHQ]R1HDO Under 10 Attempts $DURQ&UDYHU $DURQ&DUYHU 1. /DUU\:LOORXJKE\YV1HYDGD :HQGHOO0DWKLV .HOO\6NLSSHU -DLPH.LPEURXJK Rushing Yards Per Carry (Game) .HOO\6NLSSHU Rushing Touchdowns (Season) Minimum 10 Attempts 5\DQ0DWKHZV 7HG7RURVLDQ 'RQ'ULVFROO 6DQ)UDQFLVFR6W $QWKRQ\'DLJOH $QWKRQ\'DLJOH /DUU\:LOORXJKE\ DW6DQ'LHJR6W $DURQ&UDYHU /RQ\DH0LOOHU %RE*DUQHU DW%<8 :HQGHOO0DWKLV 'RQ'ULVFROO &DO6WDWH/$ 5HJJLH%URZQ 'HUULFN:DUG DW1HYDGD Rushing Yards (Season) 5\DQ0DWKHZV 5\DQ0DWKHZV 1R%RLVH6W 5\DQ0DWKHZV 5RQ5LYHUV 5\DQ0DWKHZV DW1HYDGD 5RGQH\'DYLV 0\URQ-RQHV %U\VRQ6XPOLQ +DZDL¶L 5REELH5RXVH -DPHV:LOOLDPV -DLPH.LPEURXJK 87(3 5REELH5RXVH 'DOH0HVVHU 5RQ5LYHUV 'HDQ3KLOSRWW /RQ\DH0LOOHU ,GDKR 'ZD\QH:ULJKW :HQGHOO0DWKLV DW+DZDL¶L 0DUWH]H:DOOHU Rushing Touchdowns (Game) :HQGHOO0DWKLV 'RQ'ULVFROO &6/RV$QJHOHV Rushing Yards Per Carry (Game) $DURQ&UDYHU 0LFKDHO3LWWPDQ 6DQ-RVH6WDWH Minimum 20 Attempts -DLPH.LPEURXJK 1XPHURXV3OD\HUV 'ZD\QH:ULJKW DW/RXLVLDQD7HFK 0LFKDHO3LWWPDQ 5\DQ0DWKHZV 6DQ-RVH6W 5REELH5RXVH Consecutive Games with Rushing TD 0LFKDHO3LWWPDQ %RLVH6W -DPHV:LOOLDPV 5RQ5LYHUV 5RGQH\'DYLV 608 -HURPH2OLYHU :HQGHOO0DWKLV 'HDQ-RQHV DW0RQWDQD6W %U\VRQ6XPOLQ 5REELH5RXVH /RUHQ]R1HDO DW3DFL¿F /DUU\:LOORXJKE\ $DURQ&UDYHU A /DUU\:LOORXJKE\ 6DQ)UDQFLVFR6W 0LFKDHO3LWWPDQ 'DOH0HVVHU 6DQ'LHJR6W 3DULV*DLQHV A0LVVHGJDPHGXULQJVWUHDN 5REELH5RXVH 1HYDGD 'ZD\QH:ULJKW /RQ\DH0LOOHU +DZDL¶L 5RQ5LYHUV Rushing Attempts (Career) -DLPH.LPEURXJK DWQHZ0H[LFR $DURQ&UDYHU 5REELH5RXVH 5RQ5LYHUV 87(3 0LFKDHO3LWWPDQ -DPHV:LOOLDPV /RQJ%HDFK6W Longest Runs From Scrimmage 0DUWH]H:DOOHU 5REELH5RXVH &RORUDGR 5\DQ0DWKHZV Most 100-Yard Rushing Games (Career) -RVK/HYL 6DQ-RVH6WDWH 5RQ5LYHUV 5REELH5RXVH %LOO Top 50 Single-Game Rushing Bests 3OD\HU 2SSRQHQW ^ Mountain West Championship Game * Bowl Game 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 91 RECORDS & HISTORY INDIVIDUAL PASSING RECORDS Passing Yards (Career) 'DYH7HOIRUG 8WDK6WDWH Pass Completion Percentage (Career) 'HUHN&DUU 'HUHN&DUU 1HYDGD Minimum 300 Completions .HYLQ6ZHHQH\ 'HUHN&DUU %RLVH6WDWH 'HUHN&DUU RI 3DXO3LQHJDU 'HUHN&DUU /RXLVLDQD7HFK 'DYLG&DUU RI 0DUN%DUVRWWL 'HUHN&DUU DW6DQ-RVH6WDWH 5\DQ&ROEXUQ RI 'DYLG&DUU 'HUHN&DUU DW,GDKR 3DXO3LQHJDU RI %LOO\9ROHN RI 7UHQW'LOIHU 7UHQW'LOIHU YV&RORUDGR 'HUHN&DUU YV8WDK6WDWH 7UHQW'LOIHU RI 7RP%UDQGVWDWHU 7RP%UDQGVWDWHU RI %LOO\9ROHN 'HUHN&DUU DW6DQ'LHJR6WDWH 'DYLG&DUU YV0LFKLJDQ6WDWH 'DYH7HOIRUG RI 5\DQ&ROEXUQ 5LFKLH'RQDWL RI -HII7HGIRUG Passing Attempts (Career) .HYLQ6ZHHQH\ RI 'HUHN&DUU Passing Yards (Season) 3DXO3LQHJDU Pass Completion Percentage (Season) 'HUHN&DUU .HYLQ6ZHHQH\ Minimum 75 Attempts 'DYLG&DUU 0DUN%DUVRWWL 'HUHN&DUU RI 'HUHN&DUU 7RP%UDQGVWDWHU 'HUHN&DUU RI %LOO\9ROHN RI 7UHQW'LOIHU %LOO\9ROHN 'HUHN&DUU 'DYLG&DUU RI 'DYLG&DUU 0DUN%DUVRWWL RI 3DXO3LQHJDU 7UHQW'LOIHU 7UHQW'LOIHU RI .HYLQ6ZHHQH\ 'DQQ\5RELQVRQ 3DXO3LQHJDU RI 7UHQW'LOIHU 5\DQ&ROEXUQ 5\DQ&ROEXUQ RI -HII7HGIRUG 7RP%UDQGVWDWHU RI 3DXO3LQHJDU Passing Attempts (Season) 'HUHN&DUU RI 'HUHN&DUU Passing Completions (Career) 'DYLG&DUU Pass Completion Percentage (Game) 'HUHN&DUU 'HUHN&DUU Minimum 10 Attempts, no more than 20 Attempts 'HUHN&DUU 3DXO3LQHJDU 5\DQ&ROEXUQ RI DW,GDKR %ULDQ%XUUHOO 0DUN%DUVRWWL RI DW1HZ0H[LFR .HYLQ6ZHHQH\ .HYLQ6ZHHQH\ 'DYLG&DUU 3DXO3LQHJDU Pass Completion Percentage (Game) 7RP%UDQGVWDWHU 3DXO3LQHJDU Minimum 20 Attempts %LOO\9ROHN 7UHQW'LOIHU 'HUHN&DUU RI $LU)RUFH 0DUN%DUVRWWL %LOO\9ROHN .HYLQ6ZHHQH\ RI :LFKLWD6WDWH 7UHQW'LOIHU 7UHQW'LOIHU RI DW%D\ORU 5\DQ&ROEXUQ Passing Attempts (Game) 'HUHN&DUU RI :HEHU6WDWH 'DQQ\5RELQVRQ 'HUHN&DUU 5XWJHUV .HYLQ6ZHHQH\ RI DW3DFL¿F 'DYH7HOIRUG 8WDK6WDWH 'HUHN&DUU RI /RXLVLDQD7HFK Passing Completions (Season) 7UHQW'LOIHU YV&RORUDGR 'HUHN&DUU 'HUHN&DUU %RLVH6WDWH Most Touchdown Passes (Career) 'HUHN&DUU %ULDQ%XUUHOO 1R1HEUDVND 'HUHN&DUU 'DYLG&DUU 'HUHN&DUU DW6DQ'LHJR6WDWH 3DXO3LQHJDU 'HUHN&DUU 'DYLG&DUU YV0LFKLJDQ6W 'DYLG&DUU 'HUHN&DUU 1HYDGD .HYLQ6ZHHQH\ 3DXO3LQHJDU %LOO\9ROHN 7UHQW'LOIHU 'HUHN&DUU 6DQ'LHJR6WDWH 'HUHN&DUU YV86& 7UHQW'LOIHU %ULDQ%XUUHOO 'HUHN&DUU YV608 0DUN%DUVRWWL %LOO\9ROHN 3DXO3LQHJDU /RXLVLDQD7HFK 7RP%UDQGVWDWHU 3DXO3LQHJDU 7UHQW'LOIHU DW&RORUDGR6W -HII7HGIRUG .HYLQ6ZHHQH\ 'HUHN&DUU YV8WDK6WDWH 'DQQ\5RELQVRQ 3DXO3LQHJDU DW%RLVH6WDWH Passing Completions (Game) .HYLQ6ZHHQH\ 0RQWDQD6WDWH * Mountain West Record 'HUHN&DUU 5XWJHUV 'HUHN&DUU DW6DQ-RVH6WDWH ! Led NCAA 'HUHN&DUU 6DQ'LHJR6WDWH -HII7HGIRUG %RZOLQJ*UHHQ Top 50 Single-Game Passing Bests 3OD\HU 2SSRQHQW Most Games With 5 or More TD Passes (Career) Lowest Interception Percentage (Season) 'HUHN&DUU Minimum 100 Attempts 'DYLG&DUU 1DPH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 93 RECORDS & HISTORY 3,000-YARD PASSING SEASONS (8) .HYLQ6ZHHQH\ &$, %RZO*DPH A0RXQWDLQ:HVW&KDPSLRQVKLS*DPH 94 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY RECEIVING RECORDS Pass Receptions (Career) Receiving Yardage (Career) 'DYDQWH$GDPV &KDUOLH-RQHV Receiving Touchdowns (Career) -RVK+DUSHU 5RGQH\:ULJKW 'DYDQWH$GDPV 5RGQH\:ULJKW 'DYDQWH$GDPV -RVK+DUSHU ,VDLDK%XUVH %ULDQ5REHUVRQ %HUQDUG%HUULDQ %HUQDUG%HUULDQ +HQU\(OODUG &KDUOLH-RQHV %ULDQ5REHUVRQ -RVK+DUSHU +HQU\(OODUG &KDUOLH-RQHV %HUQDUG%HUULDQ 5RGQH\:ULJKW ,VDLDK%XUVH &KDUOHV6PLWK &KDUOHV6PLWK &KDUOHV6PLWK /DUU\:LOOLV 0DOFROP6HDEURQ /DUU\:LOOLV -RH)HUQDQGH] 0DUTXH'DYLV 6H\L$MLURWXWX ,VDLDK%XUVH Pass Receptions (Season) 0DUTXH'DYLV 0DOFROP6HDEURQ -DOHQ6DXQGHUV 'DYDQWH$GDPV %ULDQ5REHUVRQ 5RGQH\:ULJKW -RKQ6H[WRQ 'DYDQWH$GDPV A Receiving Yardage (Season) ,VDLDK%XUVH 1 'DYDQWH$GDPV 5RGQH\:ULJKW Receiving Touchdowns (Season) -RVK+DUSHU 'DYDQWH$GPDV %HUQDUG%HUULDQ +HQU\(OODUG %HUQDUG%HUULDQ +HQU\(OODUG -RVK+DUSHU 'DYDQWH$GDPV A /DUU\:LOOLV 'DYDQWH$GDPV A /DUU\:LOOLV -RVK+DUSHU %ULDQ5REHUVRQ %HUQDUG%HUULDQ 5RQ-HQNLQV %ULDQ5REHUVRQ &KDUOLH-RQHV -DOHQ6DXQGHUV Pass Receptions (Game) -RVK+DUSHU 0DOFROP6HDEURQ ,VDLDK%XUVH YV8WDK6WDWH -DOHQ6DXQGHUV 5RGQH\:ULJKW -RVK+DUSHU 1HYDGD *DU\%RUHKDP 'DYDQWH$GDPV DW,GDKR Yards Per Reception (Career) &KDUOLH-RQHV 5RQ-HQNLQV DW3DFL¿F Minimum 50 Receptions -RKQ6H[WRQ /DUU\:LOOLV 0RQWDQD6WDWH 6WHSKHQ%DNHU &KXFN7R\ 6WHSKRQH3DLJH %RZOLQJ*UHHQ -DOHQ6DXQGHUV /OR\G0DGGHQ DW3DFL¿F Receiving Touchdowns (Game) 'DYDQWH$GDPV 5XWJHUV Yards Per Reception (Career) 'DYDQWH$GDPV 1HZ0H[LFR -RVK+DUSHU 5XWJHUV +HQU\(OODUG 'DYDQWH$GDPV 81/9 5RGQH\:ULJKW %RLVH6WDWH -DOHQ6DXQGHUV &KDUOLH-RQHV 87(3 'DYDQWH$GDPV DW6DQ-RVH6WDWH 6WHSKRQH3DLJH -LP0ROLFK 2FFLGHQWDO ,VDLDK%XUVH 5XWJHUV 5. .HH6HDQ-RKQVRQ $LU)RUFH 'DYDQWH$GDPV YV608 Yards Per Reception (Game) 'DYDQWH$GDPV DW6DQ-RVH6WDWH 'HYRQ:\OLH /RXLVLDQD7HFK Minimum 5 Receptions -RVK+DUSHU 1HZ0H[LFR %HUQDUG%HUULDQ %RLVH6WDWH $DURQ3HFN 81/9 'DYDQWH$GDPV DW,GDKR 5RGQH\:ULJKW YV0LFKLJDQ6WDWH &KDUOLH-RQHV :\RPLQJ 5DVKDG(YDQV 6DQ'LHJR6WDWH 5RGQH\:ULJKW &DOLIRUQLD +HQU\(OODUG DW1HYDGD %HUQDUG%HUULDQ 8WDK6WDWH /DUU\:LOOLV 1HZ0H[LFR6W +HQU\(OODUG 0RQWDQD6WDWH /DUU\:LOOLV 1HZ0H[LFR6WDWH -RVK+DUSHU DW81/9 -DOHQ6DXQGHUV DW,GDKR +HQU\(OODUG /RQJ%HDFK6WDWH 'DYDQWH$GDPV DW6DQ'LHJR6WDWH &KDUOLH-RQHV 87(3 6WHSKRQH3DLJH 3DFL¿F 'DYDQWH$GDPV %RLVH6WDWH 'DYDQWH$GDPV 81/9 /OR\G0DGGHQ DW3DFL¿F 'DYDQWH$GDPV DW1R2UHJRQ 'DYDQWH$GDPV 1HZ0H[LFR 'DYDQWH$GPDV DW:\RPLQJ 'DYDQWH$GDPV :\RPLQJ %ULDQ5REHUVRQ DW6DQ'LHJR6W 26. .HH6HDQ-RKQVRQ $LU)RUFH -DPLUH-RUGDQ DW8WDK6WDWH LONGEST PASS COMPLETIONS -RVK+DUSHU DW%RLVH6WDWHa Yards Quarterback Receiver Opponent TD ,VDLDK%XUVH DW6DQ-RVH6WDWH 3DXO3LQHJDU 3DXO:LOOLDPV %RLVH6WDWH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 95 RECORDS & HISTORY Consecutive Games with a Touchdown Consecutive 100-Yard Receiving Games 'DYDQWH$GDPV 'DYDQWH$GDPV 'DYDQWH$GDPV 5RGQH\:ULJKW +HQU\(OODUG +HQU\(OODUG -DOHQ6DXQGHUV -RVK+DUSHU %HUQDUG%HUULDQ 'DYDQWH$GDPV 5RGQH\:ULJKW Most TD Passes Caught of 50+ Yards (Career) Receiving Touchdowns by a TE (Season) +HQU\(OODUG 0DUW\7KRPSVRQ -DOHQ6DXQGHUV &KDG2OVHQ 'DYDQWH$GDPV 0DUFHO-HQVHQ %HDU3DVFRH Most TD Passes Caught of 50+ Yards (Season) $OHF*UHFR +HQU\(OODUG 9LQFH%UDQVWHWWHU -DOHQ6DXQGHUV %LOO\-DFN3LHUFH 'DYDQWH$GDPV 'DYDQWH$GDPV Consecutive Games with a Catch +HQU\(OODUG Pass Receptions by a Running Back (Career) 'DYDQWH$GDPV 1DPH 5HF Top 50 Single-Game Receiving Bests 3OD\HU 2SSRQHQW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 97 RECORDS & HISTORY TOTAL OFFENSE/ALL-PURPOSE RECORDS Total Offensive Yardage (Career) All-Purpose Yardage (Career) Rushing and Passing Yardage 3OD\HU Average Per Play (Career) $OO3XUSRVH Top 25 Single-Game Total Offense Bests 3OD\HU 2SSRQHQW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 99 RECORDS & HISTORY DEFENSIVE INDIVIDUAL RECORDS Solo Tackles Sacks Passes intercepted (Game) Game: ...... 6WHYH&RUGOHYV$UL]RQD Game: ...... 5RQ&R[YV&6)XOOHUWRQ ...... -LP6DQGHUVRQYV6DQ'LHJR6WDWH ...... .HQW3DLQHYV/RQJ%HDFK6WDWH ..3,7RP0F&DOOYV0RQWDQD6WDQG&6/RV$QJHOHV8 ...... .DUO0LFNHOVHQYV%RLVH6WDWH Sacks (Season) ...... 6WHYH&RUGOHYV2UHJRQ 5RQ&R[ ...... 28.0 ...... 5RG:HEVWHUYV2UHJRQ6WDWH Assisted Tackles -HWKUR)UDQNOLQ ...... ...... 3KLOOLS7KRPDVYV&RORUDGR Game: .. &KXFN0F&XWFKHQYV6DQ-RVH6W 5RQ&R[ ...... 14.5 ...... %HQ-DFREVYV7H[DV$ 0 $ODQ+DUSHU ...... 12.0 Passes Intercepted (Season) -HWKUR)UDQNOLQ ...... 12.0 3OD\HU Best Interception Return Average (Career) min. 2 INT Player ...... No. ..Yds .....Avg ...TD 1. 5LFKDUG0DUVKDOO .. .....305..... ...... 3 &DOYLQ/DQH ..... .....243.....27.0 ...... 0 5RG:HEVWHU ...17 ....340.....20.0 ...... 2 'HUURQ6PLWK ..15 ......... ...... 2 -LP6DQGHUVRQ 16 ....284.....17.8 ...... 0 Longest Interception Return: ...... *DU\+D\HVYV/RQJ%HDFK6WDWH )XOOVHDVRQLQFOXGHV)UHVQR6WDWHERZOJDPH VWDWLVWLFV 0RXQWDLQ:HVW5HFRUG 1&$$5HFRUG 1&$$/HDGHU 100 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY BULLDOG STADIUM RECORDS FIRST DOWNS TOTAL OFFENSE 7RWDO¿UVWGRZQV ...... $LU)RUFHYV)UHVQR6WDWH Total offensive plays 5XVKLQJ ...... $LU)RUFHYV)UHVQR6WDWH ,QGLYLGXDO ...... 'HUHN&DUUYV5XWJHUV $XJ 3DVVLQJ ...... 6DQ-RVH6WDWH+DZDLCL Team: ...... %RLVH6WDWH 3HQDOW\ ...... )UHVQR6WDWHYV6DQ-RVH6WDWH ...... 81/9 ...... )UHVQR6WDWHYV&6)XOOHUWRQ ...... 7XOVD ...... )UHVQR6WDWHYV1HYDGD ...... 8WDK6WDWHYV)UHVQR6WDWH Total yards )HZHVWWRWDO¿UVWGRZQV ...... 6DFUDPHQWR6WDWH ,QGLYLGXDO ...... 5XVKLQJ ...... 8WDK+DZDLCL ...... SDVVLQJUXVKLQJ 'HUHN&DUU )6 YV6DQ'LHJR6WDWH 3DVVLQJ ...... 6RXWKHUQ,OOLQRLV6DFUDPHQWR6WDWH Team: ...... )UHVQR6WDWHYV1HZ0H[LFR 3HQDOW\ ...... E\PDQ\ Touchdowns responsible for: ...... 7 RUSHING ...... SDVVLQJ 'HUHN&DUUYV1HZ0H[LFR 1RY Rushing attempts $YHUDJHJDLQSHUSOD\7HDP ...... )UHVQR6WDWHYV&RORUDGR ,QGLYLGXDO ...... '¶$QJHOR%UHZHU 7XOVD YV)UHVQR6WDWH )HZHVWRIIHQVLYHSOD\V7HDP ...... /RQJ%HDFK6WDWHYV)UHVQR6WDWH Team: ...... $LU)RUFHYV)UHVQR6WDWH /RZHVWWRWDORIIHQVH7HDP ...... &6)XOOHUWRQYV)UHVQR6WDWH Yards rushing /RZHVWDYHUDJHSHUSOD\7HDP ...... &6)XOOHUWRQYV)UHVQR6WDWH ,QGLYLGXDO ...... %ULDQ+LOO :\RPLQJ YV)UHVQR6WDWH Team: ...... )UHVQR6WDWHYV+DZDLCL FUMBLES /RQJHVWUXVK ...... 5REELH5RXVHYV&RORUDGR )XPEOHV ...... 7ROHGR 'HF ...... -RVK/HYLYV6DQ-RVH6WDWH )XPEOHVORVW ...... )6YV+DZDLCL%<8 )HZHVWUXVKLQJDWWHPSWV ...... 8WDK )HZHVW\DUGVUXVKLQJ ...... )6YV/RQJ%HDFK6WDWH PENALTIES )HZHVWQHW\DUGVUXVKLQJ ...... )UHVQR6WDWHYV%RZOLQJ*UHHQ 3HQDOWLHV ...... )6YV6DQ-RVH6WDWH 3HQDOW\\DUGV ...... )6YV6DQ-RVH6WDWH PASSING )HZHVWSHQDOWLHV ...... 3DFL¿F Passes attempted )HZHVWSHQDOW\\DUGV ...... 3DFL¿F ,QGLYLGXDO ...... 'HUHN&DUU )UHVQR6WDWH YV5XWJHUV $XJ Team: ...... )UHVQR6WDWHYV5XWJHUV $XJ INTERCEPTIONS ,QGLYLGXDO ...... 'DPHRQ%DEHU 1HYDGD YV)UHVQR6WDWH Passes completed ...... 3KLOOLS7KRPDV )6 YV&RORUDGR ,QGLYLGXDO ...... 'HUHN&DUU )UHVQR6WDWH YV5XWJHUV $XJ ...... 6WHYH&RUGOH )6 YV2UHJRQ Team: ...... )UHVQR6WDWHYV5XWJHUV $XJ Team: ...... 5, ...... YV7ROHGR 'HF YV2UHJRQ6WDWH 6HSW Touchdowns ...... )6YV8WDK6WDWH)6YV1HZ0H[LFR ,QGLYLGXDO ...... 'HUHN&DUUYV1HZ0H[LFR 1RY Team: ...... )UHVQR6WDWHYV1HZ0H[LFR 1RY Interception yards: ,QGLYLGXDO ...... 1DWH5D\ )6 YV608 Had intercepted Team: ...... 124, ,QGLYLGXDO ...... 6WHYH&ODUNVRQ 6DQ-RVH6WDWH YV7ROHGR 'HF ...... )UHVQR6WDWHYV1HYDGD Team: ...... 6DQ-RVH6WDWH 'HF 1HZ0H[LFR /RQJHVWUHWXUQ ...... 1DWH5D\ )6 YV608 Yards passing PUNTING ,QGLYLGXDO ...... 'HUHN&DUU )UHVQR6WDWH YV6DQ'LHJR6WDWH Punts Team: ...... )UHVQR6WDWH 6HSW ,QGLYLGXDO ...... 3KLO1HYLQ &6)XOOHUWRQ YV)UHVQR6WDWH Team: ...... &6)XOOHUWRQYV)6 Fewest passes attempted ...... 6DFUDPHQWR6WDWHYV)6 Team: ...... $LU)RUFH Punting yards Fewest yards passing ,QGLYLGXDO ...... 3KLO1HYLQ &6)XOOHUWRQ YV)UHVQR6WDWH Team: ...... 1RUWKHUQ,OOLQRLVYV)UHVQR6WDWH Team: ...... &6)XOOHUWRQYV)UHVQR6WDWH Longest pass: Average yards per punt ...... \DUGV3DXO3LQHJDUWR3DXO:LOOLDPV )UHVQR6WDWH YV%RLVH6WDWH ,QGLYLGXDO PLQ ...... IRU 5REHUW0DORQH )6 YV6DQ-RVH6W 7HDP PLQ ...... IRU )UHVQR6WDWHYV6DQ-RVH6W Best completion percentage: /RQJHVWSXQW ...... [ODVW5REHUW0DORQH)UHVQR6WDWHYV6DQ-RVH6W ...... 6WHYH6DUNLVLDQ %<8 YV)UHVQR6WDWH )HZHVWSXQWV ...... YV6DQ-RVH6W)UHVQR6WDWHYV+DZDLCL )HZHVWSXQWLQJ\DUGV PLQ ...... 18, vs. Hawai`i, 2004 RECEPTIONS /RZHVWDYHUDJH\DUGVSXQW PLQ .... 3DFL¿FYV)UHVQR6WDWH Most receptions ,QGLYLGXDO ...... *HUDOG:LOOKLWH 6DQ-RVH6WDWH YV7ROHGR 'HF Most yards ,QGLYLGXDO ...... /DUU\:LOOLV )UHVQR6WDWH YV0RQWDQD6WDWH Average yards per reception ,QGLYLGXDO PLQ ... IRU -DOHQ6DQXGHUV )6 YV1RUWK'DNRWD 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 101 RECORDS & HISTORY BULLDOG STADIUM RECORDS PUNT RETURNS Most punt returns Points after touchdown made ,QGLYLGXDO ...... 8, ,QGLYLGXDO ...... 'HUHN0DKRQH\ )6 YV1HZ0H[LFR ...... 7RPP\3XUYLV 3DFL¿F YV)UHVQR6WDWH 0RVWWZRSRLQWFRQYHUVLRQV ...... 6DQ-RVH6WDWH ...... (ULF)R[ )6 YV%RZOLQJ*UHHQ ...... /DUU\:LOOLV )6 YV%RZOLQJ*UHHQ Kick scoring ...... 0DOFROP6HDEURQ )6 YV&6)XOOHUWRQ ,QGLYLGXDO ...... %DUU\%HOOL )6 YV8WDK6WDWH ...... $GDP-HQQLQJV )6 YV87(3 Team: ...... [ODVWYV87(3 /RQJHVW¿HOGJRDO ,QGLYLGXDO ...... %DUU\%HOOL )6 YV0RQWDQD6WDWH Most punt return yards ,QGLYLGXDO ...... &OLIWRQ6PLWK )6 YV:HEHU6WDWH Longest rush touchdown Team: ...... )UHVQR6WDWHYV%RLVH6WDWH ,QGLYLGXDO ...... 5REELH5RXVHYV&RORUDGR ...... -RVK/HYLYV6DQ-RVH6WDWH Highest average per return: (min. 3) ...... IRU &OLIWRQ6PLWK )6 YV:HEHU6WDWH 0RVW+RPH:LQV ...... 0RVW+RPH/RVVHV...... Longest return: ...... &OLIWRQ6PLWK )6 YV:HEHU6WDWH MOST POINTS KICKOFF RETURNS Game ,QGLYLGXDO ...... /D9RQ(GZDUGV 8WDK YV)UHVQR6WDWH )UHVQR6WDWH ...... YV1HZ0H[LFR ...... ,VDLDK%XUVH )6 YV%RLVH6WDWH 2SSRQHQW ...... +DZDL¶L Team: ...... [ODVWE\1HZ0H[LFRYV)UHVQR6WDWH Season Kickoff return yards )UHVQR6WDWH ...... ,QGLYLGXDO ...... &DUORV:LJJLQV 1HZ0H[LFR YV)UHVQR6WDWH 2SSRQHQW ...... Team: ...... 1HZ0H[LFRYV)UHVQR6WDWH +LJKHVWDYHUDJHSHUUHWXUQ PLQ ...... 44.7 FEWEST POINTS ...... %URFN6PLWK )6 YV6DQ-RVH6WDWH Game )HZHVWNLFNRIIUHWXUQV...... [ODVWYV6DFUDPHQWR6WDWH )UHVQR6WDWH ...... YV6DQ'LHJR6WDWH Team: ...... 0, 2SSRQHQW ...... VHYHUDOWLPHVODVW)UHVQR6WDWHYV8&'DYLV ... YV&DO3RO\YV0RQWDQD6WDWHYV8WDK6WDWHYV/RXLVLDQD 7HFKYV6DFUDPHQWR6WDWH Season )HZHVWNLFNRIIUHWXUQ\DUGV ...... [ODVWYV6DFUDPHQWR6WDWH )UHVQR6WDWH ...... 123, 2016 /RQJHVWUHWXUQ ...... -DQDULRQ*UDQW 5XWJHUV YV)UHVQR6WDWH 2SSRQHQW ...... ...... :DGH/RFNHWW &6)XOOHUWRQ YV)UHVQR6WDWH &RQVHFXWLYH:LQV ...... IURP2FW6HSW ...... IURP2FW6HSW SCORING &RQVHFXWLYH/RVVHV ...... IURP6HSW(QGRIVHDVRQ Most points scored /DVW7LH ...... 2FWYV8WDK6WDWH ,QGLYLGXDO ...... 7'V 'DYDQWH$GDPV )6 YV81/9 ...... 7'V 'DYDQWH$GDPV )6 YV1HZ0H[LFR ...... 7'V 5REELH5RXVH )6 YV&RORUDGR ...... 7'V 0DUN%DUVRWWL )6 YV8WDK Team: ...... )UHVQR6WDWHYV1HZ0H[LFR Most points scored )LUVWTXDUWHU ...... )UHVQR6WDWHYV&RORUDGR 6HFRQGTXDUWHU ...... )UHVQR6WDWHYV1HZ0H[LFR 7KLUGTXDUWHU ...... )UHVQR6WDWHYV1HZ0H[LFR )RXUWKTXDUWHU ...... :\RPLQJYV)UHVQR6WDWH Most points scored )LUVWKDOI ...... 44 )UHVQR6WDWHYV1HZ0H[LFR 6HFRQGKDOI ...... 44 )UHVQR6WDWHYV6DQ-RVH6WDWH ...... 44 YV$LU)RUFHYV)UHVQR6WDWH )HZHVWSRLQWVVFRUHG ...... VHYHUDOWLPHVODVW608YV)UHVQR6WDWH /DUJHVWPDUJLQRIYLFWRU\ ...... )UHVQR6WDWHYV1HZ0H[LFR 0RVWWRXFKGRZQV ...... )UHVQR6WDWHYV1HZ0H[LFR 5XVKLQJ ...... )UHVQR6WDWHYV1HZ0H[LFRYV+DZDLCL 3DVVLQJ ...... )UHVQR6WDWHYV1HZ0H[LFR ...... 6DQ-RVH6WDWHYV)UHVQR6WDWH 0RVW¿HOGJRDOVDWWHPSWHG ,QGLYLGXDO ...... %DUU\%HOOL )6 YV8WDK6WDWH 0RVW¿HOGJRDOVPDGH ,QGLYLGXDO ...... %DUU\%HOOL )6 YV8WDK6WDWH Team: ...... )6YV8WDK6WDWH Points after touchdown attempted ,QGLYLGXDO ...... 'HUHN0DKRQH\ )6 YV1HZ0H[LFR 102 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1921 1926 1931 Record: 4-4-0 Record: 5-3-1 Record: 4-6-0 Home: 2-3-0 | Away: 2-1-0 Home: 4-2-0 | Away: 1-1-1 Home: 3-4-0 | Away: 1-2-0 Head Coach: Arthur W. Jones Head Coach: Arthur W. Jones Head Coach: Stanley E. Borleske 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG /D9HUQH : DW6WDQIRUG / 1RUWKHUQ$UL]RQD / DW&DO7HFK : 8&6DQWD%DUEDUD : :KLWWLHU : DW3DFL¿F / 1HYDGD / /D9HUQH / &DO7HFK : /D9HUQH : 6DQ-RVH6WDWH : &KLFR6WDWH / DW6DQ'LHJR6WDWH : DW1HYDGD / DW0RGHVWR-& : 6DQ-RVH6WDWH : DW8&'DYLV : 6DQ-RVH6WDWH / 8&'DYLV : DW&KLFR6WDWH / )UHVQR+LJK / 6DLQW0DU\¶V / 3DFL¿F : DW3DFL¿F 7 $UL]RQD6WDWH / 1922 6DQ'LHJR6WDWH / 5HFRUG Home: 3-1-1 | Away: 4-0-1 Record: 3-3-2 1932 Head Coach: Arthur W. Jones Home: 3-1-2 | Away: 0-2-0 Record: 3-5-2 California Coast Conference Champions Head Coach: Arthur W. Jones Home: 3-3-0 | Away: 0-2-2 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Stanley E. Borleske DW7XODUH+LJK : DW6WDQIRUG / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW/HPRRUH+LJK : DW8&/$ / 6DQ'LHJR0DULQHV : 0RGHVWR-& 7 1HYDGD : :HVW&RDVW$UP\ / DW/R\ROD : 6W,JQDWLXV 7 8&'DYLV / 5HHGOH\+LJK : 6DQ-RVH6WDWH : 6DQ)UDQFLVFR6WDWH : 6WDQIRUG)URVK / 8&'DYLV / DW6DQ-RVH6WDWH 7 &DO3RO\ : 6DQWD&ODUD 7 DW3DFL¿F / DW8&'DYLV 7 3DFL¿F : DW1RUWKHUQ$UL]RQD 7 DW%DNHUV¿HOG-& : DW:DVKEXUQ / 3DFL¿F : 1928 /D9HUQH : Record: 2-5-1 1HYDGD / 1923 Home: 2-4-0 | Away: 0-1-1 5HFRUG Head Coach: Arthur W. Jones 1933 Home: 4-0-0 | Away: 3-2-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Record: 5-4-0 Head Coach: Arthur W. Jones &DO3RO\ : Home: 4-2-0 | Away: 1-2-0 California Coast Conference Champions 8&6DQWD%DUEDUD : Head Coach: Leo Harris 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6W,JQDWLXV / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 5HHGOH\ : 6WDQIRUG / &DO7HFK : DW&DUXWKHUV/HJLRQ : DW3DFL¿F / /D9HUQH : 6DFUDPHQWR-& : DW1HYDGD 7 &DOLIRUQLD-9V / DW8&'DYLV : 6DQWD&ODUD / &DO3RO\3RPRQD : DW0RGHVWR-& : 8&'DYLV / DW8&'DYLV : DW1HYDGD / DW$UL]RQD6WDWH / 5HGODQGV : 1929 :DVKEXUQ : %DNHUV¿HOG-& : 5HFRUG DW6DQ-RVH6WDWH / DW6DQ'LHJR / Home: 1-3-0 | Away: 0-4-0 3DFL¿F / Head Coach: Stanley E. Borleske 1924 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 1934 5HFRUG /R\ROD / 5HFRUG Home: 5-0-0 | Away: 2-2-0 DW8&/$ / Home: 5-2-1 | Away: 2-0-0 Head Coach: Arthur W. Jones 2O\PSLF&OXE / Head Coach: Leo Harris 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW&KLFR6WDWH / Far Western Conference Co-Champions DW1HYDGD / DW1HYDGD / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG &DO&KULVWLDQ : DW8&'DYLV / 6DQ)UDQFLVFR6WDWH : %DNHUV¿HOG-& : 6DQ-RVH6WDWH / 86&-9V : 0RGHVWR-& : 3DFL¿F : &DOLIRUQLD-9V / 0DUH,VODQG1DY\ : DW1RUWKHUQ$UL]RQD : DW&DO3RO\ : 1930 DW3DFL¿F : DW3DFL¿F : Record: 8-0-0 6DQWD&ODUD / 6DQ'LHJR6WDWH : Home: 4-0-0 | Away: 4-0-0 6DQ-RVH6WDWH 7 DW&KLFR6WDWH / Head Coach: Stanley E. Borleske 8&'DYLV : Far Western Conference Champions &DO7HFK : 1925 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 1HYDGD : Record: 2-6-1 DW&DO&KULVWLDQ : Home: 2-4-0 | Away: 0-2-1 5HGODQGV : Head Coach: Arthur W. Jones DW/R\ROD : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG &KLFR6WDWH : DW0RGHVWR-& 7 DW3DFL¿F : 2FFLGHQWDO / 8&'DYLV : 6DQWD&ODUD / DW6DQ-RVH6WDWH : 6DQ-RVH6WDWH : 1HYDGD : 8&'DYLV / DW1HYDGD / %DUEDULDQV : 3DFL¿F / DW6DLQW0DU\¶V / 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 103 RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1935 1939 1944 Record: 6-3-0 Record: 9-1-0 Record: 0-6 Home: 3-3-0 | Away: 3-0-0 Home: 6-1-0 | Away: 3-0-0 Home: 0-3-0 | Away: 0-3-0 Head Coach: Leo Harris Head Coach: James Bradshaw Head Coach: Earl Wright Far Western Conference Champions 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 87(3 : DW0LQWHU)LHOG / /D9HUQH : DW8&6DQWD%DUEDUD : DW6DOLQDV-& / &DOLIRUQLD-9V / 1HYDGD : DW0RGHVWR-& / 6DQWD&ODUD / &DOLIRUQLD-9V : 0LQWHU)LHOG / DW&KLFR6WDWH : 6DQ)UDQFLVFR : 7RQRSDK$UP\$LU)LHOG / &DO7HFK : 3DFL¿F : 3DFL¿F / 3DFL¿F : 3RUWODQG : DW1HYDGD : 6DQ-RVH6WDWH / DW8&'DYLV : DW+DZDLCL : 1945 6DQ)UDQFLVFR / DW+HDODQL$& : Record: 4-6-2 Home: 0-2-2 | Away: 4-3-0 | Bowl: 0-1-0 1936 Head Coach: Alvin “Pix” Pierson Record: 5-3-1 1940 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 5-1-1 | Away: 0-2-0 Record: 9-2-1 &DO3RO\ 7 Head Coach: James Bradshaw Home: 6-1-0 | Away: 3-1-1 DW3DFL¿F : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: James Bradshaw 0LQWHU)LHOG 7 6DQ)UDQFLVFR / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW1RUWKHUQ$UL]RQD : :KLWWLHU : :KLWWLHU : DW&DO3RO\ : 1RUWKHUQ$UL]RQD : 8&6DQWD%DUEDUD : DW6%0DULQHV / &DOLIRUQLD-9V : :HVW7H[DV6WDWH : 6DQ'LHJR6WDWH / &KLFR6WDWH : DW3DFL¿F : DW1HYDGD / :LOODPHWWH 7 DW6DQ'LHJR6WDWH 7 6DLQW0DU\¶V / DW3DFL¿F / 1HYDGD : DW&DPS%HDOH / 1HYDGD : UTEP W 16-6 10,024 DW3DFL¿F : DW+DUGLQ6LPPRQV / 6DQ-RVH6WDWH / 5DLVLQ%RZO )UHVQR&DOLI &RORUDGR6FKRRORI0LQHV W 28-0 7,256 - 'UDNH / DW&HQWUDO$UNDQVDV / DW+HDODQL$& : Record: 8-1-1 - DW+DZDLCL : 1946 Home: 3-1-1 | Away: 4-0-0 | Bowl: 1-0-0 Record: 8-4-0 Head Coach: James Bradshaw Home: 5-1-0 | Away: 3-3-0 Far Western Conference Champions 1941 Head Coach: James Bradshaw 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Record: 4-3-2 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 86&-9V 7 Home: 1-0-0 | Away: 3-3-2 6DQWD&ODUD : DW:LOODPHWWH : Head Coach: James Bradshaw +DZDLCLDQ$OO6WDUV : &DOLIRUQLD-9V : California Collegiate Athletic Assoc. Champions DW2NODKRPD&LW\ / DW:KLWWLHU : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW8&6DQWD%DUEDUD : DW8&'DYLV : DW:HVW7H[DV6WDWH / DW6DQ'LHJR6WDWH / &KLFR6WDWH : DW&DPS+DDQ 7 /R\ROD : DW1HYDGD : DW8&6DQWD%DUEDUD : Hawai`i L 2-7 11,057 +DUGLQ6LPPRQV / DW1HYDGD : 3DFL¿F : 3DFL¿F : 6DQ'LHJR6WDWH : DW6DQ-RVH6WDWH / /LWWOH$OO$PHULFDQ%RZO /RV$QJHOHV&DOLI DW6DQ)UDQFLVFR / ,GDKR : ' YV&HQWUDO$UNDQVDV : DW3DFL¿F : DW0ROLL%HDUV : DW6DQ-RVH6WDWH 7 DW/HLOHKDX$OXPQL : DW$UL]RQD6WDWH / 1938 5HFRUG Home: 6-2-0 | Away: 1-1-0 1942 Record: 3-6-2 Head Coach: James Bradshaw Record: 9-1-0 Home: 3-3-1 | Away: 0-3-1 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 6-1-0 | Away: 3-0-0 Head Coach Kenny Gleason 6DQ'LHJR0DULQHV : Head Coach: James Bradshaw 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG &DOLIRUQLD-9V : California Collegiate Athletic Assoc. Champions 2NODKRPD&LW\ / &HQWUDO$UNDQVDV : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 0ROLL%HDUV : DW1HYDGD : :KLWWLHU : 6DQWD&ODUD / 8&'DYLV : 2FFLGHQWDO : &DO3RO\ : DW3DFL¿F / DW6DQ'LHJR6WDWH : +RQROXOX$OO6WDUV / 6DQ)UDQFLVFR / 0DUFK)LHOG : 6DQ'LHJR6WDWH 7 Hawai`i W 15-13 4,866 )RUW2UG : DW1HZ0H[LFR / 8&6DQWD%DUEDUD : DW3DFL¿F : DW8&6DQWD%DUEDUD 7 ' 87(3 / 1HYDGD : DW3DFL¿F / 6DQ)UDQFLVFR / 6DQ-RVH6WDWH : 6DQ-RVH6WDWH : DW+DZDLCL / DW/R\ROD : 1943 No football due to World War II 104 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1948 1952 1956 Record: 3-6-1 Record: 8-2-0 Record: 8-2-0 Home: 3-3-1 | Away: 0-3-0 Home: 5-1-0 | Away: 3-1-0 Home: 4-2-0 | Away: 4-0-0 Head Coach Kenny Gleason Head Coach: Clark Van Galder Head Coach: Clark Van Galder 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG California Collegiate Athletic Assoc. Champions 3RUWODQG 7 6 8&'DYLV : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6DQWD&ODUD / 2 3HSSHUGLQH : 6 DW%<8 : DW&DO3RO\ / 2 DW6DQ-RVH6WDWH / 6 DW:LOODPHWWH : 8&6DQWD%DUEDUD : 2 8WDK6WDWH : 2 6DQ'LHJR0DULQHV : DW3HSSHUGLQH / 2 DW2FFLGHQWDO : 2 3DFL¿F / 1HZ0H[LFR : 1 DW6DQ'LHJR6WDWH : 2 6DQ)UDQFLVFR6WDWH : 6DQ'LHJR6WDWH : 1 DW1HYDGD : 2 +DZDLCL : 1HYDGD / 1 3DFL¿F / 1 ,GDKR / DW6DQ-RVH6WDWH / 1 6DQ)UDQFLVFR6WDWH : 1 &DO3RO\ : 3DFL¿F / 1 :KLWWLHU : 1 DW6DQ'LHJR6WDWH : 1 DW6DQ-RVH6WDWH : 1949 1953 Record: 3-8-0 Record: 4-4-2 Home: 3-3-0 | Away: 0-5-0 Home: 4-2-1 | Away: 0-2-1 Record: 5-5-0 Head Coach: Alvin “Pix” Pierson Head Coach: Clark Van Galder Home: 3-2-0 | Away: 2-3-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Clark Van Galder &DO3RO\ : 6 &DO3RO\ / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW8&6DQWD%DUEDUD / 2 6DQ-RVH6WDWH / 6 0RQWDQD6WDWH / 6DQWD&ODUD / 2 DW&DO6WDWH/$ / 6 DW3DFL¿F / DW1HYDGD / 2 1HYDGD : 2 6DQ'LHJR0DULQHV / DW/R\ROD / 2 8&6DQWD%DUEDUD : 2 DW6DQ)UDQFLVFR6WDWH : $ODPHGD$LU3DF : 2 6DQ'LHJR6WDWH 7 2 DW&DO3RO\ / 6DQ'LHJR6WDWH / 1 DW8WDK6WDWH / 2 DW,GDKR / 3HSSHUGLQH : 1 6DQ)UDQFLVFR6WDWH : 1 6DQ'LHJR6WDWH : DW3DFL¿F / 1 3HSSHUGLQH : 1 %<8 : 6DQ-RVH6WDWH / 1 DW3DFL¿F 7 1 6DQ-RVH6WDWH : DW+DZDLCL / 1 DW+DZDLCL : Total Att: 81,002 _$YJ 1954 Home Att:_$YJ 1950 5HFRUG Record: 2-6-1 Home: 4-2-0 | Away: 3-1-0 Home: 1-4-0 | Away: 1-2-1 Head Coach: Clark Van Galder 1958 Head Coach: Duke Jacobs California Collegiate Athletic Assoc. Champions Record: 5-5-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 4-2-0 | Away: 1-3-0 +DZDLCL : 6 +DZDLCL / Head Coach: Clark Van Galder DW6DQ'LHJR6WDWH 7 2 &DO6WDWH/$ : California Collegiate Athletic Assoc. Champions 8&6DQWD%DUEDUD / 2 8WDK6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG DW&DO3RO\ : 2 DW1HYDGD : 6 DW%<8 / DW6DQ-RVH6WDWH / 2 DW8&6DQWD%DUEDUD : 6 6DQ'LHJR0DULQHV / 3DFL¿F / 2 DW6DQ'LHJR6WDWH : 2 DW8&6DQWD%DUEDUD / /R\ROD / 1 &DO3RO\ : 2 &DO3RO\ : DW3HSSHUGLQH / 1 6DQ'LHJR0DULQHV / 2 DW&DO6WDWH/$ : 1RUWK7H[DV6WDWH / 1 DW6DQ-RVH6WDWH / 1 6DQ'LHJR6WDWH : 1 6DQ)UDQFLVFR6WDWH : 1 /RQJ%HDFK6WDWH : Total Att: 75,451_$YJ 1 DW6DQ-RVH6WDWH / 1951 Home Att:_$YJ 1 6DQ)UDQFLVFR6WDWH : Record: 5-5-0 1 3DFL¿F / Home: 3-4-0 | Away: 2-1-0 Head Coach: Duke Jacobs 1955 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Record: 9-1-0 1959 6 DW8&'DYLV : Home: 6-0-0 | Away: 3-1-0 5HFRUG 6 3HSSHUGLQH : Head Coach: Clark Van Galder Home: 4-2-0 | Away: 3-1-0 2 6DQ-RVH6WDWH / California Collegiate Athletic Assoc. Champions Head Coach: Cecil Coleman 2 8&6DQWD%DUEDUD / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG California Collegiate Athletic Assoc. Champions 2 &DO3RO\ : 6 DW6DQ)UDQFLVFR6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 2 2FFLGHQWDO : 2 :LOODPHWWH : 6 %<8 : 1 6DQ'LHJR6WDWH / 2 6DQ'LHJR1DY\ : 2 8&6DQWD%DUEDUD : 1 DW:KLWWLHU : 2 1HYDGD : 2 6DQ'LHJR0DULQHV / 1 DW1RUWK7H[DV6WDWH / 2 6DQ'LHJR0DULQHV : 2 6DQ-RVH6WDWH / 1 6DQ)UDQFLVFR6WDWH / 2 DW8WDK6WDWH / 2 DW&DO3RO\ : Total Att:_$YJ 1 6DQ'LHJR6WDWH : 2 6DQ'LHJR6WDWH : Home Att:_$YJ 1 DW&DO3RO\ : 1 DW3DFL¿F / 1 6DQ-RVH6WDWH : 1 DW/RQJ%HDFK6WDWH : 1 DW+DZDLCL : 1 &DO6WDWH/$ : 1 DW+DZDLCL : Total Att: _$YJ Home Att:_$YJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 105 RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1960 1964 1968 Record: 9-1-0 Record: 4-6-0 5HFRUG Home: 6-1-0 | Away: 3-0-0 Home: 4-1-0 | Away: 0-5-0 Home: 5-1-0 | Away: 2-2-0 | Bowl: 0-1-0 Head Coach: Cecil Coleman Head Coach: Phil Krueger Head Coach: Darryl Rogers California Collegiate Athletic Assoc. Champions 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG California Collegiate Athletic Assoc. Champions 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 6RXWK'DNRWD6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 +DZDLCL : 6 DW0RQWDQD6WDWH / 6 ,GDKR6WDWH / 6 DW8&6DQWD%DUEDUD : 2 +DZDLCL : 6 DW6DQ-RVH6WDWH / 2 $ELOHQH&KULVWLDQ : 2 DW,GDKR6WDWH / 2 DW3RUWODQG6WDWH : 2 &DO3RO\ : 2 &DO3RO\ : 2 &61RUWKULGJH : 2 DW&DO6WDWH/$ : 2 DW&DO6WDWH/$ / 2 &DO3RO\ : 2 6DQ'LHJR6WDWH : 2 DW6DQ'LHJR6WDWH / 2 DW&DO6WDWH/$ : 1 /RQJ%HDFK6WDWH : 1 /RQJ%HDFK6WDWH / 1 DW6DQ'LHJR6WDWH / 1 DW6DQ-RVH6WDWH : 1 3DFL¿F : 1 /RQJ%HDFK6WDWH : 1 0RQWDQD6WDWH / 1 DW6DQ-RVH6WDWH / 1 0RQWDQD6WDWH : 1 3DFL¿F : Total Att: 86,160_$YJ 1 3DFL¿F : Home Att:_$YJ &DPHOOLD%RZO 6DFUDPHQWR&DOLI ' YV+XPEROGW6WDWH / 1961 Record: 10-0-0 1965 Home: 4-0-0 | Away: 5-0-0 | Bowl: 1-0-0 Record: 6-4-0 1969 Head Coach: Cecil Coleman Home: 3-2-0 | Away: 3-2-0 Record: 6-4-0 California Collegiate Athletic Assoc. Champions Head Coach: Phil Krueger Home: 4-1-0 | Away: 2-3-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Darryl Rogers 6 DW0RQWDQD6WDWH : 6 DW&RORUDGR / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 8&6DQWD%DUEDUD : 2 :DVKEXUQ : 6 &DO3RO\3RPRQD : 2 DW3DFL¿F : 2 0RQWDQWD6WDWH : 6 DW0RQWDQD6WDWH : 2 DW&DO3RO\ : 2 DW&DO3RO\ : 2 DW3DFL¿F / 2 DW&DO6WDWH/$ : 2 &DO6WDWH/$ / 2 DW&61RUWKULGJH : 2 6DQ'LHJR6WDWH : 2 6DQ'LHJR6WDWH / 2 DW&DO3RO\ / 1 DW/RQJ%HDFK6WDWH : 1 DW/RQJ%HDFK6WDWH / 2 &DO6WDWH/$ : 1 $ELOHQH&KULVWLDQ : 1 DW3DFL¿F : 1 6DQ'LHJR6WDWH / 1 6DQ-RVH6WDWH : 1 6DQ-RVH6WDWH : 1 DW/RQJ%HDFK6WDWH / 0HUF\%RZO /RV$QJHOHV&DOLI 1 DW+DZDLCL : 1 1RUWKHUQ$UL]RQD : 1 YV%RZOLQJ*UHHQ : Total Att: 102,067_$YJ 1 3RUWODQG6WDWH : Total Att: _$YJ Home Att:_$YJ Home Att:_$YJ 1966 Record: 8-4-0 1962 5HFRUG Home: 5-2-0 | Away: 3-2-0 5HFRUG Home: 5-1-0 | Away: 2-2-0 Head Coach: Darryl Rogers Home: 4-1-0 | Away: 3-2-0 Head Coach: Darryl Rogers 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Cecil Coleman 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 +D\ZDUG6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 +DZDLCL : 6 DW8&6DQWD%DUEDUD : 6 :KLWZRUWK : 6 1RUWKHUQ$UL]RQD : 6 0RQWDQD6WDWH / 6 DW8&6DQWD%DUEDUD : 2 DW0RQWDQD6WDWH / 2 3DFL¿F : 2 DW$ELOHQH&KULVWLDQ / 2 &61RUWKULGJH : 2 &61RUWKULGJH : 2 &DO3RO\ : 2 &DO3RO\ : 2 &DO3RO\ : 2 DW&DO6WDWH/$ : 2 DW&DO6WDWH/$ : 2 &DO6WDWH/$ : 2 DW6DQ'LHJR6WDWH / 2 DW6DQ'LHJR6WDWH / 2 DW6DQ'LHJR6WDWH / 1 /RQJ%HDFK6WDWH : 1 /RQJ%HDFK6WDWH / 1 /RQJ%HDFK6WDWH / 1 DW6DQ-RVH6WDWH : 1 3DFL¿F : 1 DW1RUWKHUQ$UL]RQD : 1 3DFL¿F : 1 DW6DQ-RVH6WDWH : 1 DW6DQ-RVH6WDWH : 1 0RQWDQD6WDWH / 1 DW+DZDLCL / Total Att: 110,260 _$YJ Home Att:_$YJ Record: 3-8-0 Home: 1-5-0 | Away: 2-3-0 Record: 6-5-0 1963 Head Coach: Darryl Rogers Home: 5-1-0 | Away: 1-3-0 | Bowl: 0-1-0 Record: 4-6-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Darryl Rogers Home: 2-3-0 | Away: 2-3-0 6 6DQWD&ODUD / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Cecil Coleman 6 ,GDKR / 6 +D\ZDUG6WDWH / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 0RQWDQD6WDWH / 6 6DQ-RVH6WDWH : 6 DW,GDKR / 2 DW&61RUWKULGJH : 6 DW0RQWDQD6WDWH / 6 DW0RQWDQD6WDWH / 2 DW&DO3RO\ : 2 +DZDLCL : 2 $GDPV6WDWH : 2 &DO6WDWH/$ : 2 DW&DO3RO\ : 2 DW3DFL¿F : 2 6DQ'LHJR6WDWH / 2 &DO6WDWH/$ : 2 DW&DO3RO\ : 1 DW/RQJ%HDFK6WDWH / 2 6DQ'LHJR6WDWH : 2 &DO6WDWH/$ : 1 DW3DFL¿F / 1 DW/RQJ%HDFK6WDWH / 1 DW/RQJ%HDFK6WDWH / 1 6DQ-RVH6WDWH / 1 &61RUWKULGJH : 1 6DQ'LHJR6WDWH / 1 DW+DZDLCL / 1 DW3DFL¿F / 1 6DQ-RVH6WDWH / 0HUF\%RZO,, $QDKHLP&DOLI 1 $ELOHQH&KULVWLDQ / ' &6)XOOHUWRQ / Total Att: 82,381_$YJ Home Att:_$YJ 106 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1980 Record: 6-4-1 Record: 5-6-0 5HFRUG 3&$$7LHGWK Home: 3-3-1 | Away: 3-1-0 Home: 5-1-0 | Away: 0-5-0 Home: 4-2-0 | Away: 1-4-0 Head Coach: Darryl Rogers Head Coach: Jim Sweeney Head Coach: Jim Sweeney 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 6DFUDPHQWR6WDWH : 6 DW/RXLVLDQD/DID\HWWH / 6 ADW&6)XOOHUWRQ / 6 :HVWHUQ0LFKLJDQ : 6 DW6DQ'LHJR6WDWH / 6 DW81/9 / 6 DW1HZ0H[LFR6WDWH : 6 0RQWDQD6WDWH : 6 /RXLVLDQD/DID\HWWH : 6 DW6DQ-RVH6WDWH : 2 &6)XOOHUWRQ : 6 DW8WDK / 2 3DFL¿F / 2 DW:LFKLWD6WDWH / 2 &DO3RO\ : 2 &DO3RO\ 7 2 &DO3RO\ / 2 ADW6DQ-RVH6WDWH / 2 &DO6WDWH/$ : 2 DW6DQ-RVH6WDWH / 2 A3DFL¿F : 2 DW6DQ'LHJR6WDWH / 2 3DFL¿F : 2 A8WDK6WDWH / 1 /RQJ%HDFK6WDWH / 1 /RQJ%HDFK6WDWH : 1 A/RQJ%HDFK6WDWH / 1 DW1RUWKHUQ,OOLQRLV : 1 1HZ0H[LFR6WDWH : 1 DW6RXWKHUQ,OOLQRLV : 1 0RQWDQD6WDWH / 1 DW6DQWD&ODUD / 1 0RQWDQD6WDWH : ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG Total Att.:_$YJ Home Att.:_$YJ Record: 2-9-0 1981 Home: 1-5-0 | Away: 1-4-0 5HFRUG 3&$$VW 5HFRUG 3&$$7LHGUG Head Coach: JR Boone Home: 4-0-0 | Away: 5-2-0 Home: 2-3-0 | Away: 3-3-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Head Coach: Jim Sweeney Head Coach Jim Sweeney 6 &DO3RO\3RPRQD / 3DFL¿F&RDVW$WKOHWLF$VVRFLDWLRQ&KDPSLRQV 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 6DQ-RVH6WDWH / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 2UHJRQ : 6 +DZDLCL / 6 DW/RXLVLDQD/DID\HWWH / 6 DW2UHJRQ6WDWH / 6 DW0RQWDQD6WDWH / 6 %RLVH6WDWH : 6 DW0RQWDQD6WDWH / 2 1RUWKHUQ,OOLQRLV / 6 DW0RQWDQD6WDWH / 2 A6DQ-RVH6WDWH / 2 DW:LFKLWD6WDWH / 2 DW&DO3RO\ : 2 A&6)XOOHUWRQ / 2 DW/RQJ%HDFK6WDWH : 2 6DQ'LHJR6WDWH : 2 6RXWKHUQ,OOLQRLV / 2 DW&DO3RO\ / 2 ADW3DFL¿F : 2 ADW3DFL¿F : 1 DW3DFL¿F / 2 A6DQ-RVH6WDWH : 2 ADW8WDK6WDWH / 1 6DQ'LHJR6WDWH / 2 ,GDKR6WDWH : 1 81/9 : 1 &61RUWKULGJH : 1 ADW/RQJ%HDFK6WDWH : 1 ADW/RQJ%HDFK6WDWH : 1 ADW&6)XOOHUWRQ : 1 DW$UL]RQD : 1 6DQWD&ODUD : Total Att._$YJ Total Att.:_$YJ Home Att.: _$YJ 5HFRUG Home Att.: _$YJ Home: 2-4-0 | Away: 3-3-0 1982 Head Coach: JR Boone 5HFRUG 3&$$VW 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 5HFRUG 3&$$7LHGWK +RPH_$ZD\_%RZO 6 &DO3RO\3RPRQD / Home: 2-4-0 | Away: 1-4-0 Head Coach Jim Sweeney 6 DW6DQ-RVH6WDWH / Head Coach: Bob Padilla 3DFL¿F&RDVW$WKOHWLF$VVRFLDWLRQ&KDPSLRQV 6 0RQWDQD6WDWH / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 &DO3RO\ / 6 DW0F1HHVH6WDWH / 6 &DO3RO\ : 2 DW1HZ0H[LFR6WDWH : 6 :HEHU6WDWH : 6 DW2UHJRQ : 2 DW6DQ'LHJR6WDWH / 6 ADW8WDK6WDWH / 6 :HEHU6WDWH : 2 3DFL¿F : 6 &DO3RO\ / 2 A8WDK6WDWH : 2 DW&6)XOOHUWRQ : 2 DW6DQ'LHJR6WDWH / 2 A3DFL¿F : 1 DW&61RUWKULGJH : 2 A3DFL¿F / 2 DW1HYDGD / 1 /RQJ%HDFK6WDWH / 2 ADW6DQ-RVH6WDWH / 2 ADW6DQ-RVH6WDWH : 1 :LFKLWD6WDWH : 2 A&6)XOOHUWRQ / 2 A/RQJ%HDFK6WDWH : 1 DW+DZDLCL / 1 A/RQJ%HDFK6WDWH : 1 A&6)XOOHUWRQ : 1 0RQWDQD6WDWH / 1 0RQWDQD6WDWH : 1 DW,GDKR : 1 ADW81/9 : Total Att.: _$YJ &DO%RZO,, )UHVQR&DOLI Record: 3-8-0 Home Att.: _$YJ ' %RZOLQJ*UHHQ : Home: 2-3-0 | Away: 1-5-0 Total Att.:_$YJ Head Coach: JR Boone Home Att.:_$YJ 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 5HFRUG 3&$$WK 6 &6)XOOHUWRQ : Home: 2-4-0 | Away: 2-3-0 1983 6 DW1HZ0H[LFR / Head Coach: Bob Padilla 5HFRUG 3&$$WK 6 &61RUWKULGJH / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 3-4-0 | Away: 3-1-0 6 DW0RQWDQD6WDWH : 6 ,GDKR : Head Coach Jim Sweeney 2 DW&DO3RO\ / 6 DW0RQWDQD6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 2 6DQ'LHJR6WDWH / 6 6DQ'LHJR6WDWH / 6 %RZOLQJ*UHHQ / 2 DW/RQJ%HDFK6WDWH / 6 DW:DVKLQJWRQ / 6 1HYDGD : 2 DW3DFL¿F / 2 DW&DO3RO\ / 6 ADW3DFL¿F : 1 6DQ-RVH6WDWH / 2 A6DQ-RVH6WDWH / 2 ADW8WDK6WDWH / 1 DW:LFKLWD6WDWH / 2 ADW/RQJ%HDFK6WDWH / 2 A6DQ-RVH6WDWH / 1 &DO6WDWH/$ : + 2 ADW3DFL¿F : 2 DW0RQWDQD6WDWH : 1 81/9 / 2 A&6)XOOHUWRQ / 1 A&6)XOOHUWRQ : 2 &DO3RO\ : 1 A8WDK6WDWH / 1 A81/9 / ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG 1 ADW/RQJ%HDFK6WDWH : Total Att.: _$YJ 1 1RUWKHUQ$UL]RQD : Home Att.: _$YJ Total Att.: _$YJ Home Att.: _$YJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 107 RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1984 1990 5HFRUG 3&$$7LHGWK 5HFRUG 3&$$7LHGQG 5HFRUG %LJ:HVW7LHGQG Home: 4-2-0 | Away: 2-4-0 Home: 5-1-0 | Away: 1-4-0 Home: 6-0-1 | Away: 2-2-0 Head Coach Jim Sweeney Head Coach: Jim Sweeney Head Coach: Jim Sweeney 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 DW$UL]RQD : 6 DW:DVKLQJWRQ6WDWH / 6 (DVWHUQ0LFKLJDQ : 6 DW%RLVH6WDWH : 6 :HVWHUQ,OOLQRLV : 6 1HZ0H[LFR : 6 &DO3RO\ : 6 DW8&/$ / 6 DW8WDK : 6 A/RQJ%HDFK6WDWH : 2 A/RQJ%HDFK6WDWH : 6 A1HZ0H[LFR6WDWH : 6 A1HZ0H[LFR6WDWH : 2 6RXWKHUQ,OOLQRLV : 6 A&6)XOOHUWRQ : 2 DW+DZDLCL / 2 A6DQ-RVH6WDWH / 2 DW1RUWKHUQ,OOLQRLV / 2 A8WDK6WDWH : 2 ADW3DFL¿F / 2 A8WDK6WDWH 7 2 ADW6DQ-RVH6WDWH / 2 A81/9 : 2 A/RQJ%HDFK6WDWH : 1 ADW&6)XOOHUWRQ / 1 A&6)XOOHUWRQ : 1 ADW81/9 : 1 A3DFL¿F / 1 ADW8WDK6WDWH / 1 A3DFL¿F : 1 0RQWDQD6WDWH / 1 ADW1HZ0H[LFR6WDWH : 1 ADW6DQ-RVH6WDWH / 1 ADW81/9 / Total Att.:_$YJ Total Att.:_$YJ Total Att.: _$YJ Home Att.: _$YJ Home Att.: _$YJ Home Att.: _$YJ 1988 1991 1985 5HFRUG %LJ:HVWVW 5HFRUG %LJ:HVW7LHGVW 5HFRUG 3&$$VW Home: 5-0-0 | Away: 4-2-0 | Bowl: 1-0-0 Home: 6-0-0 | Away: 4-1-0 | Bowl: 0-1-0 Home: 5-0-1 | Away: 5-0-0 | Bowl: 1-0-0 Head Coach: Jim Sweeney Head Coach: Jim Sweeney Head Coach: Jim Sweeney Big West Conference Champions Big West Conference Champions 3DFL¿F&RDVW$WKOHWLF$VVRFLDWLRQ&KDPSLRQV 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 DW1HZ0H[LFR : 6 1RUWKHUQ,OOLQRLV : 6 A81/9 : 6 DW&RORUDGR / 6 DW:DVKLQJWRQ6WDWH : 6 DW2UHJRQ6WDWH : 6 A1HZ0H[LFR6WDWH : 6 DW2UHJRQ6WDWH : 6 &DO3RO\ : 6 0F1HHVH6WDWH : 2 1HZ0H[LFR : 2 +DZDLCL 7 2 DW2UHJRQ6WDWH / 2 A/RQJ%HDFK6WDWH : 2 A6DQ-RVH6WDWH : 2 ADW&6)XOOHUWRQ : 2 ADW1HZ0H[LFR6WDWH : 2 ADW1HZ0H[LFR6WDWH : 2 A8WDK6WDWH : 2 A81/9 : 2 ADW8WDK6WDWH : 2 ADW6DQ-RVH6WDWH : 1 ADW8WDK6WDWH / 1 A&6)XOOHUWRQ : 1 A3DFL¿F : 1 ADW3DFL¿F : 1 ADW3DFL¿F : 1 ADW81/9 : 1 A&6)XOOHUWRQ : 1 ADW/RQJ%HDFK6WDWH : 1 A/RQJ%HDFK6WDWH : 1 A6DQ-RVH6WDWH : 1 :LFKLWD6WDWH : &DO%RZO9,,, )UHVQR&DOLI &DO%RZO;, )UHVQR&DOLI &DO%RZO9 )UHVQR&DOLI ' :HVWHUQ0LFKLJDQ : ' %RZOLQJ*UHHQ / ' %RZOLQJ*UHHQ : Total Att.:_$YJ Total Att.: _$YJ Total Att.:_$YJ Home Att.:_$YJ Home Att.: _$YJ Home Att.:_$YJ 1986 1989 1992 5HFRUG 3&$$QG 5HFRUG %LJ:HVWVW 5HFRUG :$&7LHGVW Home: 8-0-0 | Away: 1-2-0 +RPH_$ZD\_%RZO Home: 5-1-0 | Away: 3-3-0 | Bowl: 1-0-0 Head Coach: Jim Sweeney Head Coach: Jim Sweeney Head Coach: Jim Sweeney 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Big West Conference Champions Western Athletic Conference Co-Champions 6 0RQWDQD6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 2UHJRQ6WDWH : 6 8WDK : 6 DW3DFL¿F : 6 /RXLVLDQD7HFK : 6 0RQWDQD : 6 DW2UHJRQ6WDWH / 2 ADW6DQ-RVH6WDWH / 6 ADW3DFL¿F : 6 A&RORUDGR6WDWH : 2 A1HZ0H[LFR6WDWH : 6 A/RQJ%HDFK6WDWH : 6 :DVKLQJWRQ6WDWH / 2 A3DFL¿F : 2 2UHJRQ6WDWH : 2 /RXLVLDQD7HFK : 2 A/RQJ%HDFK6WDWH : 2 ADW8WDK6WDWH : 2 ADW%<8 / 2 A&6)XOOHUWRQ : 2 A&6)XOOHUWRQ : 2 ADW+DZDLCL / 1 ADW81/9 : 2 A81/9 : 2 A1HZ0H[LFR : 1 DW+DZDLCL / 1 A6DQ-RVH6WDWH : 2 A:\RPLQJ : 1 A8WDK6WDWH : 1 ADW1HZ0H[LFR6WDWH : 1 A8WDK : Total Att.: _$YJ 1 DW1HZ0H[LFR / 1 ADW6DQ'LHJR6WDWH : Home Att.:_$YJ &DO%RZO,; )UHVQR&DOLI 1 ADW87(3 : ' %DOO6WDWH : )UHHGRP%RZO $QDKHLP&DOLI Total Att.: _$YJ ' YV86& : Home Att.:_$YJ Total Att.:_$YJ Home Att.: _$YJ 108 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY YEAR-BY-YEAR RESULTS 1993 1996 1999 5HFRUG :$&7LHGVW 5HFRUG :$&7LHGWK3DFL¿F'LYLVLRQ 5HFRUG :$&7LHGVW Home: 6-0-0 | Away: 2-3-0 | Bowl: 0-1-0 Home: 3-3 | Away: 1-4 Home: 6-0 | Away: 2-4 | Bowl: 0-1 Head Coach: Jim Sweeney Head Coach: Jim Sweeney Head Coach Pat Hill Western Athletic Conference Co-Champions 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Western Athletic Conference Co-Champions 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG $ 2UHJRQ / 27 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 DW%D\ORU / 6 DW1R$XEXUQ / 6 3RUWODQG6WDWH : 6 2UHJRQ6WDWH : 6 ADW8WDK / 6 DW2UHJRQ6WDWH / 6 ADW1HZ0H[LFR : 6 A+DZDLCL : 6 DW1R8&/$ / 6 8WDK6WDWH : 2 A6DQ-RVH6WDWH : 6 DW1HYDGD : 2 ADW&RORUDGR6WDWH / 2 ADW:\RPLQJ / 2 A7&8 : 27 37,112 2 A$LU)RUFH : 2 ADW81/9 : 2 &RORUDGR6WDWH : 2 ADW%<8 : 1 %RLVH6WDWH : 2 ADW608 / 2 ADW:\RPLQJ / 1 A&RORUDGR6WDWH / 2 A87(3 : 27 36,405 1 A87(3 : 1 A$LU)RUFH / 27 2 ADW7XOVD : 1 A+DZDLCL : 1 ADW6DQ'LHJR6WDWH / 1 A5LFH : 1 A6DQ'LHJR6WDWH : -LP6ZHHQH\¶VWKFDUHHUYLFWRU\ 1 ADW+DZDLCL /27 37,283 -HHS(DJOH$ORKD%RZO +RQROXOX+DZDL¶L Total Att.: _$YJ 1 A6DQ-RVH6WDWH : ' YV1R&RORUDGR / Home Att.: _$YJ ($6SRUWV/DV9HJDV%RZO /DV9HJDV1HY Total Att.:_$YJ ' YV8WDK / Home Att.:_$YJ Total Att.: _$YJ Home Att.: _$YJ 5HFRUG :$&UG3DFL¿F'LYLVLRQ 1994 Home: 4-2 | Away: 2-4 5HFRUG :$&WK Head Coach: Pat Hill 2000 Home: 3-4-0 | Away: 2-2-1 | Neutral: 0-1-0 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 5HFRUG :$&QG Head Coach: Jim Sweeney $ 3RUWODQG6WDWH : Home: 5-0 | Away: 2-4 | Bowl: 0-1 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 %D\ORU / Head Coach: Pat Hill $ YV1R2KLR6WDWH1 L 10-34 28,513 6 DW2NODKRPD6WDWH / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 6DQ-RVH6WDWH : 6 DW2UHJRQ / 27 38,288 6 DW1R2KLR6WDWH / 6 DW:DVKLQJWRQ6WDWH / 2 A8WDK : 6 DW1R8&/$ / 6 2UHJRQ6WDWH : 2 ADW+DZDLCL / 6 &DOLIRUQLD : 6 ADW+DZDL¶L : 2 ADW1R$LU)RUFH : 2 ADW5LFH : 2 A1R%<8 / 2 A81/9 : 2 A1HYDGD : 2 A:\RPLQJ : 1 ADW6DQ-RVH6WDWH : 2 ADW87(3 / 2 ADW$LU)RUFH / 1 ADW&RORUDGR6WDWH / 2 A7XOVD : 2 A1HZ0H[LFR / 1 A6DQ'LHJR6WDWH / 1 A+DZDLCL : 1 1HYDGD / 1 A:\RPLQJ : 1 ADW7&8 / 1 ADW87(3 7 Total Att.: _$YJ 1 A608 : 1 A1R&RORUDGR6WDWH / Home Att.: _$YJ 1 ADW6DQ-RVH6WDWH : 1 ADW6DQ'LHJR6WDWH : 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF, 6DQ-RVH&DOLI 1 - 'LVQH\ODQG3LJVNLQ&ODVVLFDWWKH)ORULGD&LWUXV%RZO 2UODQGR)OD ' YV$LU)RUFH / Total Att.: _$YJ 1998 Total Att.: _$YJ Home Att.:_$YJ 5HFRUG :$&7LHGQG3DFL¿F'LYLVLRQ Home Att.:_$YJ Home: 4-1 | Away: 1-5 Head Coach: Pat Hill 1995 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 2001 5HFRUG :$&7LHGWK 6 DW1R&RORUDGR / 5HFRUG :$&7LHGQG Home: 4-2-0 | Away: 1-5-0 6 DW7H[DV7HFK / Home: 5-1 | Away: 6-1 | Bowl: 0-1 Head Coach: Jim Sweeney 6 1HYDGD / Head Coach: Pat Hill 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 2 A%<8 : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 /RXLVLDQD0RQURH : 2 ADW7&8 / $ DW&RORUDGR : 6 DW&DOLIRUQLD : 2 ADW8WDK / 6 1R2UHJRQ6WDWH : 6 3DFL¿F : 2 A87(3 : 6 DW1R:LVFRQVLQ : 6 ADW8WDK / 2 ADW1HZ0H[LFR : 6 ADW7XOVD : 6 DW8&/$ / 1 ADW6DQ'LHJR6WDWH / 6 A/RXLVLDQD7HFK : 2 A1HZ0H[LFR : 1 A+DZDL¶L : 2 DW&RORUDGR6WDWH : 27 31,580 2 ADW6DQ'LHJR6WDWH / 1 A6DQ-RVH6WDWH : 2 A%RLVH6WDWH / 2 A$LU)RUFH / Total Att.: _$YJ 2 ADW+DZDLCL / 1 ADW+DZDLCL / Home Att.: _$YJ 1 A5LFH : 1 A87(3 : 1 ADW608 : 1 ADW:\RPLQJ / 1 ADW1HYDGD : 1 A%<8 / 1 A6DQ-RVH6WDWH : Total Att.: _$YJ ' 8WDK6WDWH : Home Att.: _$YJ 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,, 6DQ-RVH&DOLI ' YV0LFKLJDQ6WDWH / Total Att.:_$YJ Home Att.: _$YJ 6FKRRO5HFRUG 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 109 RECORDS & HISTORY YEAR-BY-YEAR RESULTS 2002 2005 2008 5HFRUG :$&UG 5HFRUG :$&7LHGQG 5HFRUG :$&7LHGUG Home: 5-1 | Away: 3-4 | Bowl: 1-0 Home: 5-1 | Away: 3-3 | Bowl: 0-1 Home: 2-3 | Away: 5-2 | Bowl: 0-1 Head Coach: Pat Hill Head Coach Pat Hill Head Coach Pat Hill 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG $ DW1R:LVFRQVLQ / 6 :HEHU6WDWH : 6 DW5XWJHUV : $ 6DQ'LHJR6WDWH : 6 DW2UHJRQ / 6 1R:LVFRQVLQ / 6 DW1R2UHJRQ / 6 7ROHGR : 6 DW7ROHGR :27 6 DW2UHJRQ6WDWH / 2 ADW1HZ0H[LFR6WDWH : 6 DW8&/$ : 6 ADW5LFH : 2 A8WDK6WDWH : 2 A+DZDL¶L / 27 40,572 2 &RORUDGR6WDWH : 2 ADW,GDKR : 2 A,GDKR : 2 A608 : 2 ADW+DZDL¶L : 2 ADW8WDK6WDWH : 2 ADW%RLVH6WDWH / 1 A6DQ-RVH6WDWH : 1 ADW/RXLVLDQD7HFK / 2 A+DZDLCL / 1 A%RLVH6WDWH : 1 A1HYDGD / 1 A7XOVD : 1 DW1R86& / 1 A1HZ0H[LFR6WDWH : 1 A1HYDGD : 1 ADW1HYDGD / 1 ADW6DQ-RVH6WDWH : 1 ADW6DQ-RVH6WDWH : ' A/RXLVLDQD7HFK / 1 ADW1R%RLVH6WDWH / ' ADW/RXLVLDQD7HFK : $XWR=RQH/LEHUW\%RZO 0HPSKLV7HQQ 1HZ0H[LFR%RZO $OEXTXHUTXH10 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,,, 6DQ-RVH&DOLI ' YV7XOVD / ' YV&RORUDGR6WDWH / ' YV*HRUJLD7HFK : Total Att.: _$YJ Total Att.: _$YJ Total Att.: _$YJ Home Att.: _$YJ Home Att.:_$YJ Home Att.: _$YJ 2006 2009 2003 5HFRUG :$&WK 5HFRUG :$&UG 5HFRUG :$&7LHGQG Home: 3-3 | Away: 1-5 Home: 4-1 | Away: 4-3 | Bowl: 0-1 Home: 5-1 | Away: 3-4 | Bowl: 1-0 Head Coach Pat Hill Head Coach Pat Hill Head Coach: Pat Hill 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 A1HYDGD : 6 8&'DYLV : $ DW1R7HQQHVVHH / 6 1R2UHJRQ / 6 DW:LVFRQVLQ / 27 80,353 6 2UHJRQ6WDWH : 6 DW:DVKLQJWRQ / 6 A1R%RLVH6WDWH / 6 DW1R2NODKRPD / 6 &RORUDGR6WDWH / 6 DW1R&LQFLQQDWL / 6 A/RXLVLDQD7HFK : 2 ADW8WDK6WDWH / 2 ADW+DZDL¶L : 6 3RUWODQG6WDWH : 2 A+DZDL¶L / 2 A6DQ-RVH6WDWH : 2 DW&RORUDGR6WDWH / 2 DW1R/68 / 2 ADW1HZ0H[LFR6WDWH : 2 ADW+DZDLCL / 1 ADW1R%RLVH6WDWH / 2 A8WDK6WDWH : 2 A5LFH : 1 A1HZ0H[LFR6WDWH : 1 ADW,GDKR : 1 ADW608 : 1 A,GDKR : 1 ADW1HYDGD / 1 ADW1HYDGD : 1 ADW/RXLVLDQD7HFK : 1 A/RXLVLDQD7HFK : 1 A6DQ-RVH6WDWH : ' ADW6DQ-RVH6WDWH / ' DW,OOLQRLV : 1 A1R%RLVH6WDWH / Total Att.:_$YJ 1HZ0H[LFR%RZO $OEXTXHUTXH10 1 ADW87(3 : Home Att.:_$YJ ' YV:\RPLQJ / 27 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,9 6DQ-RVH&DOLI Total Att.: _$YJ ' YV8&/$ : Home Att.:_$YJ Total Att.: *_$YJ Home Att.: _$YJ 5HFRUG :$&UG 6FKRRO5HFRUG Home: 5-1 | Away: 3-3 | Bowl: 1-0 2010 Head Coach Pat Hill 5HFRUG :$&QG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 5-2 | Away: 3-2 | Bowl: 0-1 2004 6 6DFUDPHQWR6WDWH : Head Coach Pat Hill 5HFRUG :$&7LHGUG 6 DW1R7H[DV$ 0 / 27 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 4-1 | Away: 4-2 | Bowl: 1-0 6 DW2UHJRQ / 6 &LQFLQQDWL : Head Coach: Pat Hill 6 A/RXLVLDQD7HFK : 6 ADW8WDK6WDWH : 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 2 ADW1HYDGD : 6 DW0LVVLVVLSSL / 6 DW:DVKLQJWRQ : 2 ADW,GDKR : 2 &DO3RO\ : 6 DW1R.DQVDV6WDWH : 2 A6DQ-RVH6WDWH : 2 A+DZDL¶L / 6 3RUWODQG6WDWH : 2 A%RLVH6WDWH / 2 A1HZ0H[LFR6WDWH : 2 ADW/RXLVLDQD7HFK / 1 A8WDK6WDWH : 2 ADW6DQ-RVH6WDWH : 2 A87(3 / 1 ADW1R+DZDL¶L / 1 ADW/RXLVLDQD7HFK : 2 ADW1R%RLVH6WDWH / 1 .DQVDV6WDWH : 1 A1R1HYDGD / 2 A608 : 1 ADW1HZ0H[LFR6WDWH : 1 ADW1R%RLVH6WDWH / 1 ADW5LFH : 5RDG\¶V+XPDQLWDULDQ%RZO %RLVH,GDKR 1 A,GDKR : 1 A+DZDLCL : ' YV*HRUJLD7HFK : ' ,OOLQRLV : 1 A1HYDGD : Total Att.: _$YJ X'URYH+XPDQLWDULDQ%RZO %RLVH,GDKR 1 ADW6DQ-RVH6WDWH : Home Att.:_$YJ ' YV1RUWKHUQ,OOLQRLV / 03&&RPSXWHUV%RZO %RLVH,GDKR Total Att$YJ ' YV1R9LUJLQLD : 27 28,516 Home Att.$YJ Total Att.: _$YJ Home Att.: _$YJ ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG A,QGLFDWHVFRQIHUHQFHJDPH 110 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY 2011 2014 5HFRUG :$&7LHGWK 5HFRUG 0:VW:HVW'LYLVLRQ Home: 2-4 | Away: 2-4 | Neutral: 0-1 Home: 4-2 | Away: 2-5 | Bowl: 0-1 Head Coach Pat Hill Head Coach Tim DeRuyter 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 YV&DO / $ DW1R86& / 6 DW1R1HEUDVND / 6 DW8WDK / 6 1RUWK'DNRWD : 6 1R1HEUDVND / 6 ADW,GDKR : 6 6RXWKHUQ8WDK : 2 0LVVLVVLSSL / 6 ADW1HZ0H[LFR : 2 1R%RLVH6WDWH / 2 A6DQ'LHJR6WDWH : 2 A8WDK6WDWH : 2 ADW81/9 / 27 2 ADW1HYDGD / 2 ADW%RLVH6WDWH / 1 A/RXLVLDQD7HFK / 1 A:\RPLQJ / 1 ADW1HZ0H[LFR6WDWH / 1 A6DQ-RVH6WDWH : 1 ADW+DZDL¶L : 1 ADW1HYDGD : 1 A6DQ-RVH6WDWH / 1 A+DZDLCL : ' DW6DQ'LHJR6WDWH / 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH %RLVH,GDKR $W&DQGOHVWLFN3DUN 6DQ)UDQFLVFR&DOLI ' DW1R%RLVH6WDWH / Total Att_$YJ +DZDLCL%RZO +RQROXOX+DZDLCL Home Att._$YJ ' YV5LFH / Total Att_$YJ Home Att._$YJ 2012 5HFRUG 0:7LHGVW Home: 6-0 | Away: 3-3 | Bowl: 0-1 2015 Head Coach Tim DeRuyter 5HFRUG 7WK:HVW'LYLVLRQ 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Home: 2-4 | Away: 1-5 6 :HEHU6WDWH : Head Coach Tim DeRuyter 6 DW1R2UHJRQ / 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 &RORUDGR : 6 $ELOHQH&KULVWLDQ : 6 DW7XOVD / 6 DW1R0LVVLVVLSSL / 6 A6DQ'LHJR6WDWH : 6 1R8WDK / 2 ADW&RORUDGR6WDWH : 6 ADW6DQ-RVH6WDWH / 2 ADW1R%RLVH6WDWH / 2 ADW6DQ'LHJR6WDWH / 2 A:\RPLQJ : 2 A8WDK6WDWH / 2 ADW1HZ0H[LFR : 2 A81/9 : 1 A+DZDL¶L : 2 ADW$LU)RUFH / 1 ADW1HYDGD : 1 A1HYDGD / 1 A$LU)RUFH : 1 ADW+DZDLCL : 6KHUDWRQ+DZDL¶L%RZO +RQROXOX+DZDL¶L 1 DW%<8 / ' YV608 / 1 A&RORUDGR6WDWH / Total Att_$YJ Total Att_$YJ Home Att._$YJ Home Att.: _$YJ 2013 2016 5HFRUG 0:VW 5HFRUG WK:HVW'LYLVLRQ +RPH_$ZD\_%RZO Home: 1-5 | Away: 0-6 Head Coach Tim DeRuyter Head Coach Tim DeRuyter 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG Interim Coach: Eric Kiesau (4 games) $ 5XWJHUV : 27 'DWH 2SSRQHQW 5HVXOW 6FRUH $WWHQG 6 &DO3RO\ : 6 DW1HEUDVND / 6 DW&RORUDGR &DQFHOHG)ORRGLQJ 6 6DFUDPHQWR6WDWH : 6 A%RLVH6WDWH : 6 DW7ROHGR / 6 ADW+DZDL¶L : 6 7XOVD / 2 DW,GDKR : 2 ADW81/9 / 2 A81/9 : 2 ADW1HYDGD / 2 ADW6DQ'LHJR6WDWH : 27 32,707 2 A6DQ'LHJR6WDWH / 1 A1HYDGD : 2 ADW8WDK6WDWH / 1 ADW:\RPLQJ : 2 A$LU)RUFH / 1 A1HZ0H[LFR : 1 ADW&RORUDGR6WDWH / 1 ADW6DQ-RVH6WDWH / 1 A+DZDL¶L / 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH )UHVQR&DOLI 1 A6DQ-RVH6WDWH / ' 8WDK6WDWH : Total Att_$YJ 5R\DO3XUSOH/DV9HJDV%RZO /DV9HJDV1HY Home Att.: _$YJ ' YV86& / Total Att_$YJ Home Att. _$YJ 6FKRRO5HFRUG 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 111 RECORDS & HISTORY BULLDOGS IN OVERTIME GAMES 1996 #Aug. 31 vs. Oregon: L, 30-27 (1OT) Overall Record: 7-10 (17) Nov. 16 vs. Air Force: L, 44-38 (1OT) Home Record: 3-4 (7) 1997 Away Record: 3-5 (8) Sept. 20 at Oregon: L, 43-40 (1OT) Bowl Record: 1-1 (2) 1999 Single OT games: 6-5 (11) Oct. 2 vs. TCU: W, 26-19 (1OT) Oct. 23 vs. UTEP: W, 24-23 (1OT) Double OT games: 1-4 (5) Nov. 13 at Hawai’i: L, 31-24 (2OT) Triple OT games: 0-1 (1) 2001 Division I-A (now-FBS) Football instituted the Oct. 13 at Colorado State: W, 25-22 (1OT) overtime format full-time at the beginning of the 1996 season. Division I-A football initially adopted 2004 it for the 1995 bowl season. Dec. 27 vs. Virginia--MPC Computers Bowl: W, 37-34 (1OT) # Fresno State played in the second-ever Division I-A (now-FBS) regular season game under the new 2007 overtime format. Sept. 8 at No. 23 Texas A&M: L, 47-45 (3OT) The first overtime game was played at the 1995 Las 2008 Vegas Bowl between Nevada and Toledo. The first Sept. 20 at Toledo: W, 55-54 (2OT) overtime game played after the format was instituted Oct. 4 vs. Hawai’i: L, 32-29 (1OT) full-time was played earlier in the day prior to Fresno State’s game - Southwest Missouri State at Oklahoma 2009 State. Sept. 12 at Wisconsin: L, 34-31 (2OT) Dec. 19 vs. Wyoming--New Mexico Bowl: L, 35-28 (2OT) 2013 Aug. 29 vs. Rutgers: W, 52-51 (1OT) Oct. 26 at San Diego State: W, 35-28 (1OT) 2014 Oct. 10 at UNLV: L, 30-27 (1OT) 2016 Sept. 24 vs. Tulsa: L, 48-41 (2OT) 112 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY YEAR-BY-YEAR MOUNTAIN WEST STANDINGS *Fresno State joined in 2012 2016 FINAL MOUNTAIN WEST STANDINGS: MOUNTAIN DIVISION Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N %RLVH6WDWH 5959 1HZ0H[LFR :\RPLQJ $LU)RUFH 5959 &RORUDGR6WDWH 8WDK6WDWH 2015 FINAL MOUNTAIN WEST STANDINGS: WEST DIVISION Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N 6DQ'LHJR6WDWH Year-by-Year +DZDL¶L MW Champions 1HYDGD 81/9 2016: San Diego State 6DQ-RVH6WDWH 2015: San Diego State )UHVQR6WDWH 2014: Boise State 2015 FINAL MOUNTAIN WEST STANDINGS: MOUNTAIN DIVISION 2013: Fresno State* Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N $LU)RUFH 2012: Fresno State, %RLVH6WDWH San Diego State, Boise State 1HZ0H[LFR &RORUDGR6WDWH 2011: TCU 8WDK6WDWH 2010: TCU :\RPLQJ 2009: TCU 2015 FINAL MOUNTAIN WEST STANDINGS: WEST DIVISION 2008: Utah Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N 6DQ'LHJR6WDWH 2007: BYU 1HYDGD 2006: BYU 6DQ-RVH6WDWH 81/9 2005: TCU )UHVQR6WDWH 2004: Utah +DZDLL 2003: Utah 2014 FINAL MOUNTAIN WEST STANDINGS: MOUNTAIN DIVISION 2002: Colorado State Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N 2001: BYU %RLVH6WDWH &RORUDGR6WDWH 2000: Colorado State 8WDK6WDWH 1999: Colorado State, Utah, $LU)RUFH :\RPLQJ BYU 1HZ0H[LFR 2014 FINAL MOUNTAIN WEST STANDINGS: WEST DIVISION *Fresno State won first annual Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N Mountain West Championship )UHVQR6WDWH Game 6DQ'LHJR6WDWH 1HYDGD +DZDLµL 6DQ-RVp6WDWH 81/9 2013 FINAL MOUNTAIN WEST STANDINGS: MOUNTAIN DIVISION Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N 8WDK6WDWH %RLVH6WDWH &RORUDGR6WDWH :\RPLQJ 1HZ0H[LFR $LU)RUFH 2013 FINAL MOUNTAIN WEST STANDINGS: WEST DIVISION Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N )UHVQR6WDWH 6DQ'LHJR6WDWH 81/9 6DQ-RVp6WDWH 1HYDGD +DZDLµL 2012 FINAL MOUNTAIN WEST STANDINGS Team (Coaches/AP) MW Pct. Pts. Opp. H A Overall Pct. Pts. Opp. H A N %RLVH6WDWH )UHVQR6WDWH 6DQ'LHJR6WDWH $LU)RUFH 1HYDGD :\RPLQJ &RORUDGR6WDWH 81/9 1HZ0H[LFR +DZDLµL 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 113 RECORDS & HISTORY FRESNO STATE IN THE TOP 25 ASSOCIATED PRESS USA TODAY Fresno State vs. the Top 25 Year Date Rank Record Year Date Rank Record 'DWH 2SSRQHQW 5DQN 5HVXOW 1RY WK -DQ UG 8WDK / 6HSW WK 6HSW WK DW2OH0LVV / 2FW WK 6HSW WK DW%RLVH6WDWHA / 1RY WK 1RY WK 1HEUDVND / 1RY UG 1RY UG DW86& / 6HSW WK 6HSW WK DW%RLVH6WDWH / 2FW WK 2FW WK DW2UHJRQ / 2FW WK 2FW WK %RLVH6WDWH / -DQ WK 2FW QG DW1HEUDVND / 3UHVHDVRQ WK 2FW UG DW%RLVH6WDWH / 'HF WK 1RY WK 1HYDGD / 2001 6HSW WK 1RY UG DW&LQFLQQDWL / 6HSW WK 1RY WK %RLVH6WDWH / 6HSW WK )LQDO QG DW%RLVH6WDWH / 2FW WK 6HSW WK :LVFRQVLQ / 2FW WK 6HSW WK DW+DZDL¶L / 2FW WK 2FW UG DW7H[DV$ 0 /27 2FW WK 'HF WK DW%RLVH6WDWH / 1RY UG 2001 6HSW WK 1RY VW 6HSW WK DW/68 / 'HF VW 2FW WK 2UHJRQ / 'HF VW 2FW WK DW86& / OT 2004 6HSW WK 2FW WK YV9LUJLQLD : 6HSW WK 2FW WK DW%RLVH6WDWH / 6HSW WK 1RY WK DW.DQVDV6WDWH : )LQDO QG 1RY QG %RLVH6WDWH / 2005 3UHVHDVRQ WK 1RY VW DW2NODKRPD / 6HSW WK 'HF WK DW7HQQHVVHH / 6HSW UG 'HF WK DW2UHJRQ / 2FW WK 2004 6HSW WK DW:LVFRQVLQ / 2FW QG 6HSW WK DW:LVFRQVLQ : 2FW VW 6HSW WK 2UHJRQ6WDWH : 1RY WK )LQDO QG DW8&/$ / 1RY WK 2005 6HSW WK DW2KLR6WDWH / 1RY WK 6HSW WK DW8&/$ / 1RY UG 6HSW WK DW&RORUDGR / 2008 $XJ VW 6HSW QG DW$LU)RUFH : 6HSW VW 1RY WK DW$XEXUQ / 6HSW WK 1RY WK &RORUDGR6WDWH / 6HSW WK 1RY WK %<8 / 6HSW QG 1RY QG YV2KLR6WDWH / 6HSW WK 2008 3UHVHDVRQ WK YV86& : 6HSW UG $XJ VW *'LVQH\ODQG3LJVNLQ&ODVVLFDWWKH)ORULGD&LWUXV%RZO 2FW VW 6HSW VW 2UODQGR)OD 2FW WK 6HSW WK A0RXQWDLQ:HVW&KDPSLRQVKLS*DPH 2FW WK 6HSW VW )UHHGRP%RZO $QDKHLP&DOLI 2FW WK 6HSW WK 1RY WK 6HSW UG 1RY WK 6HSW QG 1RY WK 2FW QG 1RY WK 2FW WK 'HF WK 2FW WK 'HF VW 2FW WK 1RY WK 1RY WK 1RY WK 1RY WK 'HF QG 'HF WK 114 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY ALL-TIME SERIES RECORDS ABILENE CHRISTIAN BOWLING GREEN CENTRAL ARKANSAS )UHVQR6WDWH : $ Fresno State leads 3-2 Fresno State leads 3-2 Fresno State leads 2-1 )UHVQR6WDWH : $ (H:3-1 A: 0-1) +1 )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : )UHVQR6WDWH : + )UHVQR6WDWH : )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + $ELOHQH&KULVWLDQ / $ %RZOLQJ*UHHQ / + &HQWUDO$UNDQVDV / $ +DZDL¶L / $ $ELOHQH&KULVWLDQ / + )UHVQR6WDWH : + /LWWOH$OO$PHULFDQ%RZO /RV$QJHOHV&DOLI +DZDL¶L / $ )UHVQR6WDWH : + %RZOLQJ*UHHQ / + )UHVQR6WDWH : + 0HUF\%RZO /RV$QJHOHV&DOLI CINCINNATI +DZDL¶L / + &DO%RZO,, )UHVQR&DOLI +DZDL¶L / $ AIR FORCE Series tied 1-1 +DZDL¶L / $ Air Force leads 6-3 +$ 7,(' 7 + +$1 BYU 'DWH :LQQHU 6FRUH 6LWH +DZDL¶L / $ &LQFLQQDWL / $ +DZDL¶L / $ ,QWUD&RQIHUHQFH :$&0: Series Tied 5-5 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + +$ )UHVQR6WDWH : $ $LU)RUFH / $ 'DWH :LQQHU 6FRUH 6LWH +DZDL¶L / $ $LU)RUFH / + )UHVQR6WDWH : $ COLORADO )UHVQR6WDWH : + $LU)RUFH / 38-4427 H )UHVQR6WDWH : + Colorado leads 4-2 +DZDL¶L / $ )UHVQR6WDWH : $ %<8 / $ +$1 )UHVQR6WDWH : + 27 $LU)RUFH / )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH +DZDL¶L /24-31 A )UHVQR6WDWH : + )UHVQR6WDWH : + %<8 / $ &RORUDGR / $ +DZDL¶L / $ $LU)RUFH / $ )UHVQR6WDWH : $ &RORUDGR / $ )UHVQR6WDWH / + +DZDL¶L / + %<8 / + &RORUDGR / +DZDL¶L / $ 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF, 6DQ &RORUDGR / $ -RVH&DOLI %<8 / + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ %<8 / $ )UHVQR6WDWH : + +DZDL¶L / + ARIZONA -HHS(DJOH$ORKD%RZO +RQROXOX+DZDL¶L +DZDL¶L / $ Fresno State leads 2-0 +DZDL¶L / + (A: 2-0) CALIFORNIA COLORADO STATE )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH Fresno State leads 2-1 +DZDL¶L / + Colorado State leads 9-5 )UHVQR6WDWH : $ )UHVQR6WDWH : $ +$1 +$1 )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH ,QWUD&RQIHUHQFH :$&0: )UHVQR6WDWH : $ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ ARIZONA STATE &RORUDGR6WDWH / $ Arizona State leads 3-0 &DOLIRUQLD / 1 +DZDL¶L / $ 1&DQGOHVWLFN3DUN 6DQ)UDQFLVFR&DOLI &RORUDGR6WDWH / + 3LQHDSSOH%RZO +RQROXOX+DZDL¶L +$ &RORUDGR6WDWH / + 'DWH :LQQHU 6FRUH 6LWH &RORUDGR6WDWH / $ $UL]RQD6WDWH / + IDAHO )UHVQR6WDWH : + Fresno State leads 11-4 $UL]RQD6WDWH / $ CAL POLY Fresno State leads 32-10-2 )UHVQR6WDWH : $ +$ $UL]RQD6WDWH / $ +$ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH &RORUDGR6WDWH / $ )UHVQR6WDWH : + &RORUDGR6WDWH / + )UHVQR6WDWH : + ,GDKR / + AUBURN &RORUDGR6WDWH / )UHVQR6WDWH : $ ,GDKR / $ Auburn leads 1-0 )UHVQR6WDWH : $ (A: 0-1) )UHVQR6WDWH : + ,GDKR / $ &RORUDGR6WDWH / + ,GDKR / + 'DWH :LQQHU 6FRUH 6LWH 7,(' 7 + &RORUDGR6WDWH / $ )UHVQR6WDWH : $ $XEXUQ / $ )UHVQR6WDWH : $ 1HZ0H[LFR%RZO $OEXTXHUTXH10 )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ &DO3RO\ / $ )UHVQR6WDWH : + BALL STATE )UHVQR6WDWH : + DRAKE )UHVQR6WDWH : $ Fresno State leads 1-0 Drake leads series 1-0 )UHVQR6WDWH : $ )UHVQR6WDWH : + (H: 1-0) )UHVQR6WDWH : + (H: 0-1) 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ &DO3RO\ / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : +A )UHVQR6WDWH : + 'UDNH / +A )UHVQR6WDWH : $ A&DOERZO,; )UHVQR&DOLI )UHVQR6WDWH : $ A5DLVLQ%RZO )UHVQR&DOLI )UHVQR6WDWH : $ )UHVQR6WDWH : + BAYLOR &DO3RO\ / $ )UHVQR6WDWH : + EASTERN MICHIGAN IDAHO STATE Baylor leads 2-0 Idaho State leads 2-1 )UHVQR6WDWH : $ Fresno State leads 1-0 +$ 'DWH :LQQHU 6FRUH 6LWH +$ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH %D\ORU / $ )UHVQR6WDWH : + ,GDKR6WDWH / $ %D\ORU / + )UHVQR6WDWH : $ ,GDKR6WDWH / + GEORGIA TECH )UHVQR6WDWH : + )UHVQR6WDWH : + Fresno State leads 2-0 BOISE STATE )UHVQR6WDWH : $ Boise State leads 13-5 (N: 2-0) )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH ILLINOIS +$ )UHVQR6WDWH : $ ,QWUD&RQIHUHQFH :$&0: )UHVQR6WDWH : Fresno State leads 2-0 )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : ) +$ &DO3RO\ / $ )UHVQR6WDWH : + 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,,, 6DQ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ -RVH&DOLI )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 5RDG\¶V+XPDQLWDULDQ%RZO %RLVH,GDKR )UHVQR6WDWH : + %RLVH6WDWH / + 7,(' 7 + %RLVH6WDWH / $ &DO3RO\ / $ %RLVH6WDWH / + &DO3RO\ / + KANSAS STATE HAWAI’I Fresno State leads 2-0 %RLVH6WDWH / $ &DO3RO\ / $ Fresno State leads 26-22-1 )UHVQR6WDWH : + &DO3RO\ / + +$ +$ %RLVH6WDWH / $ )UHVQR6WDWH : $ ,QWUD&RQIHUHQFH :$&0: 'DWH :LQQHU 6FRUH 6LWH %RLVH6WDWH / + &DO3RO\ / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ %RLVH6WDWH / $ &DO3RO\ / $ )UHVQR6WDWH : + )UHVQR6WDWH : + %RLVH6WDWH / + )UHVQR6WDWH : + )UHVQR6WDWH : $ %RLVH6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : %RLVH6WDWH / + LOUISIANA-LAFAYETTE )UHVQR6WDWH : + +DZDL¶L / + Louisiana-Lafayette leads 2-1 %RLVH6WDWH / $ )UHVQR6WDWH : + +DZDL¶L / $ )UHVQR6WDWH : + +$ )UHVQR6WDWH : + +DZDL¶L / $ %RLVH6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + %RLVH6WDWH / +DZDL¶L / + 8//DID\HWWH / $ )UHVQR6WDWH : + -LP6ZHHQH\¶VWKFDUHHUYLFWRU\ )UHVQR6WDWH : $ 8//DID\HWWH / $ 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH )UHVQR6WDWH : + )UHVQR6WDWH : + %RLVH,GDKR ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 115 RECORDS & HISTORY ALL-TIME SERIES RECORDS LOUISIANA-MONROE NEBRASKA )UHVQR6WDWH : $ OREGON STATE Fresno State leads 1-0 Nebraska leads 3-0 )UHVQR6WDWH : + Fresno State leads 8-5 (H: 1-0) )UHVQR6WDWH : $ +$ (H: 0-1; A: 0-2) )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ 1HEUDVND / $ )UHVQR6WDWH : + 2UHJRQ6WDWH / $ 1HEUDVND / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ LOUISIANA STATE 1HEUDVND / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + LSU leads 1-0 )UHVQR6WDWH : + 2UHJRQ6WDWH / $ (A: 0-1) )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH NEVADA )UHVQR6WDWH : + )UHVQR6WDWH : $ /68 / $ )UHVQR6WDWHOHDGV )UHVQR6WDWH : $ 2UHJRQ6WDWH / $ +$ )UHVQR6WDWH : + )UHVQR6WDWH : + ,QWUD&RQIHUHQFH :$&0: 1HZ0H[LFR6WDWH / $ )UHVQR6WDWH : + LOUISIANA TECH 'DWH :LQQHU 6FRUH 6LWH Fresno State leads 9-4 2UHJRQ6WDWH / $ 1HYDGD / $ )UHVQR6WDWH : + +$ 1HYDGD / $ NORTH DAKOTA Fresno State leads 1-0 2UHJRQ6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 1HYDGD / $ (H: 1-0) )UHVQR6WDWH : + 1HYDGD / + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 7,(' 7 $ PORTLAND STATE )UHVQR6WDWH : $ 1HYDGD / $ Fresno State leads 6-0 )UHVQR6WDWH : + )UHVQR6WDWH : + NORTHERN ARIZONA +$ /RXLVLDQD7HFK / $ )UHVQR6WDWHOHDGV 1HYDGD / $ 'DWH :LQQHU 6FRUH 6LWH /RXLVLDQD7HFK / + +$ 1HYDGD / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ 1RUWKHUQ$UL]RQD / + )UHVQR6WDWH : + /RXLVLDQD7HFK / $ )UHVQR6WDWH : + 7,(' 7 $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + /RXLVLDQD7HFK / + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + McNEESE STATE )UHVQR6WDWH : $ )UHVQR6WDWH : + Series tied 1-1 )UHVQR6WDWH : + )UHVQR6WDWH : $ RICE +$ 1HYDGD / $ )UHVQR6WDWH : + Fresno State leads 6-1 'DWH :LQQHU 6FRUH 6LWH 1HYDGD / + +$1 0F1HHVH6WDWH / $ 1HYDGD / $ NORTHERN ILLINOIS 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ Northern Illinois leads 3-2 )UHVQR6WDWH : + )UHVQR6WDWH : + +$1 )UHVQR6WDWH : $ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + MICHIGAN STATE )UHVQR6WDWH : + Michigan State leads 1-0 )UHVQR6WDWH : $ )UHVQR6WDWH : $ 1HYDGD / / )UHVQR6WDWH : + (N: 0-1) )UHVQR6WDWH : + 1RUWKHUQ,OOLQRLV / + 'DWH :LQQHU 6FRUH 6LWH 1HYDGD / + 1RUWKHUQ,OOLQRLV / $ )UHVQR6WDWH : $ 0LFKLJDQ6WDWH / 1HYDGD / + )UHVQR6WDWH : + 5LFH / 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,, 6DQ )UHVQR6WDWH : $ +DZDLCL%RZO +RQROXOX+DZDLCL -RVH&DOLI 1RUWKHUQ,OOLQRLV / )UHVQR6WDWH : + X'URYH+XPDQLWDULDQ%RZO %RLVH,GDKR )UHVQR6WDWH : $ )UHVQR6WDWH : + RUTGERS MISSISSIPPI Fresno State leads 2-0 Mississippi leads 3-0 )UHVQR6WDWH : $ OHIO STATE +$ )UHVQR6WDWH : + Ohio State leads 2-0 (H: 1-0; A: 1-0) 'DWH :LQQHU 6FRUH 6LWH 1HYDGD / $ $1 'DWH :LQQHU 6FRUH 6LWH 0LVVLVVLSSL / $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ 27 0LVVLVVLSSL / + )UHVQR6WDWH : $ 2KLR6WDWHA / 1A )UHVQR6WDWH : H 0LVVLVVLSSL / $ 1HYDGD / + 1HYDGD / $ 2KLR6WDWH / $ 1HYDGD / + A'LVQH\ODQG3LJVNLQ&ODVVLFDWWKH)ORULGD SACRAMENTO STATE MONTANA 1HYDGD / $ &LWUXV%RZO 2UODQGR)OD Fresno State leads 3-0 Fresno State leads 1-0 )UHVQR6WDWH : $ (H: 3-0) (H: 1-0) )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ OKLAHOMA )UHVQR6WDWH : + Oklahoma leads 1-0 )UHVQR6WDWH : + 1HYDGD / + )UHVQR6WDWH : + 1HYDGD / $ (A: 0-1) MONTANA STATE 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + Montana State leads 16-11 NEW MEXICO 2NODKRPD / $ +$ Fresno State leads 11-4 SAN DIEGO 'DWH :LQQHU 6FRUH 6LWH +$ OKLAHOMA STATE San Diego leads 1-0 0RQWDQD6WDWH / + ,QWUD&RQIHUHQFH :$&0: (A: 0-1) 0RQWDQD6WDWH / + Oklahoma State leads 1-0 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ (A: 0-1) 1HZ0H[LFR / $ 6DQ'LHJR / $ 0RQWDQD6WDWH / + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 0RQWDQD6WDWH / $ 1HZ0H[LFR / $ 2NODKRPD6WDWH / $ 0RQWDQD6WDWH / $ )UHVQR6WDWH : $ SAN DIEGO STATE )UHVQR6WDWH : + 1HZ0H[LFR / $ OREGON San Diego State leads 29-23-4 0RQWDQD6WDWH / $ )UHVQR6WDWH : + +$ 0RQWDQD6WDWH / + 2UHJRQOHDGV )UHVQR6WDWH : + +$ Intra-Conference: 18-21-4 )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH &&$$3&$$:$&0: )UHVQR6WDWH : $ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH 0RQWDQD6WDWH / + )UHVQR6WDWH : + 1HZ0H[LFR / + )UHVQR6WDWH : + 0RQWDQD6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : $ 0RQWDQD6WDWH / + 2UHJRQ /27 H )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DQ'LHJR6WDWH / + 0RQWDQD6WDWH / $ 2UHJRQ / 40-4327 A )UHVQR6WDWH : $ 7,(' 7 $ 0RQWDQD6WDWH / + 2UHJRQ / $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ 2UHJRQ / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 2UHJRQ / + 6DQ'LHJR6WDWH / + 0RQWDQD6WDWH / $ 2UHJRQ / $ 0RQWDQD6WDWH / + NEW MEXICO STATE 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : $ )UHVQR6WDWHOHDGV 2UHJRQ / $ 7,(' 7 + )UHVQR6WDWH : + +$ )UHVQR6WDWH : + 0RQWDQD6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 6DQ'LHJR6WDWH / + )UHVQR6WDWH : $ )UHVQR6WDWH : + 7,(' 7 $ )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DQ'LHJR6WDWH / + )UHVQR6WDWH : + 0RQWDQD6WDWH / + )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + 116 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY ALL-TIME SERIES RECORDS 7,(' 7 + 6DQ-RVH6WDWH / $ TCU )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + TCU leads 2-1 )UHVQR6WDWH : $ 6DQ-RVH6WDWH / $ )UHVQR6WDWH : + +$ 81/9 / + )UHVQR6WDWH : $ 6DQ-RVH6WDWH / + 81/9 / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / + 7&8 / $ )UHVQR6WDWH : $ 27 )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : H )UHVQR6WDWH : + )UHVQR6WDWH : $ 6DQ-RVH6WDWH / + 7&8 / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : $ 6DQ-RVH6WDWH / $ TEXAS A&M 6DQ'LHJR6WDWH / + 6DQ-RVH6WDWH / + Texas A&M leads 1-0 )UHVQR6WDWH : + 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : $ (A: 1-0) )UHVQR6WDWH : $ 6DQ'LHJR6WDWH / + )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ 7H[DV$ 0 /47-4527 A 6DQ'LHJR6WDWH / + )UHVQR6WDWH : + 81/9 /27 A 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 6DQ'LHJR6WDWH / + )UHVQR6WDWH : + TEXAS TECH 81/9 / $ 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : $ Texas Tech leads 1-0 ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG )UHVQR6WDWH : + )UHVQR6WDWH : + (A: 0-1) 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH USC 6DQ'LHJR6WDWH / + )UHVQR6WDWH : $ 7H[DV7HFK / $ USC leads 3-1 6DQ'LHJR6WDWH / $ )UHVQR6WDWH : + $1 6DQ'LHJR6WDWH / + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + TOLEDO 6DQ'LHJR6WDWH / $ Fresno State leads 2-1 )UHVQR6WDWH : )UHVQR6WDWH : + )UHVQR6WDWH : $ 86& / $ )UHVQR6WDWH : + +$ 6DQ'LHJR6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 86& / 6DQ'LHJR6WDWH / + 6DQ-RVH6WDWH / $ 86& / $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ 27 )UHHGRP%RZO $QDKHLP&DOLI )UHVQR6WDWH : $ )UHVQR6WDWH :55-54 A )UHVQR6WDWH : + 5R\DO3XUSOH/DV9HJDV%RZO /DV9HJDV1HY )UHVQR6WDWH : + 7ROHGR / $ )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DQ'LHJR6WDWH / $ 6DQ-RVH6WDWH / + UTAH 6DQ'LHJR6WDWH / $ TULSA 6DQ-RVH6WDWH / $ Fresno State leads 4-3 8WDKOHDGV 6DQ'LHJR6WDWH / + )UHVQR6WDWH : + +$1 +$1 6DQ'LHJR6WDWH / $ 6DQ-RVH6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 6DQ-RVH6WDWH / + )UHVQR6WDWH : $ 8WDK / $ )UHVQR6WDWH : + 6DQ'HLJR6WDWH / $ ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : $ 27 )UHVQR6WDWH : + )UHVQR6WDWH : A )UHVQR6WDWH : + )UHVQR6WDWH : + SMU 8WDK / $ Fresno State leads 5-2 7XOVD / 6DQ'LHJR6WDWH / $ 8WDK / $ +$1 7XOVD / $ )UHVQR6WDWH : + 6DQ'LHJR6WDWH / + 27 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH / H 8WDK / $ 608 / $ $XWR=RQH/LEHUW\%RZO 0HPSKLV7HQQ 8WDK / SAN JOSE STATE )UHVQR6WDWH : + 8WDK / $ )UHVQR6WDWHOHDGV )UHVQR6WDWH : $ UC DAVIS 8WDK / + +$ )UHVQR6WDWH : + Fresno State leads 12-5-1 ($6SRUWV/DV9HJDV%RZO /DV9HJDV1HY Intra-Conference: 18-6 )UHVQR6WDWH : $ +$ (3-1 Big West; 14-2 WAC; 1-3 MW) )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH UTAH STATE 608 / 7,(' 7 $ )UHVQR6WDWHOHDGV 6DQ-RVH6WDWH / + )UHVQR6WDWH : $ )UHVQR6WDWH : + 6KHUDWRQ+DZDL¶L%RZO +RQROXOX +$ 8&'DYLV / + Intra-Conference: 6-3 (6-1 WAC; 0-2 MW) )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH SOUTH DAKOTA STATE 8&'DYLV / + )UHVQR6WDWH : + 6DQ-RVH6WDWH / + Fresno State leads 1-0 8&'DYLV / + 8WDK6WDWH / $ )UHVQR6WDWH : $ (H: 1-0) 8&'DYLV / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 7,(' 7 $ 8WDK6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : $ 6DQ-RVH6WDWH / $ 8WDK6WDWH / $ 7,(' 7 + 8&'DYLV / + 8WDK6WDWH / + 6DQ-RVH6WDWH / + SOUTHERN ILLINOIS )UHVQR6WDWH : $ 8WDK6WDWH / + 6DQ-RVH6WDWH / + Fresno State leads 2-1 )UHVQR6WDWH : + 8WDK6WDWH / $ 7,(' 7 $ +$ )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ 8WDK6WDWH / $ 6DQ-RVH6WDWH / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 6RXWKHUQ,OOLQRLV / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 6DQ-RVH6WDWH / + )UHVQR6WDWH : + 8WDK6WDWH / $ 6DQ-RVH6WDWH / $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / + SOUTHERN UTAH )UHVQR6WDWH : $ Fresno State leads 1-0 UCLA 7,(' 7 + 6DQ-RVH6WDWH / $ UCLA leads 6-2 (H: 1-0) 8WDK6WDWH / $ 6DQ-RVH6WDWH / + $1 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 8&/$ / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 8&/$ / $ )UHVQR6WDWH : + 8WDK6WDWH / $ STANFORD 8&/$ / $ )UHVQR6WDWH : + 6DQ-RVH6WDWH / $ Stanford leads 3-0 6DQ-RVH6WDWH / + 8&/$ / $ )UHVQR6WDWH : $ +$ )UHVQR6WDWH : $ 8&/$ / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 8&/$ / $ )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6WDQIRUG / $ )UHVQR6WDWH : )UHVQR6WDWH : + 6DQ-RVH6WDWH / + 6WDQIRUG / $ )UHVQR6WDWH : $ )UHVQR6WDWH : 6DQ-RVH6WDWH / $ 6WDQIRUG / + 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,9 6DQ 8WDK6WDWH / + )UHVQR6WDWH : + -RVH&DOLI 8WDK6WDWH / $ )UHVQR6WDWH : $ 0RXQWDLQ:HVW&KDPSLRQVKLS*DPH TENNESSEE UNLV )UHVQR&DOLI 6DQ-RVH6WDWH / + Tennessee leads 1-0 Fresno State leads 13-6 6DQ-RVH6WDWH / $ (A: 1-0) +$ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH Intra-Conference: 12-4 )UHVQR6WDWH : + 7HQQHVVHH / $ :$&%LJ:HVW0: )UHVQR6WDWH : $ 6DQ-RVH6WDWH / + 'DWH :LQQHU 6FRUH 6LWH 6DQ-RVH6WDWH / $ 81/9C / + 6DQ-RVH6WDWH / + 81/9 / $ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 117 RECORDS & HISTORY ALL-TIME SERIES RECORDS UTEP WASHINGTON WESTERN ILLINOIS WYOMING Fresno State leads 8-3-1 Washington leads 2-1 Fresno State leads 1-0 Series Tied 5-5 +$ (A: 1-2) (H: 1-0) +$1 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH ,QWUD&RQIHUHQFH :$&0: 87(3 / + :DVKLQJWRQ / $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + :DVKLQJWRQ / $ :\RPLQJ / $ )UHVQR6WDWH : $ WASHINGTON STATE WESTERN MICHIGAN )UHVQR6WDWH : + )UHVQR6WDWH : + Fresno State leads 2-0 :\RPLQJ / $ 7,(' 7 $ Washington leads 3-1 (H: 2-0) :\RPLQJ / $ )UHVQR6WDWH : + +$ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH :\RPLQJ / )UHVQR6WDWH : 24-2327 H :DVKLQJWRQ6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 87(3 / $ )UHVQR6WDWH : $ )UHVQR6WDWH : +A )UHVQR6WDWH : $ )UHVQR6WDWH : $ :DVKLQJWRQ6WDWH / + A&DOERZO9,,, )UHVQR&DOLI :\RPLQJ / + 87(3 / + :DVKLQJWRQ6WDWH / $ WISCONSIN 1HZ0H[LFR%RZO $OEXTXHUTXH10 VIRGINIA WEBER STATE Wisconsin leads 3-1 Fresno State leads 1-0 Fresno State leads 4-0 (H: 0-1; A: 1-2) (N: 1-0) (H: 4-0) 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH :27 (1) )UHVQR6WDWH : + :LVFRQVLQ / $ 03&&RPSXWHUV%RZO %RLVH,GDKR )UHVQR6WDWH : + :LVFRQVLQ / + 27 )UHVQR6WDWH : + :LVFRQVLQ / 31-34 A )UHVQR6WDWH : + SERIES AGAINST DEFUNCT PROGRAMS/NON D-I PROGRAMS ADAMS STATE &6)XOOHUWRQ / + CAMP HAAN LaVERNE 'DWH :LQQHU 6FRUH 6LWH &6)XOOHUWRQ / $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + 7,(' 7 $ )UHVQR6WDWH : + )UHVQR6WDWH : + CARUTHERS LEGION )UHVQR6WDWH : + ALAMEDA AIR PAC )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH /D9HUQH / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + CHICO STATE )UHVQR6WDWH : + BAKERSFIELD JC )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 0HUF\%RZO,, $QDKHLP&DOLI &KLFR6WDWH / + LEMOORE HIGH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ &KLFR6WDWH / $ CAL STATE LA )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH &KLFR6WDWH / $ )UHVQR6WDWH : + &DO6WDWH/$ / $ )UHVQR6WDWH : + LEILEHAU ALUMNI )UHVQR6WDWH : + &KLFR6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH BARBARIANS )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + LONG BEACH STATE )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH CALIFORNIA JVs )UHVQR6WDWH : $ FORT ORD )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ &DOLIRUQLD-9V / + &DO6WDWH/$ / $ )UHVQR6WDWH : + )UHVQR6WDWH : + &DOLIRUQLD-9V / + &DO6WDWH/$ / + )UHVQR6WDWH : $ &DOLIRUQLD-9V / + )UHVQR6WDWH : $ FRESNO HIGH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH /RQJ%HDFK6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR+LJK / + /RQJ%HDFK6WDWH / + )UHVQR6WDWH : + )UHVQR6WDWH : + /RQJ%HDFK6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + HARDIN-SIMMONS /RQJ%HDFK6WDWH / + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH /RQJ%HDFK6WDWH / $ CAL CHRISTIAN )UHVQR6WDWH : + +DUGLQ6LPPRQV / $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + +DUGLQ6LPPRQV / + /RQJ%HDFK6WDWH / $ )UHVQR6WDWH : + /RQJ%HDFK6WDWH / + )UHVQR6WDWH : $ CAL STATE NORTHRIDGE HAWAI’IAN ALL-STARS /RQJ%HDFK6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH /RQJ%HDFK6WDWH / + CAL POLY POMONA )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ /RQJ%HDFK6WDWH / + )UHVQR6WDWH : + )UHVQR6WDWH : + HAYWARD STATE /RQJ%HDFK6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + &DO3RO\3RPRQD / + )UHVQR6WDWH : + )UHVQR6WDWH : $ +D\ZDUG6WDWH / + &DO3RO\3RPRQD / + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + /RQJ%HDFK6WDWH / $ CAL STATE FULLERTON HEALANI AC )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH /RQJ%HDFK6WDWH / + Fresno State leads 13-6 &61RUWKULGJH / + )UHVQR6WDWH : $ +$1 )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH CAL TECH )UHVQR6WDWH : $ &6)XOOHUWRQ / Fresno State leads HONOLULU ALL-STARS )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + +RQROXOX$OO6WDUV / + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + HUMBOLDT STATE )UHVQR6WDWH : + &6)XOOHUWRQ / + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + +XPEROGW6WDWH / )UHVQR6WDWH : + &6)XOOHUWRQ / $ CAMP BEALE &DPHOOLD%RZO 6DFUDPHQWR&DOLI )UHVQR6WDWH : + &6)XOOHUWRQ / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + &DPS%HDOH / $ 118 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY SERIES RECORDS AGAINST DEFUNCT PROGRAMS/NON D-I PROGRAMS LOYOLA )UHVQR6WDWH : $ SAINT MARY’S UC SANTA BARBARA 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DLQW0DU\¶V / $ )UHVQR6WDWH : + /R\ROD / + 3DFL¿F / + 6DLQW0DU\¶V / + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DLQW0DU\¶V / + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + )UHVQR6WDWH : + SALINAS JC )UHVQR6WDWH : + /R\ROD / $ 3DFL¿F / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ /R\ROD / + 3DFL¿F / + 6DOLQDV-& / $ )UHVQR6WDWH : $ 7,(' 7 $ ,QGLFDWHVIRUIHLW GRHVQRWDOWHUUHFRUG 3DFL¿F / $ )UHVQR6WDWH : + 3DFL¿F / + SAN DIEGO MARINES 8&6DQWD%DUEDUD / $ 3DFL¿F / + 'DWH :LQQHU 6FRUH 6LWH MARCH FIELD 8&6DQWD%DUEDUD / + 'DWH :LQQHU 6FRUH 6LWH 7,(' 7 $ )UHVQR6WDWH : + 8&6DQWD%DUEDUD / + )UHVQR6WDWH : + 3DFL¿F / + )UHVQR6WDWH : + )UHVQR6WDWH : + 3DFL¿F / $ 6DQ'LHJR0DULQHV / + )UHVQR6WDWH : $ MARE ISLAND NAVY 3DFL¿F / + )UHVQR6WDWH : + 8&6DQWD%DUEDUD / $ 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / $ )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 6DQ'LHJR0DULQHV / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ 6DQ'LHJR0DULQHV / + )UHVQR6WDWH : + MINTER FIELD )UHVQR6WDWH : + 6DQ'LHJR0DULQHV / + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : $ 0LQWHU)LHOG / $ )UHVQR6WDWH : + SAN DIEGO NAVY 0LQWHU)LHOG / + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH USC JVs 7,(' 7 + )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / $ )UHVQR6WDWH : + )UHVQR6WDWH : + SAN FRANCISCO 7,(' 7 + MOLII BEARS 3DFL¿F / $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 6DQ)UDQFLVFR / + WASHBURN )UHVQR6WDWH : $ 3DFL¿F / $ 6DQ)UDQFLVFR / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 3DFL¿F / + 6DQ)UDQFLVFR / + :DVKEXUQ / + 3DFL¿F / $ )UHVQR6WDWH : + )UHVQR6WDWH : + MODESTO JC )UHVQR6WDWH : + 6DQ)UDQFLVFR / $ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / $ 6DQ)UDQFLVFR / + )UHVQR6WDWH : $ )UHVQR6WDWH : + WEST COAST ARMY 7,(' 7 + )UHVQR6WDWH : $ SAN FRANCISCO STATE 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ 3DFL¿F / + 'DWH :LQQHU 6FRUH 6LWH :HVW&RDVW$UP\ / + )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + 7,(' 7 $ )UHVQR6WDWH : + )UHVQR6WDWH : + WEST TEXAS STATE 0RGHVWR-& / $ )UHVQR6WDWH : $ 6)6WDWH / + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + NORTH TEXAS STATE )UHVQR6WDWH : $ )UHVQR6WDWH : + :7H[DV6WDWH / $ 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / + )UHVQR6WDWH : + 17H[DV6WDWH / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ WHITTIER 17H[DV6WDWH / $ )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / $ )UHVQR6WDWH : $ )UHVQR6WDWH : + OCCIDENTAL )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : $ 2FFLGHQWDO / + )UHVQR6WDWH : + SANTA CLARA )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + )UHVQR6WDWH : + )UHVQR6WDWH : $ 6DQWD&ODUD / + )UHVQR6WDWH : $ )UHVQR6WDWH : $ )UHVQR6WDWH : + 7,(' 7 + )UHVQR6WDWH : + 6DQWD&ODUD / + OKLAHOMA CITY PEPPERDINE 6DQWD&ODUD / + WHITWORTH 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 6DQWD&ODUD / + 'DWH :LQQHU 6FRUH 6LWH 2NODKRPD&LW\ / $ 3HSSHUGLQH O $ )UHVQR6WDWH : + )UHVQR6WDWH : + 2NODKRPD&LW\ / + )UHVQR6WDWH : + 6DQWD&ODUD / + 3HSSHUGLQH / $ 6DQWD&ODUD / + WICHITA STATE OLYMPIC CLUB )UHVQR6WDWH : + 6DQWD&ODUD / + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 6DQWD&ODUD / + :LFKLWD6WDWH / $ 2O\PSLF&OXE / + )UHVQR6WDWH : + 6DQWD&ODUD / $ )UHVQR6WDWH : + )UHVQR6WDWH : + :LFKLWD6WDWH / $ PACIFIC PORTLAND :LFKLWD6WDWH / $ Fresno State leads 41-26-2 'DWH :LQQHU 6FRUH 6LWH SB MARINES )UHVQR6WDWH : + +$ )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 7,(' 7 + 6%0DULQHV / $ WILLAMETTE 3DFL¿F / $ 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + REDLANDS STANFORD FROSH 7,(' 7 + )UHVQR6WDWH : $ 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ 3DFL¿F / + )UHVQR6WDWH : + 6WDQIRUG)URVK / + )UHVQR6WDWH : + 7,(' 7 $ )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + ST. IGNATIUS 3DFL¿F / $ REEDLEY 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 7,(' 7 + )UHVQR6WDWH : $ )UHVQR6WDWH : + 6W,JQDWLXV / + )UHVQR6WDWH : + 3DFL¿F / $ REEDLEY HIGH TONOPAH ARMY AIR FIELD 3DFL¿F / + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH )UHVQR6WDWH : $ )UHVQR6WDWH : + 7$$) / + )UHVQR6WDWH : + 3DFL¿F / $ SACRAMENTO JC TULARE HIGH )UHVQR6WDWH : + 'DWH :LQQHU 6FRUH 6LWH 'DWH :LQQHU 6FRUH 6LWH 3DFL¿F / $ )UHVQR6WDWH : + )UHVQR6WDWH : $ )UHVQR6WDWH : + 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 119 RECORDS & HISTORY BULLDOG COACHING HISTORY EMORY DUKE JIM Bulldog Coaching Records RATCLIFFE JACOBS SWEENEY (by Victories) 1950-51 1976-77; 1980-96 Name (Seasons) W L T Pct. Founding Coach-1921* 7-11-1 (.385) 143-73-3 (.653) Jim Sweeney (19) 143 75 3 .654 Pat Hill (15) 112 80 0 .583 James Bradshaw (8) 59 18 5 .750 Clark Van Galder (7) 46 22 2 .671 CONFERENCE TITLES: Darryl Rogers (7) 43 32 1 .573 3&$$ ARTHUR Cecil Coleman (5) 37 13 0 .740 CLARK 3&$$ Arthur Jones (8) 36 26 7 .572 JONES 3&$$ Tim DeRuyter (5) 30 30 0 .500 1921-28 VAN GALDER %LJ:HVW Leo Harris (3) 19 9 1 .661 36-26-7 (.572) 1952-58 %LJ:HVW Stanley Borleske (4) 16 17 2 .486 CONFERENCE TITLES: 46-22-2 (.671) %LJ:HVW Phil Krueger (2) 10 10 0 .500 &DOLIRUQLD&RDVW CONFERENCE TITLES: :HVWHUQ$WKOHWLF JR Boone (3) 10 24 0 .294 &DOLIRUQLD&RDVW &&$$ :HVWHUQ$WKOHWLF Duke Jacobs (2) 7 11 1 .395 &&$$ Alvin Pierson (2) 7 14 2 .348 STANLEY &&$$ BOWL GAMES: Bob Padilla (2) 7 15 0 .318 &&$$ &DOLIRUQLD%RZO : Ken Gleason (2) 6 12 3 .357 BORLESKE &DOLIRUQLD%RZO : Earl Wight (1) 0 6 0 .000 1929-32 &DOLIRUQLD%RZO : Eric Kiesau (1) 0 4 0 4 16-17-2 (.486) CECIL &DOLIRUQLD5DLVLQ%RZO : &DOLIRUQLD%RZ / COLEMAN Bulldog Coaching Records CONFERENCE TITLES: 1959-63 )UHHGRP%RZO : )DU:HVWHUQ 37-13-0 (.740) 1-HHS(DJOH$ORKD%RZO / (by Winning % - min. 20 victories) Name (Seasons) W L T Pct. James Bradshaw (8) 59 18 5 .750 LEO HARRIS CONFERENCE TITLES: PAT HILL Cecil Coleman (5) 37 13 0 .740 1932-35 &&$$ 1997-2011 Clark Van Galder (7) 46 22 2 .671 18-9-1 (.661) &&$$ 112-80 (.583) Jim Sweeney (19) 143 75 3 .654 &&$$ Pat Hill (15) 112 80 0 .583 Darryl Rogers (7) 43 32 1 .573 BOWL GAMES: Arthur Jones (8) 36 26 7 .572 CONFERENCE TITLES: 0HUF\%RZO : CONFERENCE TITLES: Tim DeRuyter (5) 30 30 0 .500 )DU:HVWHUQ :HVWHUQ$WKOHWLF )DU:HVWHUQ PHIL BOWL GAMES: Bulldog Coaching Records KRUEGER ($6SRUWV/DV9HJDV%RZO / (by Games Coached) JAMES 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF / 1964-65 Name (Seasons) W L T Games 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF / BRADSHAW 10-10-0 (.500) Jim Sweeney (19) 143 75 3 221 1936-42, 1946 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF : Pat Hill (15) 112 80 0 192 59-18-5 (.750) 6LOLFRQ9DOOH\)RRWEDOO&ODVVLF : James Bradshaw (8) 59 18 5 82 03&&RPSXWHUV%RZO :27) Darryl Rogers (7) 43 32 1 76 $XWR=RQH/LEHUW\%RZO / Clark Van Galder (7) 46 22 2 70 CONFERENCE TITLES: DARRYL 5RDG\¶V+XPDQLWDULDQ : Arthur Jones (8) 36 26 7 69 )DU:HVWHUQ ROGERS 1HZ0H[LFR%RZO / Tim DeRuyter (5) 30 30 0 60 &&$$ 1966-72 1HZ0H[LFR%RZO / Cecil Coleman (5) 37 13 0 50 &&$$ 43-32-1 (.573) X'URYH+XPDQLWDULDQ%RZO / Stanley Borleske (4) 16 17 2 35 JR Boone (3) 10 24 0 34 BOWL GAMES Leo Harris (3) 19 9 1 29 CONFERENCE TITLES: /LWWOH$OO$PHULFDQ : TIM Alvin Pierson (2) 7 14 2 23 &&$$ DeRUYTER Bob Padilla (2) 7 15 0 22 Ken Gleason (2) 6 12 3 21 2012-2016 EARL BOWL GAMES: Phil Krueger (2) 10 10 0 20 30-30 (.500) &DPHOOLD%RZO / Duke Jacobs (2) 7 11 1 19 WIGHT 0HUF\%RZO / 1944 Earl Wight (1) 0 6 0 6 CONFERENCE TITLES: Eric Kiesau (1) 0 4 0 4 0-6-0 (.000) 0RXQWDLQ:HVW JR BOONE 0RXQWDLQ:HVW 1973-75 10-24-0 (.294) ALVIN BOWL GAMES: 6KHUDWRQ+DZDL¶L%RZO / PIERSON 5R\DO3XUSOH/DV9HJDV%RZO / 1945, 1949 +DZDLCL%RZO / 7-14-2 (.348) BOB ERIC BOWL GAMES: PADILLA KIESAU 5DLVLQ%RZO / 1978-79 2016-INTERIM HEAD COACH 7-15-0 (.318) 0-4 (.000) KEN GLEASON 1947-48 JEFF 6-12-3 (.357) TEDFORD 1ST SEASON 120 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY &21)(5(1&(7,7/(6 YEAR-BY-YEAR: COACHING RESULTS ±&DOLIRUQLD&RDVW&RQIHUHQFH Overall Conference Overall Conference Overall Conference &&& Year Coach W-L-T W-L-T Year Coach W-L-T W-L-T Year Coach W-L-T W-L-T ±&&& $UWKXU-RQHV ...... 3-4-0 ...... 'XNH-DFREV -LP6ZHHQH\ ...... 5-6-0 ...... 1-4-0 ...... $UWKXU-RQHV ...... 7-1-2 ...... 'XNH-DFREV ...... 5-5-0 ...... -LP6ZHHQH\ ...... 5-6-0 ...... 2-3-0 ...... ±)DU:HVWHUQ&RQIHUHQFH ):& $UWKXU-RQHV ...... 7-2-0 ...... 7RWDOV\HDUV -LP6ZHHQH\ ...... 11-1-0 ...... 6-0-0...... ±):& 7LH $UWKXU-RQHV ...... 7-2-0 ...... -LP6ZHHQH\ ...... 6-5-0 ...... 2-4-0 ...... ±):& $UWKXU-RQHV ...... 2-6-1 ...... &ODUN9DQ*DOGHU ...... 8-2-0 ...... -LP6ZHHQH\ ...... 6-6-0 ...... 3-4-0 ...... ±):& $UWKXU-RQHV ...... 5-3-1 ...... &ODUN9DQ*DOGHU ...... 4-4-2 ...... -LP6ZHHQH\ ...... 11-0-1 ...... 7-0-0...... ±&DOLIRUQLD&ROOHJLDWH$WKOHWLF $UWKXU-RQHV ...... 3-3-2 ...... &ODUN9DQ*DOGHU ...... 7-3-0 ...... -LP6ZHHQH\ ...... ...... 6-1-0 ...... $UWKXU-RQHV ...... 2-5-1 ...... &ODUN9DQ*DOGHU ...... ...... -LP6ZHHQH\ ...... 6-5-0 ...... 4-3-0 ...... $VVRFLDWLRQ &&$$ 7RWDOV \HDUV &ODUN9DQ*DOGHU ...... 8-2-0 ...... -LP6ZHHQH\ ...... 10-2-0 ...... 7-0-0 ...... ±&&$$ &ODUN9DQ*DOGHU ...... 5-5-0 ...... -LP6ZHHQH\ ...... 11-1-0 ...... 7-0-0...... ±&&$$ 6WDQOH\%RUOHVNH ...... 1-7-0...... &ODUN9DQ*DOGHU ...... 5-5-0 ...... -LP6ZHHQH\ ...... 8-2-1 ...... 5-1-1 ...... ±&&$$ 6WDQOH\%RUOHVNH ...... 8-0-0...... 7RWDOV\HDUV -LP6ZHHQH\ ...... 10-2-0 ...... 6-1-0 ...... ±&&$$ 6WDQOH\%RUOHVNH ...... 4-6-0...... -LP6ZHHQH\ ...... ...... 6-2-0 ...... 6WDQOH\%RUOHVNH ...... 3-4-2...... &HFLO&ROHPDQ ...... 7-3-0 ...... 5-0-0 ...... -LP6ZHHQH\ ...... 8-4-0 ...... 6-2-0 ...... ±&&$$ 7RWDOV \HDUV &HFLO&ROHPDQ ...... ...... 5-0-0 ...... -LP6ZHHQH\ ...... 5-7-1 ...... 3-4-1 ...... ±&&$$ &HFLO&ROHPDQ ...... 10-0-0 ...... 5-0-0 ...... -LP6ZHHQH\ ...... 5-7-0 ...... 2-6-0 ...... ±&&$$ /HR+DUULV ...... 5-4-0 ...... &HFLO&ROHPDQ ...... 7-3-0 ...... 4-1-0 ...... -LP6ZHHQH\ ...... 4-7-0 ...... 3-5-0 ...... ±&&$$ /HR+DUULV ...... 7-2-1 ...... &HFLO&ROHPDQ ...... 4-6-0 ...... 7RWDOV\HDUV ±&&$$ /HR+DUULV ...... 6-3-0 ...... 7RWDOV\HDUV Totals: 3 years 18-9-1 .661 3DW+LOO...... 6-6 ...... 5-3 ...... ±3DFL¿F&RDVW$WKOHWLF$VVRFLDWLRQ 3KLO.UXHJHU ...... 4-6-0 ...... 1-3-0 ...... 3DW+LOO...... 5-6 ...... 5-3 ...... 3&$$ -DPHV%UDGVKDZ ...... 5-3-1 ...... 3KLO.UXHJHU ...... 6-4-0 ...... 1-3-0 ...... 3DW+LOO...... 8-5 ...... 5-2 ...... ±3&$$ -DPHV%UDGVKDZ ...... 8-1-1 ...... Totals: 2 years 10-10-0 .500 3DW+LOO...... 7-5 ...... 6-2 ...... ±3&$$ -DPHV%UDGVKDZ ...... 7-3-0 ...... 3DW+LOO...... 11-3 ...... 6-2 ...... ±%LJ:HVW&RQIHUHQFH -DPHV%UDGVKDZ ...... ...... 'DUU\O5RJHUV ...... 7-3-0 ...... 3-2-0 ...... 3DW+LOO...... ...... 6-2 ...... -DPHV%UDGVKDZ ...... ...... 'DUU\O5RJHUV ...... 3-8-0 ...... 3-2-0 ...... 3DW+LOO...... ...... 6-2 ...... ±%LJ:HVW&RQIHUHQFH -DPHV%UDGVKDZ ...... 4-3-2 ...... 'DUU\O5RJHUV ...... 7-4-0 ...... 3-2-0 ...... 3DW+LOO...... ...... 5-3 ...... ±%LJ:HVW&RQIHUHQFH 7LH -DPHV%UDGVKDZ ...... ...... 'DUU\O5RJHUV ...... 6-4-0 ...... 1-3-0 ...... 3DW+LOO...... 8-5 ...... 6-2 ...... ±:$& 7LH 7RWDOV\HDUV 'DUU\O5RJHUV ...... 8-4-0 ...... 4-2-0 ...... 3DW+LOO...... 4-8 ...... 4-4 ...... ±:$& 7LH 'DUU\O5RJHUV ...... 6-5-0 ...... 3-2-0 ...... 3DW+LOO...... ...... 6-2 ...... ±:$& 7LH 1R)RRWEDOO :RUOG:DU,, 'DUU\O5RJHUV ...... 6-4-1 ...... 1-3-0 ...... 3DW+LOO...... 7-6 ...... 4-4 ...... 7RWDOV\HDUV 3DW+LOO...... 8-5 ...... 6-2 ...... 0RXQWDLQ:HVW 7LH (DUO:LJKW ...... 0-6-0...... 3DW+LOO...... 8-5 ...... 5-3 ...... 0RXQWDLQ:HVW -5%RRQH ...... ...... 1-3-0 ...... 3DW+LOO...... ...... 3-4 ...... $OYLQ3LHUVRQ ...... 4-6-2...... -5%RRQH ...... 5-7-0 ...... 1-3-0 ...... Totals: 15 years 112-80-0 .583 7RWDOV\HDUV -5%RRQH ...... 3-8-0 ...... 1-4-0 ...... Totals: 3 years 10-24-0 .294 7LP'H5X\WHU ...... ...... 7-1 ...... -DPHV%UDGVKDZ ...... 8-4-0 ...... 7LP'H5X\WHU ...... 11-2 ...... 7-1 ...... 6HHDERYH -LP6ZHHQH\ ...... 5-6-0 ...... 3-1-0 ...... 7LP'H5X\WHU ...... 6-8 ...... 5-3 ...... -LP6ZHHQH\ ...... ...... 4-0-0 ...... 7LP'H5X\WHU ...... ...... 2-6 ...... .HQ*OHDVRQ ...... 3-6-2 ...... VHHWRWKHULJKW 7LP'H5X\WHU ...... 1-7 ...... 0-4 ...... .HQ*OHDVRQ ...... 3-6-1 ...... Totals: 5 years 30-30 .500 7RWDOV\HDUV %RE3DGLOOD ...... 3-8-0 ...... 1-4-0 ...... %RE3DGLOOD ...... 4-7-0 ...... 3-2-0 ...... (ULF.LHVDX ...... 0-4 ...... 0-4 ...... $OYLQ3LHUVRQ ...... 3-8-0...... 7RWDOV\HDUV Totals: 0 years (Interim HC) 0-4 .000 6HHDERYH ...... $OO7LPH5(&25' 6HDVRQV &RQIHUHQFH7LWOHV ...... ALL-TIME ASSISTANT COACHES LEO HARRIS (1933-35) PHIL KRUEGER (1964-65) PAT HILL (1997-2011) 5R\1LVZDQGHU -DFN%RKDQ .HQ*OHDVRQ %RE9DQ*DOGHU 3HWH$ODPDU .HUU\/RFNOLQ .HOO\6NLSSHU %RE%XUJHVV -RKQ5HDUGRQ 'LFN9DQ*DOGHU 0LFKD$OED $QG\/XGZLJ 7LP6NLSSHU JAMES BRADSHAW (1936-42, 46) -RKQ%D[WHU 7RP0DVRQ .HYLQ6WHHOH +DO%HDWW\ 52&RXUWULJKW $OYLQ3LHUVRQ DARRYL ROGERS (1966-72) 'DQ%URZQ -LP0F(OZDLQ 5DQG\6WHZDUW 6WDQ%RUOHVNH .HQ*OHDVRQ -&7URPEHWWD %RE%XUJHVV 'LFN0XUUD\ %RE9DQ*DOGHU )UDQN&LJQHWWL 5XI¿Q0F1HLOO -HII7HGIRUG -LP&ROEHUW %RE3DGLOOD .HYLQ&R\OH 7UHQW0LOHV -RH:DGH -HWKUR)UDQNOLQ 'RXJ1XVVPHLHU 'HQQLV:DJQHU EARL WIGHT (1944) 'HUHN)UD]LHU :LOO3OHPRQV 0DUN:HEEHU -D\)OLQW+DQQHU JR BOONE (1973-75) -HII*UDG\ -RKQ6HWWOH -':LOOLDPV %LOO%DLUG 3DW&DOODKDQ 'LFN5RDFK .HQ*UHHQH 7LP6LPRQV .HLWK:LOOLDPV %RE%XUJHVV -RKQ*RGGHQ 'DQ6WRFNWRQ ALVIN PIERSON (1945, 49) 6WHYH+DJHQ 3HWH%HLGHQ %RE%XUJHVV (DUO:LJKW 'RQ%ROW -D\)OLQW+DQQHU BOB PADILLA (1978-79) TIM DERUYTER (2012-2016) .HQ%OXH &KDUOLH+DZWKRUQH %LOO6WHZDUW 5RQ$QWRLQH (ULF.LHVDX %XUO7ROHU,,, 'HQQLV(ULFNVRQ 0LNH+LOO 'HO:LJKW KEN GLEASON (1947-48) -RH%HUQDUGL 7LP0F'RQDOG 1LFN7RWK -RKQ*RGGHQ 0LNH0DUW] %RE%XUJHVV 0DO)LHVH $OYLQ3LHUVRQ 'DYLG%URZQ &DPHURQ1RUFURVV -RH:DGH 3KLO(DUOH\ -RUGDQ3HWHUVRQ /RUHQ]R:DUG DUKE JACOBS (1950-51) JIM SWEENEY (1976-77, 80-96) 3HWH*HUPDQR 'DYH6FKUDPP 0DUN:HEHU 3HWH%HLGHQ 0DO)LHVH &KXFN0RUDQ -RQ$QDER 0LNH+LOO 6WHYH0RRVKDJLDQ 0DUFXV:RRGVRQ %RE%XUJHVV .HQ*OHDVRQ 5RQ$QWRQ 3DW+LOO 5LFK2OVRQ .HQ%OXH -RKQ+XVE\ %RE2ZHQV JEFF TEDFORD (2017-PRESENT) /HRQ%XUWQHWW &OLII+\VHOO 5RG3HUU\ CLARK VAN GALDER (1952-58) -DPDU&DLQ -RKQ'LIHGH :DOW.OLQNHU %LOO6WHZDUW %RE%XUJHVV .HQ*OHDVRQ -DPLH&KULVWLDQ %LOO'ROH 0LNH5DVPXVVHQ -HII7HGIRUG 0DO)LHVH 'DUUHO6WDQOH\ .DOHQ'H%RHU 'HQQLV(ULFNVRQ :LOO\5RELQVRQ %REE\7XUQHU 5\DQ*UXEE -HWKUR)UDQNOLQ 5RELQ5RVV 0LNH:DXÀH .LUE\0RRUH CECIL COLEMAN (1959-63) *UHJ*LEVRQ .HOO\6NLSSHU -':LOOLDPV 2UORQGR6WHLQDXHU %RE%XUJHVV .HQ*OHDVRQ %RE9DQ*DOGHU -RKQ*RRGHQ 5LFN6WDQQDUG 'HO:ULJKW 6FRWW7KRPSVRQ .HQ*UHHQH 5RQ0HHNV %HUW:DWWV &KDUOLH+DZWKRUQH -RKQ0LNOHVK -':LOOLDPV 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 121 RECORDS & HISTORY ALL-TIME LETTERWINNERS A ...... %DUWOHZVNL5LFK ...... %URFNHWW'RQ ...... &KDUWHUV&OLIWRQ ...... 'DYLV6KDUURG ...... 2007-08 $EDMLDQ'DQQ\ ...... %DVV'DYH ...... %URQ]DQ1LFN ...... &KHDWKDP5\DQ ...... 'DYLVRQ7\HOHU ...... 2011-12-13-14 $GDPR'DYLG ...... 2001-02-03 %DVV*UHJ ...... %URRNV%REE\ ...... &KLDUDPRQWH*LDFKLQR ...... 'D\.HLWK ...... $GDPV'DYDQWH ...... 2012-13 %DWHV1LFN ...... 2007-08 %URRNV-HUPDLQH ...... ...... 'D\0RQWH ...... $GDPV'DYH ...... %DWWOH)UDQN ...... %URRNV.HOO\ ...... &KLFRQLQH/DUU\ ...... 'D\WRQ.HLWK ...... $GDPV.HYLQ ...... %DWWOH/DUU\ ...... %URRNV1LFN ...... &KLOGHUV%HQ ...... 'H$PDUHO-LP ...... $GDPV0DUN ...... %DXPVWDUN3HWHU ...... %URZQ%LOO ...... &KULVWHQVHQ-RUGDQ .2003-04-05-06 'HDQ9LFWRU ...... 2011-12 $GDPV1DWH ...... 2006-07 %DXWLVWD-XDQ ...... 2000-01-02 %URZQ&KDUOHV ...... &KULVWLDQ-DPLH ...... 'HFN/DZUHQFH ...... $GDPV6WDQ ...... %D[WHU5REHUW ...... %URZQ&ODXGH ...... &KLVRP7RGG ...... 2007 'H&KDLQH)UDQN ...... $GULDQ%LOO ...... %D\QH&KULV ...... %URZQ'LFN ...... &KXG\-HII ...... 'H&RVWD$GDP ...... 2013-14 $GROSK1RUPDQ ...... %HDVOH\:LQVWRQ ...... %URZQ'RXJ ...... &KXKODQWVHII0LNH...... 'H)DELR0LFKDHO ...... $MLURWXWR6H\L ...... %HDWW\+DO ...... %URZQ(ULF ...... 2007 &KLVP7 ...... 'HPRWR*HRUJH ...... $NHUV0DWW ...... %HERXW0DUN ...... %URZQ-RKQ ...... &LFXWR-RKQ ...... 'HQPDQ&KULV ...... 2003-04-05-06 $NLQV'RQ ...... %HFNHU'RQ...... %URZQ0RUULV ...... &ODLERUQH$GULDQ ...... 'HQQHQ5RGJHU ...... $ODPDQ$O ...... %HFNHU-RH ...... %URZQ1LFN ...... &ODQF\:LOOLDP ...... 'HQQLQJ&ODUHQFH ...... 2000-01 $OEHUV5RQ ...... %HFNVWURP&ODUN ...... %URZQ3DW...... &ODUN$O ...... 'HQQLV7HUUDQFH ...... 2011 $OH[DQGHU$QGUH ...... %HJLQ'LUN ...... %URZQ3DXO...... &ODUN'RQ ...... 'HQQLV7HUU\ ...... $OH[DQGHU+DOEHUW ...... %HKUHQV-RKQ ...... %URZQ4XDDGLU ...... 2005-07 &ODUN-RKQ ...... 'H2ULDQ0DOFROP ...... $OIDUR-RH ...... %HODWWL-RKQ ...... %URZQ5HJJLH ...... &ODUN3DW ...... 'HU*DUDEHGLDQ$UD ...... $OODLQ,YDQ ...... %HOO%UDG ...... %URZQ6WUDWWRQ ...... 2014-15-16 &ODXVHQ+ ...... 'H6DOOHV)UDQN ...... $OOHQ%XG ...... %HOO&DOYLQ ...... %URZQ7HUHQFH ...... &OD\EDXJK3DXO ...... 'HVKD\$QGUH ...... $OOHQ&XUWLV ...... %HOO/RUQH ...... 2007-10 %URZQ7RQ\ ...... &OHODQG'LFN ...... 'HWZLOHU'\ODQ ...... 2012-13-14-15 $OOHQ'HUULFN ...... %HOO0LNH ...... 2016 %URZQ7UDYLV ...... &OXWWV7\OHU ...... 2004-05-06-07 'LH]'LFN ...... $OOHQ)ULW] ...... %HODWWL-RKQ ...... %URZQ:LOOLDP ...... &REE%RE ...... 'LOHV$ZDQ ...... 2002-03-04-05 $OOHQ-HUU\ ...... %HOOL%DUU\ ...... %URZQHOO/HH ...... &RKDJDQ*DU\ ...... 'LOIHU7UHQW ...... $OOHQ-XVWLQ ...... 2016 %HORQ\3DWULFN ...... 2016 %UXPERXJK*HRUJH ...... &RKQ0LFKDHO ...... 'LPDODQWH-RQ ...... $OOLVRQ-DPHV ...... %HQFN(UQLH ...... %UXP¿HOG6\OYHVWHU ...... &ROEHUW/HUR\ ...... 'LRQ&KHW ...... $OOLVRQ-HIIUH\ ...... 2016 %HQJWVRQ*DU\ ...... %UXPPHWW7UHQW ...... &ROEXUQ5\DQ ...... 'LVOHU0LNH ...... $OORZD\6WDQOH\ ...... %HQQHWW%UXFH ...... %UXQHU0DXU\ ...... &ROFKLFR'RPLQLF ...... 'LWWHQELU(GGLH ...... $OVWRQ6HDQ ...... 2011-12 %HQQHWW-DPLH ...... %U\DQW(OWRQ ...... &ROGLURQ-RVK ...... 'RFN-% ...... 2011 $PHULQH*DU\ ...... %HUJ'RQDOG ...... %U\DQW-DURQ ...... 2016 &ROHPDQ&DUQHOO ...... 'RFNVWDGHU-RKQ ...... $PHQGROD.HQQ\ ...... 2005-06 %HUJ0LNH ...... %XFNHUW-D\ ...... &ROHPDQ/DUQHOO ...... 'RGVRQ*OHQQ ...... $QDER-RQ ...... %HUQDUGL-RH ...... %XHFKHOH(ULF ...... &ROHPDQ5REHUW ...... 'RNRR]OLDQ1LFN ...... $QGHUVRQ&UDLJ ...... %HUULDQ%HUQDUG ...... %XHQDWH5RQ ...... &ROHV/HZLV ...... 'ROODUKLGH$QWKRQ\ ...... $QGHUVRQ*UHJ ...... %HUWUXFFL-LP ...... %XIIXQD%LOO...... &ROOLHU$QWKRQ\ ...... 'RPLQLFL-XOLXV ...... $QGHUVRQ.LOWRQ ...... 2015 %HUXNRII(VH\ ...... %XIRUG(PPHWW ...... &ROOLQ3DW ...... 'RPRWR/\PDQ ...... $QGHUVRQ0\URQ ...... %HVVH\&RUOLVV ...... %XUFK'RQQHOO ...... &ROOLQV'HDQ ...... 'RQDEHGLDQ3DXO ...... $QGUHZV&KDUOHV ...... %HVVH\5RVFRH ...... %XUGLFN'RQ ...... &ROOLQV5LS ...... 'RQDWL5LFKLH ...... $QGUHZV'ZD\QH ...2003-04-05-06 %HVW)...... %XUJHVV5REHUW ...... &ROOLQV5RQ ...... 'RULV0DUN ...... $QGUHZV5LFKDUG ...... %HWWHQFRXUW'DUUHOO ...... %XUN&KULV ...... &RPIRUW-RHO ...... 'RULV0DUVKDOO ...... $QH\7RP ...... %H]]DULGHV7HG ...... %XUOH\1LFN ...... &RQQHWWH%UDQGRQ ...... 2014 'RXJODV*UHJ ...... $QVRODEHKHUH0LNH ...... %KDWWL$KPDG ...... %XUQHWW%U\DQ ...... &RQUDG&KULV ...... 'RZQH\%ULDQ ...... $QWRQ5RQ ...... %LDPD'LFN ...... %XUQHWW9LFWRU ...... &RQURZ'DQ ...... 'UDWK3KLO ...... $QWRQHWWL5R\ ...... %LGZHOO2OLYHU ...... %XUUHOO%ULDQ ...... 2014 &RQWL'RQ ...... 'UDWL%HQ ...... $SOH\* ...... %LJHORZ$OSKRQVR ...... %XUURZ'DYH ...... &RRN/DUU\ ...... 'UHVFKXLHU:DOW ...... $SSOHJDWH'DYH ...... %LJJV5LFN ...... %XUVH,VDLDK ...... 2010-11-12-13 &RRN7HUU\ ...... 'ULVFROO'RQDOG ...... $SSULWH0LFKDHO ...... %LQJHU%RE ...... %XUWRQ-% ...... &RRNV$GULDQ ...... 'UXFWRU-RH ...... $UHOODQHV-LP ...... %LOOLQJWRQ*UHJ ...... %XUWRQ-DPHV ...... &RRQH\7HUU\ ...... 'XDUWH6FRWW ...... $UHPDJQL'RQ ...... %LVKRS(UYLQ ...... %XVWDPDQWH(GGLH ...... &RRSHU/HVOLH ...... 'X%RLV5REELH ...... 2004 $UJHQWLQR0LNH ...... %LVKRS5DQGL ...... %XWOHU0LFKDHO ...... 2012 &RRSHU7D\ORU ...... 'XGOH\'RQ ...... $UPVWURQJ0DUFHOOXV ...... %LVWULFN)UHG ...... %XWOHU1DWH ...... &RUGOH6WHYH ...... 'XHNHU/DQFH ...... $UQROG-DKLQH ...... %L]]OH.HLWK ...... %\UG:DOWHU ...... &RUGD+DQN ...... 'XII\.\OH ...... 2007 $UQROG-HII ...... %ODFN'LFN ...... &RULSSR-RQ ...... 'XJDQ&KULV ...... $UVLQLDQ5REHUW ...... %ODFNVLOO-RKQ ...... C ...... &RUQHWW'RQ ...... 'XQEDU'DUUHOO ...... $VKIRUG*UHJ ...... %ODFNZHOO-HURP\ ...... &DLQ'LFN ...... &RUWH]1HIWDOL ...... 'XQFDQ'RQ ...... $VKIRUG.HYLQ ...... %ODNHQH\-DPHV ...... &DLUQV:DOWHU ...... &RVWD%LOO ...... 'XQJDQ- ...... $VKPRUH7HUU\ ...... %ODQGLQ-RVLDK ...... 2015 &DOGZHOO'DOODV ...... &RVWD/H5R\ ...... 'XQQ'DYLG ...... $VSDUXKRY$VHQ ...... 2000-01-02 %OHGVRH ...... &DOODKDQ3DW ...... &RVWHOOR5RFFR ...... 'XQQ'DYRQ ...... 2011-12 $VWRQ%LOO ...... %RJGDQRYLFK0DUN ...... &DPDFKR-LPP\ ...... 2016 &RWWHQ*OHQ ...... 'XQQ'HVLD ...... $WDLGH&UDLJ ...... %RKDQ-DFN ...... &DPLOOL-HII ...... 2013-14-15-16 &RZOHV7HG ...... 'XQQ5REHUW ...... $WNLVVRQ0DULV ...... %ROLQ3DW...... &DPS5H\QDUG ...... &R[5RQ ...... 'XUDQ3HWH ...... $XDNLDQ+DUROG ...... %ROW'RQ ...... &DPSEHOO%\URQ ...... &UDLJ&ROXPEXV ...... $XJLHQ'RXJ ...... %RQQKHLP%R ...... 2012-13-14-15 &DUEDMDO.LUE\ ...... &UDPQHU(OPHU ...... E ...... $XVWLQ*HQH ...... %RRNHU'RQ\HOO ...... 2003-04 &DUGHQ%ULDQ ...... &UDYHU$DURQ ...... (FNHUW+HUPDQ ...... $X[LHU'DYH ...... %RRQH%RE ...... &DUGZHOO'RQ ...... &UDZIRUG%LOO ...... (GH&KDG ...... $YLOD$OEHUW ...... %RUED/DUU\ ...... &DUOLVOH5REHUW ...... &UDZOH\-DVRQ ...... 2007 (GHUDLQH(MLUR ...... 2013-14-15 $YRQ.HQQ\ ...... 2006-07-08 %RUGDJDU\6WDQOH\ ...... &DURSUHVVR*DU\ ...... &URPELH6WHYH ...... (GPRQVRQ'DOH ...... $\HUV7HG...... %RUHKDP*DU\ ...... &DUSHQWHU/...... &URQN&KULVWLDQ ...... 2016 (GZDUGV&XUWLV ...... $]KGHULDQ+HQU\ ...... %RUJ.HQQ\ ...... &DUU'DYLG ...... &URSV\ ...... (GZDUGV'HPHWULXV ..... $]]DUR%RE ...... %RUMDV3KLO ...... &DUU'HUHN ...... 2011-12-13 &URVV-LP ...... (GZDUGV'HYRQQH ...... %RUMDV9LQFH ...... &DUU*DU\ ...... &URVV5RQ ...... (GZDUGV.DZLND ...... 2003 B ...... %RVFKPD5\DQ ...... 2011 &DUU0DOFROP ...... &UXPS'ZD\QH ...... (GZDUGV.HQGDOO ...... 2000-01-03 %DFKHORU(UQLH ...... %RWHOOR(PLOLR ...... &DUU0LFKDHO...... &UXPS7RQ\ ...... (GZDUGV6KDQQRQ ...2012-13-14-15 %DFROLQL-RH ...... %RZHQV&UDLJ ...... &DUWHU%HDX...... &XOYHU7\URQH ...... 2002-03-04-05 (JHOKRIHU5D\...... %DFRQ'DUUHOO ...... %R\G'DQLHO ...... &DUWHU&KULV ...... &XPPLQJV(OPHU ...... (OVHQEUDXQ/H5R\ ...... %DJDQV-RKQ ...... %R\G'DYH ...... &DUWHU(G ...... &XPPLQJV-DPHV ...... 2002 (OGHU/HQ ...... %DKU3DXO ...... %R\HU'DUUHQ ...... &DUWHU.HQ ...... &XQGDQ)UHG ...... (OLFHFKH-RH ...... %DLOH\-DPHV ...... 2015-16 %R\HV9DQFH ...... &DUWHU6XJH ...... &XQQLQJKDP'HYDQ .. (OLSXORV3HWH ...... %DLOH\-HII ...... %UDGGRQ5RJHU ...... &DUWHU7HUU\ ...... &XVDWRU0DUN ...... (OODUG+HQU\ ...... %DLOH\5DPVH\ ...... %UDGIRUG/DUU\ ...... &DVDQRYD$OHF ...... &XVLFN%ODNH ...... 2016 (OOLV$- ...... 2010 %DLQV-DV...... 2002-03-04 %UDJJ5RQ ...... &DVDV'DQQ\ ...... (OOLV-DPDO ...... 2013-14-15-16 %DNHU(GGLH ...... %UDPHU.HHOH\ ...... &DVK'DUU\O ...... 2013-14 D ...... (PHU]LDQ/DUU\ ...... %DNHU*OHQQ ...... %UDPHU/DUV ...... 2012-13 &DVLGD.HQ ...... 'DFN(GJDU ...... (PHU]LDQ7 ...... %DNHU6WHSKHQ ...... %UDQGRQ/HRQDUG ...... &DVQHU6WHYH ...... 'DLJOH$QWKRQ\ ...... (QJVWURP'HO ...... %DQNV&RUQHOO ...... %UDQGVWDWHU7RP ....2005-06-07-08 &DVWLOOR*UHJ ...... 'DLOH\0DUF ...... 2000-01-02-03 (QORH5DOSK ...... %DQNV'HYRQ ...... %UDQVWHWWHU9LQFH .... &DVWUR)UDQN ...... 'DOHQD)UDQN ...... 2016 (QORZ%RE ...... %DOO-LPP\ ...... %UDVH'DYH ...... &DWKFDUW6FRWW ...... 'DPURQ3DXO ...... (UGPDQ-DFN ...... %DQFURIW ...... %UDYH(G ...... &DWOLQ(G ...... 'DQLHOV(XJHQH ...... (VFROD$O ...... %DQLVWHU5RVV ...... %UDWFKHU-LP ...... &DWR0DWW ...... 'DQLHOV0HOYLQ ...... (VSLQR]D%RE ...... %DQNV&RUQHOO ...... 2007 %UD[WRQ(PHU\ ...... &DWR3DXO ...... 'DUURZ6FRWW ...... (WKHULGJH%LOO ...... %DUQHV-RH ...... %UHVKHDUV4XHQWLQ ...... 2012 &D\ZRRG9HUQRQ ...... 'D6LOYD/XLV ...... (YDQV5DVKDG ...... 2008-10-11-12 %DUQHV5LOH\ ...... 2011-12-14 %UHZHU'H:D\QH ...... &KDPEHUODLQ%UHWW ...... 'DYLHV7HPSOH ...... (YDQV6RQQ\...... %DUUHWW-DQ ...... %ULJKDP%RE ...... &KDPLOELGH&KDUOLH ...... 'DYLV%HQ ...... (YDQV7RQ\ ...... %DUDQHN5DQG\ ...... %ULRQ-HUHP\ ...... &KDQFH6DP ...... 'DYLV-DFN ...... (YHUHWWH-HUU\ ...... %DUVRWWL0DUN ...... %ULVFR0DUORQ ...... 2003-04-05-06 &KDSPDQ.HQ ...... 'DYLV0DUTXH ...... (ZHUV6 ...... %DUWHOV)UHG ...... %ULWWLQJKDP5H[ ...... &KDUOVRQ&KHWW\ ...... 'DYLV5RGQH\ ...... 2002-03 (ZLQJ'DYH ...... 122 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY ALL-TIME LETTERWINNERS F ...... *DWHV7RQ\ ...... +DQQHU'HOPDU ...... +RZDUG:LOOLH ...... -RQHV.HYLQ ...... )DLUPDQ-DURQ ...... 2003-04-05-06 *DWUHOO5RE ...... +DQQHPDQQ&OLII .... +R\W%RE ...... -RQHV/- ...... 2010-11-12-13 )DOOHU&DUO...... *DXWVFKL/DUU\ ...... +DQQHU6SDUN\ ...... +XEEDUG0LNH ...... -RQHV/DQFH ...... )DQXFFKL/HGLR ...... *DZOH\&KULV ...... +DQVHQ*HQH ...... +XGVRQ%ODNH ...... -RQHV0\URQ ...... )DUPHU&KDUOHV ...... *HH'DUHQ ...... +DQVRQ&UDLJ ...... +XGVRQ5RQDOG...... -RQHV7HUUDQFH ...... )DULD-RH ...... *HRUJH3UHVWRQ ...... +DQVRQ5REHUW ...... +XHVFD$XJLH ...... -RQHV7RPP\ ...... )DULV-DQ ...... *HUDUGLQ-RH ...... +DQVRQ5XG\ ...... +XII2UODQGR ...... -RUGDQ-DPLUH ...... 2015-16 )DURWWH*UHJ ...... *HUPDQ\6DP ...... +DUERXU'DYH ...... +XJKHV%UDQGRQ .....2013-14-15-16 -RUGDQ.HYLQ ...... )DUULV'RQ ...... *HWWULGJH%URQVRQ ...... +DUGDZD\'HOYRQ ...... 2014-15-16 +XJKHV&DUO ...... -RUGDQ5RQDOG ...... )DXQW/H5R\/\QQ ...... *LDQQHWWD&KULV ...... +DUGDZD\7RQ\ ...... +XJKHV-XMX ...... 2016 -RUGH-DNH ...... 2005-06-07-08 )HLFKWPHLU7HG...... *LEVRQ5D\...... +DUGLQJ$QWKRQ\ .... +XJKHV/RJDQ ...... 2016 -RUJHQVHQ(UQLH ...... )HOORZV-DFN ...... *LJDQWLQR-RH ...... +DUGLQJ5XVVHOO ...... +XPH%LOO ...... -XU\-HUU\ ...... )HUJXVRQ'DYH ...... *LOEHDX(QLV ...... +DUGLQJ:LOO ...... 2007-08 +XPSKUH\2ZHQ ...... )HUJXVRQ-RH ...... *LOEHUW'HDQGUH ...... 2000-01-02-03 +DUGZLFN-HVVH ...... +XPSKUH\V ...... )HUQDQGH]-RH ...... 2003-04-05-06 *LOEHUW*OHQ ...... +DUSHU$ODQ ...... +XPSKUH\V9HUQRQ K ...... )HXHUEDFK0DUN ...... *LOEHUW0HUULWW ...... +DUSHU,DQ...... +XQNLQV%\URQ ...... .DDHNXDKLZL.HSD ...... )LHOGV5DQGDOO ...... 2002 *LOOLQJKDP:DOW ...... +DUSHU-RVK...... 2011-13-14 +XQNLQV:LOIUHG ...... .DLVHU(G ...... )L¿WD$OH[...... 2012-13-14-15 *LOVRQ5D\ ...... +DUUHOO/RJDQ ...... +XQW(UYLQ ...... .DLVHU*DU\ ...... )L¿WD2ID ...... 2011 *LQHV5D\ ...... +DUULQJWRQ*UDQW ...... +XQW0DWW ...... .DUUDNHU5XVVHOO ...... )LJXHURD)UHG ...... *LQVEXUJ(UZLQ ...... +DUULV$WQDI ...... +XQW7RGG ...... 2012-13-14-15 .DXIPDQ0DUW\ ...... )LOLFH-HUU\ ...... *LRUJL%DOGR ...... +DUULV%U\FH ...... +XQWLQJWRQ5RJHU ...... .D]DQMLDQ-RKQ ...... )LONLQV:DOW ...... *LUGOHVWRQH-LP ...... +DUULV&DUO5D\ ...... +XVV-DVRQ ...... 2005 .D]DULDQ%U\DQ ...... )LQFKH*DU\ ...... *LYHQV'LFN ...... +DUULV-RKQ ...... .HLWK'R\OH ...... )LQOH\%HUQDUG ...... *L]]L/DUU\ ...... +DUULV/HH ...... I ...... HOOH\-DFN ...... )LQOH\, ...... *ODVV,VDDF ...... +DUULV0LFKDHO ...... ,DFREHOOLV6DP ...... .HOOQHU6DP ...... )LQN'HQQLV ...... *ODVV7\TXZDQ ...... 2015-16 +DUULV0LNH ...... ,NH,NHQQD ...... 2005-06-07-08 .HOO\$QWKRXOD ...... 2015-16 )LQQHUW\6HDQ ...... 2002-03-04 *OD]HEURRN%RE ...... +DUULV0RVHV ...... ,PULH-D\ ...... .HOO\5RDUN ...... )LVFK*HRUJH ...... *OHDVRQ.HQQHWK ...... +DUULV5REHUW ...... ,QGHUEOHWHQ%RE ...... .HQGLFN%LOO ...... )LVFKHO%UDG ...... *OHQQ:DOWHU ...... +DUULV7RQ\ ...... ,QJOHKDUW-RKQ ...... .HUDQ'HQQLV ...... )LVFKHU*RUGRQ ...... *ORYHU&O\GH ...... +DUULVRQ*DU\ ...... ,UDFKHWD-DLPH ...... .HUE\)UDQN ...... )LVFKHU-DFN ...... *RHVVOLQJ.HYLQ ..... +DUULVRQ1DW ...... 2010-11-12-13 ,UHODQG7KRPDV ...... .HUFKRII$ODQ ...... )LVKHU$QWKRQ\ ...... *RII&HFLO ...... +DUWPDQQ5XV ...... ,UROD-RKQ ...... .H\DQ&KDUOHV ...... )LVKHU0DWW ...... *RLVKL)UDQN...... +DUYH\%LOO ...... ,WVNRII5RQ ...... .H\HV(YHUHWW ...... )LVWHU/DUU\ ...... *RQ]DOHV3HGUR ...... +DU\XQJ-RVK ...... ,YRU\0LFKDHO ...... .H\HV5 ...... )ODQQDJDQ7RP ...... *RRFK.HLWK ...... +DVWLQJV...... ,ZDVDNL/DUU\ ...... .H]LULDQ%RE ...... )OHWFKHU/DID\HWWH...... *RRGPDQ.\OH ...... 2002-03-04-05 +DW¿HOG5 ...... .H]HULDQ5RELQ ...... 2005 )ORUHV0LNH ...... *RRGZLQ$ODQ ...... 2003-04-05-06 +DZNLQV/\QGHOO ...... 2001-02-03 J...... LHUVWLQH*RUGRQ ...... )RFNH%HQ ...... *RUHH-RKQ ...... +DZNLQV-D\ ...... -DFNVRQ$QGUHZ ...... .LPEURXJK-DLPH ... )RFNH-RKQ ...... *RVOLQ-RKQ ...... +DZNLQV-RKQ ...... -DFNVRQ%DUU\ ...... .LQJ'RQ ...... )RHOO-XGG ...... *RVV%RE ...... +D\HV*DU\ ...... -DFNVRQ%U\FH ...... .LQWHU,VDDF ...... )RHUVFK.HQ ...... *UDG\-HII ...... +D\QHV0DUYLQ ...... -DFNVRQ.HODQG ...... .LVK*HRUJH ...... )RJHOVWURP/DUU\ ...... *UDKDP+ ...... +D\QHV5DQG\ ...... -DFNVRQ0DUO\Q ...... .OLHZHU$ ...... )ROODQG%ULDQ ...... *UDYHV0HOYLQ ...... +D\QHV:LOODUG ...... -DFNVRQ0LFKDHO ...... .OLQH=DFK ...... 2016 )RQWHQRW7KHUULDQ ...2001-02-03-04 *UD\VRQ7\UHOO ...... +D\V-DFN ...... -DFNVRQ6HDQGDOH ... .QLJKW-DFN ...... )RUG'H0DUFR ...... *UD\VRQ'DYLG ...... +HGJSHWK-RHO ...... -DFNVRQ7RQ\ ...... .QRFNH%LOO ...... )RUG*HQH ...... *UD]LHU*UHJ ...... +HHE3DXO ...... -DFREVHQ&KDUOHV ...... .QR[.\OH ...... )RUUHVW0LNH ...... *UHFR$OHF ...... 2000-01-02-03 +HÀLQ&OLII ...... -DFREVHQ'DYLG ...... .QR[0LOWRQ ...... 2011-12 )RUUHVWHU0DOLN ...... 2016 *UHHO\-RKQ ...... +HLHU%UDG ...... -DFRE\6WHYH ...... .REGLVK-RVK ...... )RUWHQEHUU\%LOO ...... *UHHQ-XVWLQ...... 2014-15-16 +HOHSLNR5LFKDUG ... -DFREV%HQ ...... .RHQLJ7RGG ...... )RUWLHU:DUUHQ ...... *UHHQ,VDLDK ...... +HOPDQ5RQ ...... -DPHV'DUU\O ...... .RPLQ0LFKDHO ...... )RVWHU$UWKXU ...... *UHHQ.HQQ\ ...... +HOPXWK*HRUJH ...... 2015-16 -DPHV'RQWHO ...... 2016 .UDIW5RG ...... )RVWHU)RUHVW ...... *UHHQ7UH\YRQ ...... 2016 +HOOHU-LP ...... -DPHV-DVRQ ...... .UDIW:DUUHQ...... )RXQWDLQ*DUQHWW ...... *UHHQ:RRG\ ...... +HQGHUVRQ+RZDUG ...... -DPLVRQ-HUPDLQH ...2002-03-04-05 .ULVWRIRUV1LFN ...... 2015-16 )RXVW0LNH ...... *UHHQOHH=DFN ...... 2015 +HQGHUVRQ8KODQ ...... -HIIHUVRQ$- ...... .URHQLQJ.RG\ ...... 2014-15-16 )R[(ULF ...... *UHHQDP\HU-LP ...... +HQGHUVRQ:D\QH ...... -HOPLQL5LFN ...... .UROO(ULFN ...... )R[9HUQRQ ...... *UHHQO\.HQ ...... +HQGHUVRQ:\DWW ...... -HQNLQV'DPRQ ...... 2005-06-07 .URVV-DPHV ...... )UDQFLV.DUO ...... *UHHQZRRG6\OYHVWHU ...... +HQGULFNVRQ.\OH...... 2015-16 -HQNLQV3HWH ...... .UXP%LOO ...... )UDQNH(UYLQ ...... *UHHU%ULDQ ...... +HQGVFK&KDUOHV .... -HQNLQV5RQ ...... .U]\ZLFNL(G ...... )UDQNOLQ'HUULFN ...... *UHJRU\*RUGRQ ...... +HQU\:LO ...... -HQQLQJV$GDP ...... 2002-03-04-05 .XKQ-LP ...... )UDQNOLQ-HWKUR ...... *UHJRU\-DFN ...... +HQVRQ5LFKDUG ...... -HQQLQJV$QG\ ...... 2012-13 .XUWL:LOODUG ...... )UDQNOLQ6WHYH ...... *UHJRU\3DW ...... +HUEVW(G ...... -HQVHQ& ...... )UD]LHU&XUWLV ...... *ULEEOH5 ...... +HUQDQGH]'DYH ...... -HQVHQ0DUFHO ...... 2011-12-13 L ...... )UD]LHU*HRUJH ...... *ULHYHU%LOO...... +HUQDQGH]*DU\ ...... -HQVHQ1HLO ...... /DFH\&KULV ...... )UHHPDQ0LNH ...... *ULIIHQ%LOO ...... +HUURQ1LFR ...... -HQVHQ3DXOPHU ...... /DI¿WWH'LRQ ...... )ULW]HU5LS ...... *ULI¿Q&RXUWQH\ ..... +LFNOLQ'DPRQ ...... -HQVHQ:DOW...... /DI¿WWH7HUU\ ...... )ULHGPDQ)UDQN ...... *ULI¿Q'LFN ...... +LJKWRZHU5LFN ...... -LPPHUVRQ-RH ...... /DJDQD7RQ\ ...... )URVW%RE ...... *ULI¿Q+DO ...... +LOO&RUWH] ...... -HUJHQVHQ* ...... /DLVQH(XJHQH ...... )U\H%RE...... *ULJJV$QGUH ...... +LOO=DN ...... -RKQVRQ$- ...... 2010-11 /DPEHUW7HG ...... )U\H'HQQLV ...... *ULJVE\'RQQ ...... +LUD\DPD)LEEHU ...... -RKQVRQ$UWKXU ...... /DPRXU-HDQ ...... )U\HU%HDX ...... 2011-12 *ULOO$OYLQH ...... +RIIDUW0DUN ...... -RKQVRQ%RE ...... /DQH$KLMDK ...... 2004-05-06 )XHU\'DUUHOO ...... 2016 *URYH%DUU\ ...... +RIIPDQ%RE...... -RKQVRQ&UDLJ...... /DQH&DOYLQ ...... )XJPDQ-LP ...... *XHUUD0LFKDHO ...... +RIIPDQ6WDQOH\ ...... -RKQVRQ'DQ ...... /DQJR3HWH ...... )XOOHU-DPHV ...... *XLGD/RXLV ...... +RNLW-RVK ...... 2016 -RKQVRQ'DYLG ...... /DQJKDLP5D\ ...... )XUJXVRQ) ...... *XLQQ.HQ ...... +ROEURRN*UDQYLOOH ..... -RKQVRQ-HII...... /DQKDP6WHYH ...... )XWUHOO/RXLH ...... *XL]DU(IUDLQ ...... +ROFRPEH/DUU\ ...... -RKQVRQ-HUHP\ ...... 2000-01 /DUDPLH'DUU\O ...... *XVEHWK-DFN ...... +ROOLV-HII ...... -RKQVRQ-RKQ ...... /DUVHQ%LOO ...... G ...... *XVWDIVRQ$QGUHZ ...... 2012 +ROORZD\%ODLU ...... -RKQVRQ-RKQQ\ ...... /DUVRQ5R\ ...... *DLQHV3DULV ...... *XVWDIVRQ0HOYLQ ...... +ROO\$QWRLQH ...... -RKQVRQ-XVWLQ ...... /DVKR%ULDQ ...... *DOH ...... *XVWDIVRQ7RP ...... +ROO\7HUUHQFH ...... -RKQVRQ-XVWLQ ...... 2012-13-14-15 /DWLPHU0DUVKDOO ...... *DOORZD\5RE ...... +ROPHV&DUO ...... -RKQVRQ.HH6HDQ ...... 2015-16 /DXJOLQ%LOO ...... *DOORZD\5RG ...... H ...... +ROPHV5\DQ ...... -RKQVRQ.HYLQ ...... /DXJKOLQ5D\ ...... *DUDEHGLDQ/HR ...... +DFNHWW7RP ...... +ROVWHLQ* ...... -RKQVRQ0HOYLQ ...... /DZOHVV$OEHUW ...... *DUFLD$O ...... +DOO&RU\ ...... +ROZRUWK\&UDLJ ...... -RKQVRQ6WHYH...... /DZVRQ%UHWW ...... *DUFLD'DYLG ...... +DOO.HQQ\ ...... +RRNV&KDUOHV ...... -RKQVRQ7H[ ...... /DZWRQ(G ...... *DUFLD-RH ...... +DOOHQ*HRUJH ...... +RRNV'HOPR ...... -RLQHU'DYLG ...... /D]DUXV0LFKDHO ...... 2014 *DUFLD7RGG ...... 2001-02-03-04 +DPLOWRQ)UDQN\ ...... +RUQ-LP...... -RQHV$QGUHZ ...... /HDFK$DURQ ...... *DUGHQKLUH$OOHQ ...... +DPOHU-DPHO ...... +RUQ6WX ...... -RQHV%REE\ ...... /HDYLWW*RUGRQ ...... *DUGQHU'DYLG ...... +DPPRQG5DOSK ...... +RUQEXFNOH'HVPRQG ...... -RQHV&KDUOLH ...... /HGJHU5\DQ ...... 2003-04 *DUQHU%RE ...... +DPP+HUPDQ ...... +RUQHU-DFN ...... -RQHV&UDLJ ...... /HH%REE\ ...... *DUQHWW:D\QH ...... +DPS+HUPDQ ...... +RUQHU-DFN ...... -RQHV'DOHQ ...... 2013-14-15-16 /HH&KULV ...... *DUUHWW.LUE\ ...... +DPSWRQ7HUUDQFH ...... 2000 +RXFN-LP ...... -RQHV'DYH ...... /HH6WHYH ...... *DUULVRQ'XVWLQ ...... 2015 +DQ'DQ ...... +RXVHKROGHU*X\ ...... -RQHV'HDQ ...... /HHVW/OR\G ...... *DUYHU'LUN ...... +DQGOH\'LFN ...... +RXVHKROGHU+DUROG ...... -RQHV(YHUDUG ...... /H¶DX-DPHV ...... 2012-13 *DU]RQL0LNH ...... +DQH\'RQ ...... +RXVHU*HUDOG ...... -RQHV)UDQN ...... /HLPEDFK5RQ ...... *DVV$-...... +DQQD-HII ...... +RXVWRQ)UHG ...... -RQHV+RZDUG ...... /HPRQ-HUU\ ...... *DWHV$UOR ...... +DQQD:LOVRQ ...... +RXVWRQ6WHYH ...... -RQHV-DPDO ...... 2001-02-03-04 /HRQDUG&KULV ...... 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 123 RECORDS & HISTORY ALL-TIME LETTERWINNERS /HRQDUG/RXLV ...... 2003-04-05-06 0F$IHH ...... 0RUULV5ROOLQ ...... P ...... Q ...... /HSRUL%REE\ ...... 2005-06-07 0F%HH:\DWW...... 2016 0RUULVVHWWH5RQ ...... 3DFH0LNH ...... 4XDOOV2UULQ ...... /HUPD'DYH ...... 0F&DOO7RP ...... 0RUVH-RKQ ...... 3DFKHFR&KULV ...... 4XH]DGD-RVK ...... 2013-14 /H5RHXI6WHYH ...... 0F&DXOH\0DUFXV ..2003-04-05-06 0RVHV$NND$U ...... 3DFKHFR5LFKDUG ...... /HWFKHU%HQ ...... 2012-13 0F&OHQDJKDQ-HUU\ ...... 0RVKHU&OLQWRQ ...... 3DGLOOD%RE ...... R ...... /HYL-RVK ...... 0F&OHQGRQ-HUULQ ...... 2013 0RVLHU)UHG ...... 3DGLOOD)UDQN ...... 2007 5DFKDO/DWDULR ...... /HZLV&KULV ...... 0F&OXUJ)UDQN ...... 0RVOH\$QWKRQ\ ...... 3DLJH6WHSKRQH ...... 5DFR)UHG ...... /HZLV'HUPDQ ...... 0F&OXUJ0LNH ...... 0RVVPDQ*DU\ ...... 3DLQH.HQW ...... 5DGHPDQQ-LP ...... /HZLV'RQDYRQ ...... 2011-12-13-14 0F&OXUJ3DW ...... 0RXOWRQ'HQQ\ ...... 3DNROD/HH ...... 5DGND$O ...... /HZLV)UHG ...... 0F&RQQHOO& ...... 0R\H'RF ...... 3DOHUFLR0LNH ...... 5DJVGDOH*HRUJH ...... /HZLV-DPHV ...... 0F&RQQHOO0LNH ...... 0XHOOHU6FRWW ...... 3DOPHU*HRUJH ...... 5DLQH%LOO ...... /HZLV-RH ...... 0F&R\.HLWK ...... 0XKDPPDG0XVWDIDK- ... 3DOPR9LQFHQW ...... 5DLQH\'DQQ\ ...... Lewis, Tim ...... 0F&UHH6RQQ\ ...... 0XONH\-DFN ...... 3DOXPER3DW ...... 5DPVH\*UHJ ...... /LPEULFN$QWKRQ\ .. 0F&UHU\'DYH ...... 0XOOLQV-RKQ...... 3DUQDJLDQ*UDQW ...... 5DPRV:LOVRQ ...... /LPEULFN7RQ\ ...... 0F&XOOH\5RQ ...... 0XQVRQ/HH ...... 3DQLVK%ULDQ ...... 5DSKDHO$XVWLQ ...... /LQGVD\0DWW ...... 0F&XWFKHQ&KXFN ...... 0XUDVN\.HQ ...... 3DQ]UDP.HQ ...... 5DQFDWRUH-RH ...... /LQH%RE ...... 0F'HUPRWW-HUPDLQH ...... 2000-01 0XUSK\%LOO ...... 3DSDF/RXLV ...... 5DQNLQ7H[ ...... /LQJHQIHOWHU&UDLJ ...... 0F'RQDOG'HY\Q ...... 2004-05 0XUSK\.HYLQ ...... 3DSDF1LFN ...... 5DVKDG-DPDDO ...... /LQJXD0LNH ...... 2003-04 0F'RZHOO$GDP ...... 2005-06-08 0XUSK\:LOOLDP ...... 3DSD]LDQ5RQ ...... 5DWFOLIIH%UXFH ...... /LVKRN(G ...... 0F(QWHH&KDVH ...... 0XUUD\0RUJDQ ...... 3DSHQGRUI%LOO ...... 5DWOLII7UR\ ...... /LVOH&KDSS\ ...... 0F)DOO:DOO\ ...... 0XUUD\5LFKDUG ...... 3DUNHU)UHG ...... 5DWOLIIH&KDUOHV ...... /LWWOH-RH\ ...... 0F*LOO%U\FH ...... 2000-01-02-03 0XUUD\6KDZQ ...... 3DUNHU5RQ ...... 5DW]ODII/HV ...... /RFNKDUW7KDELWL ...... 0F*XLUH&ROLQ ...... 2013 0XVNLF%LOO...... 3DUNLQVRQ7RG ...... 5DXVFK-RH ...... /RFNZRRG-HUU\ ...... 0F,QW\UH*DUUHWW ....2002-03-04-05 0XVVHU6FRWW ...... 3DVFRH%HDU ...... 2005-06-07-08 5D\1DWKDQ ...... 2001-02-03-04 /RIWLQ&DUO\H ...... 0F.HUVLH*HUDOG ...... 0XVWDFKLR6DO ...... 3DVFRH9LQFH ...... 5HGPRQG*UDQYLOOH ..... /RIWRQ-LP ...... 0F.HUVLH+ ...... 0\HUV%RE ...... 3DWWHH-DFN ...... 5HGZRRG(ULF ...... /RQJ-DPHV ...... 0F.LQOH\5\DQ ...... 2005-06-07 0\HUV%XG ...... 3DWWHUVRQ'DYLG ...... 2015-16 5HHG%HQVRQ ...... /RQJ.HQ ...... 0F.LQQH\-HVVLH ...... 3DWWHUVRQ5D\ ...... 5HLG'XQFDQ ...... 2001-02-03-04 /RRS6WHYH ...... 0F.QLJKW0DWW ...... N ...... 3DWWRQ0DUN ...... 5HLG0DQVRQ ...... /RVFK$ ...... 0F/HDQ%HQ ...... 1DJHO5LFKDUG ...... 3DXOVWLQH-RKQ ...... 5HLQKDUGW:DOW ...... /RXLV&ODXGHOO ...... 2014-15 0F1DLU*OHQ...... 1DMDULDQ(OEHUW ...... 3HDUVRQ-DPHV ...... 5HPLQJWRQ5RQ ...... /RYH&KULV ...... 0F1DLU+RZDUG ...... 1DSLHU:DOW ...... 3HFN$DURQ ...... 2012-13-14-16 5HQHDX'HPRULHX[ ...... 2001-02 /RYHO\.HQ ...... 0F1HLO ...... 1DWLRQ7RP ...... 3HOODQGLQL%LOO\ ...... 5HQIUR5R\ ...... /RYHULQ%XG ...... 0F1HLO/HRQDUG ...... 1HDN'LFN ...... 3HOWR%LOO ...... 5HQQD- ...... /RYHULQJ*UHJ ...... 0F1DXJKWRQ0DUN ...... 1HDO/RUHQ]R ...... 3HUDFFKL-HII ...... 5HQQLH0LNH ...... /RZH/H5R\ ...... 0F:LOOLDPV:HV ...... 1HDO/XPXPED ...... 3HUHLUD-RKQ ...... 5H\QHYHOG:LOO\ ...... /RZH5LFK ...... 0GLYDQL0LNH ...... 1HHOH\7HUU\ ...... 3HUU\0DOFKLMDK ...... 5H\QROGV/DUU\ ...... /R]LWR-HII ...... 0HDGRZV*DUQH\ ...... 1HJUHWH-HII ...... 3HUU\5RFN\ ...... 5KHDG5D\ ...... /XELQNVN\'UHZ .....2005-06-07-08 0HDQV.HOYLQ ...... 1HLNLUN'DUHQ ...... 3HWHUV&KULV ...... 5LFH) ...... /XHGHU&DUO...... 0HFKHP0DF ...... 1HLOVRQ/ ...... 3HWHUV)UHG ...... 5LFH-DUHG ...... 2016 /XJLQELOO-HUHP\ ...... 0HGORFN3KLO ...... 1HOVRQ$OOHQ ...... 3HWHUVHQ*HRUJH ...... 5LFH-LP ...... /XLV/DUU\ ...... 0HHVH%LOO ...... 1HOVRQ'RQ ...... 3HWHUVRQ0HO ...... 5LFH-XVWLQ...... 2016 /XMDQ)LO ...... 0HKDV3HWHU ...... 1HUR2¶6KHD ...... 3HWHUVRQ6LPRQ ...... 5LFH.HLWK ...... /XQD5D\ ...... 0HMLDV%RE ...... 1HVV(QJYDOG ...... 3HWUXFFL9LQFH ...... 5LFH5R\ ...... /\QFK- ...... 0HMLFR6DO ...... 1HYLOOH7RP ...... 3HWW'DYH ...... 5LFKDUG.\OH ...... 2005 /\QGV*UHJ ...... 0HOWRQ5RQ ...... 1HZERUQ'DUUHQ ...... 3ÀXJ3DXO ...... 5LFKDUGVRQ-HII ...... /\VVDQG-RKDQ ...... 0HQGHV0LNH ...... 1HZWRQ5D\ ...... 3KDULV+RZDUG ...... 5LFNHWWV0LNH ...... 0HQGRQFD&KULV ...... 1LFHO\3HWH ...... 3LOLJLDQ&KULV ...... 2005 5LFKWHU7UHYRU ...... 2011 M ...... 0HQGR]D0LNH ...... 1LFKRODV$ODQ ...... 3KLOOLSV%HQQ\ ...... 5LGGHULQJ.\OH ...... 2015-16 0DF4XLGG\(YHUHWW ...... 0HUDV'DULXV ...... 1LFKROV%\URQ ...... 3KLOOLSV+HUELH ...... 5LJJHUW*OHQQ ...... 0DFKDGR3DWULFN ...... 0HUULWW-RKQ ...... 1LFRORSXORV&UDLJ ...... 3KLOSRWW'HDQ ...... 5LJJLQV$QWKRQ\ ...... 2011 0DFKDGR5\DQ ...... 2006-07 0HVVHU'DOH ...... 1LHKDXV%RE ...... 3LFNHQV'ZLJKW ...... 5LJJLQV/HVWHU ...... 0DFN&DUORV ...... 0HVVLFN$GDP ...... 2005 1LHOVRQ3DXO ...... 3LFNIRUG3DW ...... 5LOH\&XUWLV ...... 2013-14 0DGGHQ/OR\G ...... 0HVWMLDQ+DUU\ ...... 1LPPR*HUDOG ...... 3LHUFH%LOO\ ...... 5LOH\0DUFXV ...... 2004-05-06-07 0DGVHQ1DWKDQ ...... 2014-15-16 0H\HUV,UD ...... 1LVZDQGHU+RUDFH .. 3LHUFH%LOO\-DFN ...... 5LQHKDUW&KULV ...... 0DKDQNH(ULF ...... 0H]D'HH ...... 2000-01-02-03 1REOHV5REHUW ...... 3LHUFH5H[ ...... 5LSSHQWURS%RE ...... 0DKGL6DOHHP ...... 0LFHQKHLPHU0DOLTXH .2011-12-13-15 1ROWH(UQLH ...... 3LHUVRQ'RQ ...... 5LVVHWWR5D\ ...... 0DKRQH\'HUHN ...... 0LFKDHO5RGQH\ ..... 1RURLDQ+DUU\ ...... 3LQHJDU3DXO ...... 2002-03-04-05 5LYHUD-DPHV ...... 0DMRU/RXLH ...... 0LFKHOL.HLWK ...... 1RUWKHUQ-XVWLQ ...... 2013-14-15 3LSHU(OLMDK ...... 2016 5LYHUD0DWW ...... 2002-03-04-05 0DODYDVL%U\FH ...... 0LFNHOVHQ.DUO ...... 2011-12-13-14 1RUWRQ-DPHV ...... 3LWWPDQ0LNH ...... 5LYHUV5RQ ...... 0DOFROP%ULDQ ...... 0LFNHOZDLW'DOH ...... 1RUWRQ-RQDWKDQ ...... 2012-13 3LWWV-XOLXV ...... 5L[=DFN ...... 0DORQH5REHUW ...... 0LOOHU+DUU\ ...... 1RWWROL-LP ...... 3LWWV7HUU\ ...... 5REHUVRQ%ULDQ ...... 0DORQH\(DUO ...... 0LOOHU/DUU\ ...... 1RYDFHN%XPS ...... 3ODWW&KXFN ...... 5REHUWV-DVRQ ...... 2006 0DQFLQL0LNH ...... 0LOOHU/RQ\DH ...... 1RZHOO'RQDOG ...... 3OD\OH3KLO ...... 5REHUWV-HII ...... 0DQNLQV/RJDQ ...... 2001-02-04 0LOOV)UDQN ...... 1XD%DUU\ ...... 3OXPPHU3DW ...... 5REHUWV0DUN ...... 0DQQ(GGLH ...... 2003 0LOOV.HQQHWK ...... 1XQQ$QWKRQ\ ...... 3OXPPHU6KDZQ ..... 5REHUWV6WHYH ...... 0DQQ5DOSK ...... 0LQFH0LFKDHO ...... 1XQQHU\5REHUW ...... 3OXPS'DYH ...... 5REHUWVRQ%LOO ...... 0DQTXHUR)UDQN ...... 0LQQDWHH*UHJ ...... 3RLQWHU$QWRQ ...... 5RELQVRQ%LOO ...... 0DUVK$DURQ ...... 0LQRU&XUWLV ...... O ...... 3RODN-RKQ ...... 5RELQVRQ%U\DQ ...... 0DUVK'DQWH ...... 0LWFKHOO$DURQ ...... 2015-16 2EHUSDUOHLWHU/DQFH ...... 3RON.HQ...... 5RELQVRQ'DQ...... 0DUVKDOO5LFKDUG ...... 2003-04-05 0LWFKHOO'HQQLV ...... 2ELGLHJZX.\ULDQ ...... 2013-14-15 3ROORFN%UHQW ...... 5RELQVRQ*HUDOG ...... 0DUWHQV0LFKDHO ...... 2015-16 0LWFKHOO(OZDUG ...... 2¶%ULHQ)UDQ ...... 3RROH(UQHVW ...... 5RELQVRQ/OR\G ...... 0DUWLQ%RE ...... 0LWFKHOO(PRU\ ...... 2¶'RKHUW\0LNH ...... 3RSH0DUTXH] ...... 5RELQVRQ3ULFH ...... 0DUWLQ%RE ...... 0LWFKHOO-LP ...... 2¶'RKHUW\7LP ...... 3RSHODU/RXLV ...... 5RELQVRQ:LOO\ ...... 0DUWLQ'DUUHO ...... 0LWFKHOO0LOODUG ..... 2¶/HDU\-RKQ ...... 3RSROL]LR5\DQ ...... 2016 5REOHGR+HQU\ ...... 0DUWLQ(ULF ...... 0LWFKHOO:LOOLDP ...... 2¶/HDU\-RKQ ...... 3RSRYLFK&ROH ...... 2005-06-07 5RFNZHOO&KULV ...... 0DUWLQ-RKQ ...... 0RGHV0DUN ...... 2NHNH7REHQQD ...... 2014-15-16 3RUWHU%ULDQ ...... 5RGULJXH]0DXULFH ...... 2000-01 0DUWLQ3HUYL ...... 0RGUH6FRWW ...... 2NSDODXJR7ULVWDQ ...... 2011-12 3RUWHU1HLO ...... 5RGULTXH]6WHYH ...... 0DUWLQ5LFN ...... 0RI¿WW0LNH ...... 2OLYHU(DUO ...... 3RUWHVL3DXO ...... 5RJHUV'DQ ...... 0DUWLQ7RPP\ ...... 0RODOH%UDQGRQ ...... 2OLYHU-HURPH ...... 3RVH\7RP ...... 5RJHUV'DUU\O ...... 0DUW]0LNH ...... 0ROLFK-DPHV ...... 2OLYR%LOO ...... 3RWDVL-RKQQ\ ...... 5RJHUV7UDF\ ...... 0DVHOOL0LNH ...... 0RQJD-RQ ...... 2005-06-07-08 2OOLV0RUHOO ...... 3RWWV'H6KDZQ ...... 2015-16 5RKUNH5LFKDUG ...... 0DVLFK1LFN ...... 0RQJHOOL6DP ...... 2OVHQ&KDG ...... 2014-15 3RXRQR0DQRD ...... 2003-04 5RPHUR*DEH ...... 0DVLQL0LFN\ ...... 0RQWJRPHU\%LOO ...... 2OVHQ* ...... 3R\DGXH0DXULFH ...... 2013-14 5RRW'LOORQ...... 2012-13-14 0DVLQL/HRQDUG ...... 0RWWD1LNNR ...... 2010-12-13 2OVRQ/\OH ...... 3UDWW$QWRQLR ...... 5RVH-DDPDO ...... 2013 0DVRQ&XUWLV ...... 0RRG\'DUUHOO ...... 2OVRQ0DUN ...... 3UDWW0LNH ...... 5RVHOOLQL5HQR ...... 0DVRQ.HYLQ ...... 0RRUH0DUORQ ...... 2PDWD*HRUJH ...... 3UHDFKHU&KDG ...... 2012 5RVHQ¿HOG7D\ORU ...... 0DVVH3LHUFH ...... 2007 0RRUH5DOSK ...... 2VERUQ7LP ...... 3UHLVHQGRUI'DULQ ...... 5RVHWWH'DUUHOO ...... 0DWKHZV5\DQ ...... 0RRVKDJLDQ6WHYH ...... 2VPXQGVRQ*DU\ ... 3UHQWLFH%XUW ...... 5RVV-HUHPLDK ...... 0DWKLHVRQ6LP ...... 0RUDQ&KDUOHV ...... 2WXNROR1HOD ...... 2015-16 3ULWFKHWW'RQDYDXJKQ ...... 2010-11 5RVV0LFKDHO ...... 0DWKLV:HQGHOO ...... 2004-05 0RUDQ&KXFN ...... 2YDWW-RH ...... 3UREVW-DNH ...... 5RWK%ODLQH ...... 0DWWR[-DFN ...... 0RUJDQ5LFN ...... 2ZHQV%RE ...... 3VHW]-RKQ...... 5RXFK0HOYLQ ...... 0DWXOLFK-RKQ ...... 0RUJDQ:HV ...... 2ZHQV'DPLRQ ...... 3XDKL5DGIRUG ...... 5RXVH5REELH ...... 0D[ZHOO(DUO ...... 0RUULV%ULDQ ...... 2001-03-04 2ZHQV/HYL ...... 3XFFLR7\OHU ...... 2015 5RZH%ULDQ ...... 0D\KHZH'LFN ...... 0RUULV*URYHU ...... 2ZHQV7- ...... 5XEDOFDYD6HDQ ...... 2014 0D\V9LQFHQW ...... 2003-04-05-06 0RUULV5H[ ...... 5XG\1RUPDQ ...... 124 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY ALL-TIME LETTERWINNERS 5XI¿Q'ZD\QH ...... 2003 6LOYHUPDQ0DXULFH ...... T ...... 9HQQHU5DPVH\...... :LOOLDPV'DYH ...... 5XJJHUROL1LFN ...... 6LPPRQV(OJLQ ...... 2004-05-06 7DLIDQH9LFWRU ...... 2001-02 9HUUHOO-XVWLQ ...... 2016 :LOOLDPV'RQ ...... 5XKO-LP ...... 6LPRQLDQ*UHJ ...... 7DQJLSD'DYLG ...... 2015-16 9HUVKHU5RVKRQ ...... 2003-04-05 :LOOLDPV'RQ ...... 5XVFKKDXSW%XG ...... 6LPSVRQ%RE ...... 7DQXYDVD(ULFN ...... 9HUU\6WHYH ...... :LOOLDPV)UHG ...... 5XVVHOO-DPHV ...... 6LPSVRQ-DVRQ ...... 2000-01-02 7DRXWVRXYDV0LNH ...... 9LDO3DXO ...... :LOOLDPV-5 ...... 5XVVHOO7RGG ...... 6LPV5RQ ...... 7DSLD-HVXV ...... 2005-06-07 9LFNHUV%XGG\ ...... :LOOLDPV-DPHV ...... 5XVVR-RH ...... 6NLGPRUH-HII ...... 7DUU0LNH ...... 9LFNHUV)UHG ...... :LOOLDPV-DPHV ...... 5\DQ0LNH ...... 6NLGPRUH5\DQ ...... 7DWXP/HHYHO...... 9LHWW\'DYH ...... :LOOLDPV-DPHV' ...... 5\DQ0LNH ...... 6NLSSHU.HOO\ ...... 7DXPRHSHDX7DSD...... 9LQFHQW0DWW ...... :LOOLDPV-RH ...... 5\DQ6WDQ ...... 6NLSSHU7LP ...... 7D\ORU$VD ...... 2000-02 9LUJLO&KDVRQ ...... 2016 :LOOLDPV-RQ ...... 5\HUVRQ5LFK ...... 6WRFNR-HII...... 7D\ORU*DU\ ...... 9LVLQWDLQHU%UHWW .....2000-01-03-04 :LOOLDPV.HQ ...... 6ODJOH0LNH ...... 7D\ORU*HQH ...... 9ROHN%LOO\ ...... :LOOLDPV/H.HQGULFN ...... 2014 S ...... 6ODWHU5D\ ...... 7D\ORU.HYLQ ...... 9RWK7RP ...... :LOOLDPV0HO ...... 6DD¿U5DVKHHG ...... 6ODWRQ.HQW ...... 7D\ORU/& ...... 9XND]LFK$OH[ ...... :LOOLDPV3DXO ...... 2003-04-05-06 6DJDSROX,RDQH ...... 2014 6ODWWHU\'HDQ ...... 7D\ORU5R\ ...... :LOOLDPV3D\WRQ ..... 6DOD]DU5DOSK ...... 6OHYNRII/XNH ...... 2000 7D\ORU6WHYH ...... W ...... :LOOLDPV6DP ...... 6DOD]DU9LQFH ...... 6ORDQ$OYLQ...... 7HGIRUG-HII ...... :DGH%DUQH\ ...... :LOOLDPV:HQGHOO ... 6DOLQDV'DQLHO ...... 6ORFXP7UDF\ ...... 2010 7HOIRUG'DYH ...... Wade, Tim ...... :LOOLDPV:LOODUG ...... 6DPV7LHUUH ...... 6PLWK ...... 7HORQLFKHU)UHG ...... :DJQHU.HQ ...... :LOOLDPVRQ*UHJ ...... 6DPXHO-DPHV ...... 6PLWK$UW ...... 7HORQLFKHU*HRUJH ...... :DOGHQ*DUU\ ...... :LOOLV/DUU\ ...... 6DQFKH]0DQXHO ...... 2003-04-05 6PLWK%URFN ...... 7HUU\-DPHV ...... :DONHU$UGLV ...... :LOOLV/DUU\ ...... 6DQGHUV&ODXGH ...... 2001-02-03-04 6PLWK&KDUOHV ...... 7HUU\/HVWHU ...... :DONHU0LFKDHO ...... :LOOLVWRQ3UHVWRQ ...... 6DQGHUV-DPHV ...... 2002-03-04 6PLWK&OLIWRQ ...... 2004-05-06-07 7HVRQH3HWHU ...... :DONHU8GD ...... :LOORXJKE\/DUU\ ...... 6DQGLIHU*DU\ ...... 6PLWK'HUURQ ...... 2010-12-13-14 7KHLOH&KXFN ...... :DOO(UQLH ...... :LOVH\%LOO ...... 6DQGLIHU-RKQQLH ...... 6PLWK(DUO ...... 7KLHVHQ-HII ...... :DOOHU0DUWH]H ...... 2013-14-15 :LOVH\'DQ ...... 6DUJHDQW6KDWRQ\.... 6PLWK) ...... 7KRPDV$GDUU\OO ...... :DOOLQJ ...... :LOVRQ$ ...... 6DUNLVVLDQ0DUW\ ...... 6PLWK*HQH ...... 7KRPDV-HUPDLQH ...... :DOWRZHU'RPLQLTXH ...... :LOVRQ%RE ...... 6DWHOH)DL ...... 2002-03-04 6PLWK-DFN ...... 7KRPDV/DQFH ...... :DUNHQWLQ3DXO ...... :LOVRQ&ODUHQFH ...... 6DWRD)UDQN ...... 6PLWK-LP ...... 7KRPDV/DYDOH ...... :DURQLHFNL'DU\O ...... :LOVRQ&ULVWLQ ...... 2011-12 6DXQGHUV-DOHQ ...... 2010-11 6PLWK5LFK ...... 7KRPDV3KLOOLS ...... :DUG'HUULFN ...... :LOVRQ(G ...... 6DYDJH-DUHG ...... 6PLWK5R\ ...... 7KRPDV7- ...... 2013-14 :DUG*HRUJH ...... :LOVRQ)UHG ...... 6DYDJH0LNH ...... 6PLWK5RJHU ...... 7KRPSVRQ0DUW\ .... :DUUHQ$UWKXU ...... :LOVRQ+DUROG ...... 6D\ORU.HQ ...... 6PLWK7LP...... 7KRPSVRQ6FRWW .... :DVKLQJWRQ$QWKRQ\ ...... :LOVRQ-HUU\ ...... 6EUDJLD5RG ...... 6PLWK:DOW ...... 7KRUQWRQ&XUW ...... :DVKLQJWRQ&KDUOHV ..2012-13-14-15 :LOVRQ.\ULH ...... 2012-13-14-15 6FDPEUD\0DUN ...... 6PLWKVRQ:D\QH...... 7LEEV0DUN ...... :DVKLQJWRQ0DOFROP ...... 2014-15 :LOVRQ3KLOLS ...... 6FDPEUD\6FRWW ...... 6PRRW7LP ...... 7LOOPDQ-DPHV ...... :DVKLQJWRQ5D\PRQG ..2002-03-04-05 :LOVRQ6DP ...... 6FDQODQ0DODPD ...... 6PRWKHUPDQ7RP ...... 7LWRULJD*UHJ ...... 2007 :DVKLQJWRQ7LP ...... :LPEXVK0LNH ...... 6FKDHIIHU6WHYH ...... 6QLGHU/HRQ ...... 7LSWRQ'XDQH ...... :DWHUPDQ: ...... :LQDQV7\GXV ...... 6FKHLGW*HUDOG ...... 6RHFKWLQJ7UHQW...... 2016 7RGG-DFN ...... :DWKHQ5LFKDUG ...... :LQEODG ...... 6FKH\-RH ...... 6RLQLOD2ODYL ...... 7ROEHUW&KDUOHV ...... 2004-05-06-07 :DWVRQ%U\RQ ...... :LQGHU&RQOH\ ...... 6FKOHFW$OEHUW ...... 6RPPHU6WHYH ...... 7ROEHUW&KULV ...... :DWVRQ*UHJ ...... 2012-13-14 :LQGHU'RQ ...... 6FKOHLPEDXP:DOW ...... 6RPPHUV)UHG ...... 7ROEHUW2WLV ...... :DWVRQ-HVVLH ...... :LQWHUV*HRUJH ...... 6FKRGGH$OOHQ ...... 6RPPHUV7RP ...... 7RPD-HUHPLDK ...... 2010-11-12-13 :DWVRQ6DP...... :LSI:HVOH\ ...... 6FKURHGHU5H[ ...... 6RWHOR-RKQQ\ ...... 2003 7RPDVLQL%UDG ...... :D\WH%LOO ...... :LVH%RE ...... 6FKXOW](PLO ...... 6SDFK6WHSKHQ ...... 2001-02-03-04 7RULJLDQ$UPHQ ...... :HDWKHUV$OOHQ ...... :LWK\FRPEH0LNH ...... 6FKZDEHQODQG-LP ...... 6SDQJOHU'DYH ...... 7RURVLDQ$WRPLF ...... :HDYHU'DYH ...... :ROIH-LP ...... 6FRWW ...... 6SHQFHU.HYLQ ...... 7RURVLDQ7HG ...... :HDYHU*DU\ ...... :ROIJUDPP7& ..... 6FRWW%LOO\ ...... 6SLYH\7RP...... 7RUUHVGDO%URFN ...... :HDYHU*UHJ ...... :ROW]-XVWLQ ...... 2000-01-03 6FRWW'D¶0DUL ...... 2013-14-15 6SUDJXH/DUU\ ...... 7RVFDQR6HUJLR ...... :HEHU(G ...... :RPDFN5LFKDUG ...... 6FRWW0DOFROP ...... 6W$QGUHZ0LFDK ...... 2015-16 7RWWHQ-RQ ...... :HEVWHU-RKQ ...... :RRG0DUN ...... 2002-03-04 6FRWW5XVW\ ...... 6WDEELQV2HQ ...... 7R\&KDUOHV ...... :HEVWHU5RG ...... :RRGPDQ-RH ...... 6FULWFK¿HOG(OPHU ...... 6WDKO-RKQ ...... 7UDEHU ...... :HLODQG/HR ...... :RRGUXII7RQ\ ...... 6FUXJJV&DOYLQ ...... 6WDFNKRXVH6WHYH ...... 7UHMR'DQ ...... :HLQHU0HUY\Q ...... :RRGV.HOO\ ...... 6FXOO\6WHYH ...... 6WDOOZRUWK-- ...... 2010-11 7UHPEOD\-RVK ...... 2014 :HLULFN- ...... :RRGV6WHYH ...... 6HDEURQ0DOFROP ... 6WDQOH\'DUUHOO ...... 7ULSS'HQQLV ...... :HOFK7RQ\ ...... :RRGVRQ+HQU\...... 6HDJOH%UDG ...... 6WDQOH\5REHUW ...... 2015-16 7URQRZVN\2WWR ...... :HOGRQ&O\GH ...... :RUUHOO&DPHURQ ...... 2001-02 6HLIHUOLQJ-DFN ...... 6WDQOH\9DQFH ...... 7UXVFKHO-HII ...... :HOGRQ-RKQ ...... :RUVKDP3UHVWRQ ...... 6HLIHUW0HO ...... 6WDQQDUG5LFN ...... 7XFNHU$QWKRQ\ ...... :HOOV5LR ...... :UHQ'DYLG ...... 6HOOHUV ...... 6WHHOH5\DQ...... 2015 7XFNHU.HQW ...... :HQGHOO5\DQ ...... 2004-05-06-07 :ULJKW ...... 6HOOHUV+DO ...... 6WHHYHQV-RKQ ...... 7XFNHU5LFN ...... :HQGHU-DFN ...... :ULJKW$ODQ ...... 2015-16 6HQVHQEDXJK7HUU\ ...... 6WHHOPDQ- ...... 7XQJHW%UDQW ...... :HQWZRUWK$XVWLQ ..2010-11-12-13 :ULJKW$PRV ...... 6HUIDV1LFN ...... 6WHLQERUQ-RKQ ...... 7XSXLYDR5RZHQ ...... :HVVRQ9LQFH ...... :ULJKW'ZD\QH ...... 2003-06 6HURZLN%RE...... 6WHLQKDXHU/HVWHU .... 7XUQHU-RH ...... :HVW&KDVWLQ ...... :ULJKW5RGQH\ ...... 6HUSD$ ...... 6WHYHQV(G ...... 7XUQHU-RKQ ...... :HVW/HRQ ...... :R\%RE ...... 6HWHQFLFK/\OH ...... 6WHYHQV*UHJ ...... 7XUQHU6WDQ ...... :HVWHQGRUI%LOO ...... :XUVW&XUW ...... 6H[WRQ-RKQ ...... 6WHYHQVRQ%REE\ ...... 7XUQHU7UR\ ...... :HVWSKDO'ZD\QH ...... :\OLH'HYRQ ..... 6JDQWDV9LQFH ...... 6WHYHQVRQ0DWW ...... 2002 7XWWOH)UHG ...... :HWOHU%XUO ...... 6KDEDJOLDQ'DYLG ...... 6WHZDUW'DYH ...... 7X¶XD6LWX ...... 2000-01-02 :HW]HO&OLII ...... Y ...... 6KDFN'DUWDJQRQ ....2002-03-04-05 6WHZDUW-DVRQ ...... :KHDW+DUROG ...... 'DYLG&DUUKDGKLVMHUVH\UHWLUHGRQ6HSWHPEHU'XULQJ'DYLG&DUUKDGKLV KLVVHQLRUVHDVRQ KKHJXLGHGWKH%XOOGRJVWRDQUHFRUGW\LQJWKHVFKRROUHFRHJXLGHGWKH%XOOG UGIRUPRVWZLQV LLQDVHDVRQ)UHVQR6WDWHRSHQHGWKHVHDVRQZLWKZLQVRYHUQDVHDVRQ)UHVQR WKUHHQDWLRQDOO\ UUDQNHGRSSRQHQWV1R&RORUDGRDQG1R:LVFRQVLQERWKRQDQNHG RSSRQHQWV1 WKHURDGDQGD FFRPPDQGLQJZLQRYHU1R2UHJRQ6WDWHLQ%XOOGRJ6WDGLXRPPDQGLQJ P7KDWJDPH ZDVSOD\HGLQIURQZDVSOD\HGLQIURQWRIDWKHQUHFRUGFURZGRI,QKLV¿QW DOJDPH&DUUVHWD ERZOUHFRUGZLWKERZOUHFRUGZLWKSDVVLQJ\DUGVZKLOHWKURZLQJIRXUWRXFKGRZ QV+HZRQWKH --RKQQ\8QLWDV*ROGHQ$UP$ZDUGDQGWKH3RS:DUQHU$ZDUGZKLFKRKQQ\8QLWDV*ROG LVSUHVHQWHG DQQXDODQQXDOO\WRWKHEHVWFROOHJHIRRWEDOOSOD\HURQWKHZHVWFRDVWO\WRWKHEHVW +H¿QLVKHG¿IWKLQ WWKHEDOORWLQJIRUWKH+HLVPDQ7URSK\)RUKLVFDUHHUKHEDOORWLQJIRUWKH &DUUFRPSOHWHG RIRI SSDVVHVDVVHV IRU \DUGV DQG WRXFKGRZQV:KHQ KH OHIW KH KHOG %%XOOGRJXOOGRJ SDVVLQJSDVVLQJ UHFRUGVUH IRU PRVW WRXFKGRZQV LQ D FDUHHU SDVVLQJ \DUGV LLQDVHDVRQ WRXFKGRZQVLQDVHDVRQ DQGWRWDORIIHQDVHDVRQ QVLYH\DUGVLQD VVHDVRQ &DUUZDVVHOHFWHGDVHDVRQ &DU WKH1RRYHUDOO1)/SLFNE\WKHH[SDQVLRQ +RXVWRQ7H[DQVEHFRPLQJWKH¿UVWSOD\HUIURPDQRQ%&6FRQIHUH+RXVWRQ7H[DQV EH QFHLQ\HDUV WREHVHOHFWHGDVWKHWRSRYHUDOOSLFNWREHVHOHFWHGDVWKH TRENT DILFER 12 +HZDVKRQRUHGEHFDXVHKHOHGWKH%XOOGRJVWRWZRRIWKHLUPRVWSUHVWLJLRXV ERZOJDPHVHYHUWKH)UHHGRP%RZODPHPRUDEOHYLFWRU\RYHU86& DQGWKH$ORKD%RZO+HUDQNVVL[WKLQVFKRROKLVWRU\LQERWKSDVVLQJ\DUGV ZLWKDQGWRWDORIIHQVHZLWK\DUGV:KHQKHOHIWVFKRROKHKHOG VLQJOHVHDVRQVFKRROUHFRUGVIRUSDVVLQJ\DUGV DQGWRXFKGRZQV $W WKHWLPHKLVSDVVLQJ\DUGVLQWKH$ORKD%RZOZHUHWKHPRVWHYHUE\D TXDUWHUEDFNLQDERZOJDPH$VDMXQLRU'LOIHUHDUQHG:$&2IIHQVLYH3OD\HU RIWKH (OODUG EURNH QHDUO\ HYHU\ )UHVQR 6WDWH SDVV UHFHLYLQJ UHFRUG LQ LQDGGLWLRQWRVHWWLQJDQ1&$$UHFRUGZLWKUHFHLYLQJ \DUGVWKDWVHDVRQ7KHFR2IIHQVLYH3OD\HURIWKH 126 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY RETIRED JERSEYS DALE MESSER 21 0HVVHUDJUDGXDWHZDVDSRXQGHUIURP/HPRRUH&DOLIDQGKDG \DUGV VSHHGDVDKDOIEDFN+HQRWRQO\FDUULHGWKHEDOOEXWKHSXQWHGDQG KDQGOHGSODFHNLFNLQJFKRUHVDVZHOO$WKUHHWLPHDOOFRQIHUHQFHSLFN0HVVHU OHGWKH%XOOGRJVLQUXVKLQJ \DUGV UHFHLYLQJ FDWFKHV VFRULQJ SRLQWV SXQWUHWXUQVDQGNLFNRIIUHWXUQVKLVVHQLRU\HDU+HDOVRUHWXUQHGWKUHH SDVVLQJLQWHUFHSWLRQVIRU\DUGVSXQWHGIRUDDYHUDJHDQGZDVIRU LQWKHSDVVLQJGHSDUWPHQWZLWKWZRWRXFKGRZQV0HVVHU¶VUXVKLQJWRWDOZDV HYHQPRUHLPSUHVVLYHZKHQ\RXFRQVLGHUWKDWDVDWHDP)UHVQR6WDWHUDQNHG WKLUGLQWKHQDWLRQLQSDVVLQJRIIHQVH \DUGV $WZRWLPH$OO$PHULFD VHOHFWLRQ0HVVHUSOD\HGLQWKH(DVW:HVW6KULQHJDPHLQ6DQ)UDQFLVFRDQG ZDVDWKUHHWLPH$OO&RDVWKRQRUHH+HODWHUSOD\HGIRUWKH6DQ)UDQFLVFR HUV DIWHUUXVKLQJIRUQHDUO\\DUGVVFRULQJWRXFKGRZQV DQGOHDGLQJ)UHVQR6WDWHWRWKUHHVWUDLJKWFRQIHUHQFHWLWOHV VINCE PETRUCCI 14 3HWUXFFLDVLGHZLQGLQJSODFHNLFNHUIURP)UHVQR¶V+RRYHU+LJK 6FKRROZDVDWZRWLPH$OO3&$$SLFNDW)UHVQR6WDWH3HWUXFFL FRQQHFWHGRQFRQVHFXWLYH3$7DWWHPSWVWRUDQNVHFRQGRQWKH 1&$$ OLVW +LV FRQVHFXWLYH FRQYHUVLRQV DW WKH WLPH WUDLOHG RQO\ 8ZH YRQ 6FKDPDQQ RI WKH 8QLYHUVLW\ RI 2NODKRPD ZKR FRQQHFWHGRQDQ1&$$UHFRUG3$7VLQDURZ$VDMXQLRU 3HWUXFFLZDVDVHFRQGWHDP$OO&RDVWVHOHFWLRQE\ERWK$3DQG 83,'XULQJKLVFDUHHUDW)UHVQR6WDWH3HWUXFFLFRQYHUWHG RI3$7DWWHPSWVDQGRI¿HOGJRDODWWHPSWV+HVFRUHGD WRWDORISRLQWVDWWKHWLPHWKHEHVWWRWDOHYHUIRUD)UHVQR6WDWH NLFNHUDQGWKHWKLUGKLJKHVWVFRULQJWRWDOLQVFKRROKLVWRU\+HKDG DFDUHHUEHVW\DUG¿HOGJRDODJDLQVW&DO6WDWH)XOOHUWRQ KEVIN SWEENEY 9 6ZHHQH\¿QLVKHGKLVIRXU\HDUFDUHHULQDVWKHDOOWLPHOH6ZHHQH\ DGLQJ SDVVHU LQL 1&$$ KLVWRU\ \DUGV DW WKH WLPH EUHDNLQJ WKH SUHYLRXSUHYLRXVPDUNRIVHWIURPE\IRUPHU%RVWRQ&ROOV HJH TXDUWHUTXDUWHUEDFN'RXJ)OXWLH$IRXU\HDUVWDUWHUDWTXDUWHUEDFN6E ZHHQH\ VVHWHW RU WWLHGL D WRWDO RI VFKRRO FRQIHUHQFH DQG 1&$$ UHFRUGV +LV \DUGSDVVLQJJDPHVWLHGDQ1&$$PDUN%\¿QLVKLQJQLQWK\ LQ WWKHKH +HL+HLVPDQ7URSK\V EDOORWLQJ LQ 6ZHHQH\ EHFDPH WKH KLJKHVW ¿QLVKHU¿QLVKHULQOHDJXHKLVWRU\IRUWKDWSUHVWLJLRXVKRQRU+H¿QLVKHGUXQQHU XXSLQEDOORWLQJIRUWKH'DYH\2¶%ULHQ1DWLRQDO4XDUWHUEDFNRIWSLQED KH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 127 RECORDS & HISTORY FIRST-TEAM ALL-AMERICANS FIRST-TEAM ALL-AMERICA 0\URQ$QGHUVRQ ..... ...... (QG -DFN0XONH\ ...... ...... (QG -DFN0XONH\ ...... ...... (QG -DFNLH)HOORZV ...... ...... 4XDUWHUEDFN 'DQ%ROW ...... ...... *XDUG :LOODUG:KLWDNHU ..... ...... *XDUG 'DOH0HVVHU ...... ...... +DOIEDFN -$&.08/.(< -$&.,()(//2:6 :,//$5':+,7$.(5 '$/(0(66(5 '28*%52:1 0217('$< %($8&$57(5 (1' 4% * +% 2/ 7 4% 'DOH0HVVHU ...... ...... +DOIEDFN 'RXJ%URZQ ...... ...... *XDUG 'RXJ%URZQ ...... ...... &HQWHU 0RQWH'D\ ...... ...... 7DFNOH %HDX&DUWHU ...... ...... 4XDUWHUEDFN (UY+XQW ...... ...... 6DIHW\ 7RP0F&DOO ...... ...... /LQHEDFNHU 6WHYH&RUGOH ...... ...... 6WURQJ6DIHW\ %HUQDUG%HUULDQ ...... 2001 .....5HW6SHFLDOLVW $--HIIHUVRQ...... 2007 .....5HW6SHFLDOLVW (59+817 7200&&$// 67(9(&25'/( %(51$5'%(55,$1 $--())(5621 3+,//,37+20$6 3KLOOLS7KRPDV ...... 2012 ...... 6DIHW\ 6 /% 6 56 56 66 &RQVHQVXV$OO$PHULFDQ The NCAA recognizes the All-America teams selected by the AP, AFCA, FWAA, Sporting News, and the WCFF. To determine 8QDQLPRXV$OO$PHULFDQ consensus All-Americans, a player must appear on three of these organizations first team. If a player is named an All-American by all five organizations, he is a “unanimous All-American”. ADDITIONAL ALL-AMERICANS 0\URQ$QGHUVRQ+0 ...... ...... -DPHV:LOOLDPV+0 $3 ...... ...... &RUQHUEDFN )UHQFK\%RUGDJDUD\+0 ...... ...... -HII6NLGPRUH+0 $3 ...... ...... 2IIHQVLYH*XDUG )UDQN)ULHGPDQ+0 ...... ...... 5RQ&R[QG 761 QG )1 UG $3 +0 83, ...... ...... 5RYHU 'LFN:KLWH+0 ...... ...... -DPHV:LOOLDPVQG 761 UG $3 ...... ...... &RUQHUEDFN :DOW%\UG+0 83, ...... ...... 'ZLJKW3LFNHQV+0 761 ...... ...... )ODQNHU 0LNH)UHHPDQ+0 ...... ...... 'HIHQVLYH%DFN $DURQ&UDYHU+0 761 ...... ...... 7DLOEDFN -RKQ6WDKO+0 ...... ...... 2IIHQVLYH7DFNOH 0DUTXH]3RSH+0 761 ...... ...... )UHH6DIHW\ 6WHYH9HUU\QG ...... ...... 2IIHQVLYH*XDUG .HOYLQ0HDQV+0 761 ...... ...... 6SOLW(QG 'ZD\QH&UXPS+0 ...... ...... 6DIHW\ 0HOYLQ-RKQVRQUG )1 ...... ...... 2IIHQVLYH*XDUG -DFN)LVKHU+0 ...... ...... 'HIHQVLYH7DFNOH 7UHQW'LOIHUQG & 3)1 +0 )1 ...... ...... 4XDUWHUEDFN *DU\:HDYHUUG ...... ...... /LQHEDFNHU 0DOFROP6HDEURQ+0 )1 ...... ...... )ODQNHU 3KLO%RUMDVUG ...... ...... 'HIHQVLYH%DFN -HVVH+DUGZLFN+0 )1 ...... ...... 2IIHQVLYH7DFNOH -HII7HGIRUG+0 ...... ...... 4XDUWHUEDFN /RUHQ]R1HDO+0 )1 ...... ...... )XOOEDFN 6FRWW'DUURZ+0 ...... ...... LFNHU =DFN5L[+0 )1 ...... ...... 1RVH*XDUG (G&DUWHU+0 ...... ...... 2IIHQVLYH7DFNOH :HQGHOO9DOHQWLQH+0 )1 ...... ...... /LQHEDFNHU +HQU\(OODUGQG $3 ...... ...... 6SOLW(QG 7UHQW'LOIHUUG $3 UG )1 ...... ...... 4XDUWHUEDFN 0LNH)RUUHVW+0 ...... ...... 2IIHQVLYH*XDUG %UDG%HOO+0 )1 ...... ...... 'HIHQVLYH(QG -RKQ%ODFNVLOO+0 ...... ...... &HQWHU &KDUOLH-RQHV+0 )1 ...... ...... )ODQNHU .HYLQ-RQHV+0 ...... ...... 'HIHQVLYH(QG 5RQ5LYHUV+0 )1 ...... ...... 7DLOEDFN 0DWW0F.QLJKW+0 ...... ...... )UHH6DIHW\ 5RQ&ROOLQV+0 )1 ...... ...... 2IIHQVLYH7DFNOH 5RFN\&RVWHOOR+0 ...... ...... LFNHU 5RQ3DSD]LDQ+0 )1 ...... ...... /LQHEDFNHU /DUU\:LOOLV+0 ...... ...... 6SOLW(QG 'DYLG'XQQQG 761 QG & 3)1 ...... ...... :5.5 /DUU\:LOOLVUG $3 ...... ...... 6SOLW(QG &KDUOLH-RQHV+0 83, ...... ...... :LGH5HFHLYHU 6WHSKHQ%DNHU+0 $3 ...... ...... 6SOLW(QG &KDUOHV6PLWKIUHVKPDQ 761 ...... ...... :LGH5HFLHYHU %DUU\%HOOL+0 $3 ...... ...... LFNHU 'HUULFN:DUGIUHVKPDQ )1 ...... ...... 5XQQLQJ%DFN $QWKRQ\'ROODUKLGH+0 $3 ...... ...... &RUQHUEDFN $VHQ$VSDUXKRYUG 761 +0 &116, ...... 2001...... 3ODFHNLFNHU %DUU\*URYH+0 $3 ...... ...... 2IIHQVLYH*XDUG %HUQDUG%HUULDQWK 761 ...... 2001...... 5HWXUQ6SHFLDOLVW 'DYH/HUPD+0 $3 ...... ...... 2IIHQVLYH7DFNOH 'DYLG&DUUQG )1 UG $3 +0 &116, ...... 2001...... 4XDUWHUEDFN 0LNH0DQFLQL+0 $3 ...... ...... 3XQWHU $ODQ+DUSHUQG $3 761 )1 +0 &116, ...... 2001...... 'HIHQVLYH7DFNOH &KULV3DFKHFR+0 $3 ...... ...... 1RVH*XDUG /RJDQ0DQNLQVIUHVKPDQ 761 ...... 2001...... 2IIHQVLYH7DFNOH 0LFKDHO6WHZDUW+0 $3 ...... ...... 6WURQJ6DIHW\ 5RGQH\:ULJKWWK 761 ...... 2001...... :LGH5HFHLYHU .HYLQ6ZHHQH\+0 $3 ...... ...... 4XDUWHUEDFN -DPHV6DQGHUVIUHVKPDQ ):$$761 ...... 2002...... 6WURQJ6DIHW\ -DPHV:LOOLDPV+0 $3 ...... ...... 7DLOEDFN 3DXO3LQHJDUIUHVKPDQ 761 ...... 2002...... 4XDUWHUEDFN .HYLQ6ZHHQH\+0 $3 ...... ...... 4XDUWHUEDFN -HUPDLQH-DPLVRQIUHVKPDQ 761 ...... 2002...... :LGH5HFHLYHU 6WHSKHQ%DNHU+0 $3 ...... ...... 6SOLW(QG .\OH 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 129 RECORDS & HISTORY COLLEGE FOOTBALL AWARDS CONFERENCE PLAYERS OF THE YEAR HEISMAN MEMORIAL TROPHY (Nation’s Top Player) OFFENSIVE PLAYER SPECIAL TEAMS PLAYER 1986 - Kevin Sweeney (finished 9th) OF THE YEAR OF THE YEAR 2001 - David Carr (finished 5th) MOUNTAIN WEST WAC 2013 - Derek Carr (finished 8th) 2013 ...... 'HUHN&DUU4% ...... 'DYLG'XQQ.5 WALTER CAMP PLAYER OF THE YEAR AWARD 2012 ...... 'HUHN&DUU4% 2013 - Derek Carr (semifinalist) FRESHMAN OF THE YEAR BILETNIKOFF AWARD (Nation’s Top Wide Receiver) WAC 2013 - Davante Adams (semifinalist) 2001 ...... 'DYLG&DUU4% MOUNTAIN WEST ...... -DLPH.LPEURXJK7% 2012 ...... 'DYDQWH$GDPV:5 DAVEY O’BRIEN AWARD (Nation’s Top QB) ...... 3DFL¿F'LYLVLRQ 1986 - Kevin Sweeney (runner-up) ...... 7UHQW'LOIHU4% WAC 2001 - David Carr (semifinalist) 2004 ...... 5\DQ:HQGHOO2* 2013 - Derek Carr (semifinalist) BIG WEST 2002 ...... 3DXO3LQHJDU4% FOOTBALL NEWS OFFENSIVE PLAYER OF THE YEAR ...... 0DUN%DUVRWWL4% 2001 - David Carr (WINNER) ...... &R2IIHQVLYH093 JIM THORPE AWARD (Nation’s Top Defensive Back) PACIFIC COAST ATHLETIC 2012 - Phillip Thomas (finalist) ASSOCIATION JOHNNY UNITAS GOLDEN ARM (Nation’s Top Senior QB) . .HYLQ6ZHHQH\4% &R093 2001 - David Carr (WINNER) . .HYLQ6ZHHQH\4% &R093 2013 - Derek Carr (finalist) ...... +HQU\(OODUG6( &R093 MANNING AWARD (Nation’s Top QB) ...... -HII7HGIRUG4% &R093 2001 - David Carr (WINNER) ...... 'HDQ-RQHV4% 2013 - Derek Carr (finalist) DEFENSIVE PLAYER PAUL WARFIELD AWARD (Nation’s Top Wide Receiver) OF THE YEAR 2013 - Davante Adams (WINNER) POP WARNER (Most Outstanding Player in the Western U.S.) MOUNTAIN WEST 2012 ...... 3KLOOLS7KRPDV66 2001 - David Carr (WINNER) SAMMY BAUGH AWARD (Nation’s Top QB) WAC 1993 - Trent Dilfer (WINNER) 2010 ...... &KULV&DUWHU'( 2001 - David Carr (WINNER) 2007 ...... 0DUFXV5LOH\/% 2013 - Derek Carr (WINNER) 2005 ...... *DUUHWW0F,QW\UH'7 BURLSWORTH TROPHY 2001 ...... $ODQ+DUSHU'7 (Nation’s Top Player Who Started As A Walk-On) BIG WEST 2012 - Tristan Okpalaugo (semifinalist) ...... 0DUTXH]3RSH)6 2013 - Jonathan Norton (semifinalist) ...... &R'HIHQVLYH093 BROYLES AWARD (Nation’s Top Assistant Coach) ...... 0DUTXH]3RSH)6 2012 - Nick Toth (semifinialist) ...... &R'HIHQVLYH093 ...... 5RQ&R[529 2013 - Dave Schramm (semifinalist) ...... 7UDF\5RJHUV/% PACIFIC COAST ATHLETIC Ryan Wendell was the 2004 WAC ASSOCIATION Freshman of the Year ...... -HWKUR)UDQNOLQ'( Phillip Thomas at the Home Depot College Football Awards Show on Disney’s Boardwalk Resort: Red carpet arrivals (l to r) Bill Anoatubby, Chickasaw Nation Governor, Dee Milliner (Alabama), Johnthan Banks (Mississippi State), Phillip Thomas (Fresno State) and Barry Switzer. Thomas was a finalist for the Jim Thorpe Phillip Thomas was the 2012 MW Defensive Kevin Sweeney was the PCAA Co-MVP Player of the Year in Fresno State’s first season Awards and attended the awards show on Dec. 6, 2012 (Photo courtesy of ESPN) in both 1985 and 1986 as a member of the conference. 130 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FIRST-TEAM ALL-CONFERENCE SELECTIONS FIRST-TEAM ALL-COAST %LOO5DLQH( &UDLJ+ROZRUWK\3 %RE%XUJVV& :LOODUG:KLWDNHU* 'ZD\QH:HVWSKDO'7 %RE%XUJHVV& /\PDQ(KUOLFK7 &DOYLQ 132 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY SECOND-TEAM & HONORABLE MENTION ALL-CONFERENCE SELECTIONS SECOND TEAM ALL-WAC 'HYRQ%DQNV'% 6H\L$MLURWXWX:5 HONORABLE MENTION /RUHQ]R1HDO5% 3DULV*DLQHV5% /RUQH%HOO'% ALL-MOUNTAIN WEST 0DOFROP6HDEURQ:5 0DXULFH5RGULJXH]/% 0RVHV+DUULV'% 6HDQ$OVWRQ&% :HQGHOO9DOHQWLQH/% )LWX7X¶XD2/ .HQQ\:LJJLQV2/ ,VDLDK%XUVH:5 6DP:DWVRQ'% 5RGQH\:ULJKW:5 7UDYLV%URZQ/% 5LFKDUG+HOHSLNR2/ %UDG%HOO'/ 0DUTXH'DYLV:5 'HVLD'XQQ'% 0DUFHO-HQVHQ7( 5RQ&ROOLQV2/ 5RGQH\'DYLV5% -DPHO+DPOHU:5 /--RQHV&% 5RQ3DSD]LDQ/% %U\FH0F*LOO/% %U\FH+DUULV2/ $QGUHZ6KDSLUR3 -DVRQ-DPHV2/ 5RGQH\0LFKDHO2/ 'HUHN&DUU4% ,VDLDK%XUVH:5 -RKDQQ/\VVDQG3. -DVRQ6LPSVRQ3 'HYRQ:\OLH67 /--RQHV&% -HURPH2OLYHU5% *DUUHWW0F,QW\UH'/ .DUO0LFNHOVHQ,/% 5RQ3DSD]LDQ %ULDQ0RUULV'/ SECOND-TEAM 1LNNR0RWWD'( -DKLQH$UQROG:5 'DUWDJQRQ6KDFN2/ ALL-MOUNTAIN WEST *DUUHWW6ZDQVRQ3 2PDU6WRXWPLUH'% %UHWW9LVLQWDLQHU3. 7UDYLV%URZQ,/% &RG\:LFKPDQQ2/ 0LFKDHO3LWWPDQ5% 5LFKDUG0DUVKDOO'% $QG\-HQQLQJV'( $OH[)L¿WD2/ %ULDQ5REHUVRQ56 %U\VRQ6XPOLQ5% ,VDLDK%XUVH56 'RQDYRQ/HZLV2/% 5LR:HOOV'% .\OH CONFERENCE PLAYERS OF THE WEEK WAC OFFENSIVE MOUNTAIN WEST OFFENSIVE 5LFKDUG0DUVKDOO&% 1RY %UHWW9LVLQWDLQHU3. 2FW PLAYER OF THE WEEK PLAYER OF THE WEEK 5LFKDUG0DUVKDOO&%2FW &OLIWRQ6PLWK35 6HSW 7UHQW'LOIHU4% 2FW 5REELH5RXVH5% 6HSW *DUUHWW0F,QW\UH'(1RY -RH)HUQDQGH]35 2FW /RUHQ]R1HDO5% 2FW 'HUHN&DUU4% 2FW 1LFR+HUURQ/% 6HSW $--HIIHUVRQ.5 2FW 7UHQW'LOIHU4% 6HSW 'HUHN&DUU4% 2FW 'HVLD'XQQ&% 2FW .\OH=LPPHUPDQ3 2FW 5RQ5LYHUV5% 6HSW 5REELH5RXVH5% 1RY /RUQH%HOO6 1RY $--HIIHUVRQ.5 1RY 7UHQW'LOIHU4% 2FW 'HUHN&DUU4% 1RY %HQ-DFREV/% 1RY $--HIIHUVRQ.5 1RY -HURPH2OLYHU5% 6HSW 'HUHN&DUU4% 6HSW /RJDQ+DUUHOO'7 6HSW .\OH=LPPHUPDQ3 'HF &KDUOLH-RQHV:5 2FW 'DYDQWH$GDPV:5 2FW 7UDYLV%URZQ/% 1RY 5REHUW0DORQH3 6HSW 0LFKDHO3LWWPDQ5% 6HSW 'DYDQWH$GDPV:5 2FW /RJDQ+DUUHOO'7 6HSW .HYLQ*RHVVOLQJ3. 2FW 5HJJLH%URZQ5% 6HSW 'HUHN&DUU4% 1RY 7UDYLV%URZQ/% 6HSW $--HIIHUVRQ.5 1RY &KDUOLH-RQHV:5 1RY 'HUHN&DUU4% 1RY 5REHUW0DORQH3 2FW %ULDQ5REHUVRQ:5 2FW MOUNTAIN WEST DEFENSIVE .HYLQ*RHVVOLQJ3. 1RY 0LFKDHO3LWWPDQ7% 2FW WAC DEFENSIVE PLAYER OF THE WEEK .HYLQ*RHVVOLQJ3. 1RY 0LFKDHO3LWWPDQ7% 1RY PLAYER OF THE WEEK 3KLOOLS7KRPDV66 6HSW 6KDZQ3OXPPHU/% 2FW -DLPH.LPEURXJK5% 1RY 6DP:DWVRQ'% 6HSW $QG\-HQQLQJV'( 2FW .HYLQ*RHVVOLQJ3. 2FW -DLPH.LPEURXJK5% 1RY =DFN5L[1* 1RY 3KLOOLS7KRPDV66 2FW .HYLQ*RHVVOLQJ3. 'HF %LOO\9ROHN4% 6HSW 2PDU6WRXWPLUH'% 6HSW 7UDYLV%URZQ,/% 1RY 'HYRQ:\OLH35 6HSW 5RGQH\:ULJKW:5 6HSW &KULV3HWHUV,/% 2FW (MLUR(GHUDLQH2/% 2FW .HYLQ*RHVVOLQJ3.6HSW %HUQDUG%HUULDQ:56HSW 5RQ3DSD]LDQ 1RY .\ULH:LOVRQ,/% 1RY 'DYLG&DUU4% 6HSW $-*DVV/% 6HSW MOUNTAIN WEST SPECIAL 3DULV*DLQHV5% 2FW %ULDQ5RELQVRQ'7 2FW WAC SPECIAL TEAMS TEAMS PLAYER OF THE WEEK 'DYLG&DUU4% 'HF $-*DVV/% 2FW PLAYER OF THE WEEK 2012 4XHQWLQ%UHVKHDUV3. 6HSW 3DXO3LQHJDU4% 6HSW $-*DVV/% 2FW %U\DQ5REHUVRQ35 6HSW $QGUHZ6KDSLUR)6 6HSW 5RGQH\'DYLV5% 'HF (IUDLQ*XL]DU)6 1RY %HQ)RFNH+ 2FW &ROLQ0F*XLUH3. 6HSW %U\VRQ6XPOLQ5% 1RY -XVWLQ-RKQVRQ'/ 6HSW -HII5REHUWV3 1RY ,VDLDK%XUVH35 6HSW 3DXO3LQHJDU4% 6HSW %REE\%URRNV/% 2FW 3D\WRQ:LOOLDPV35 1RY 0DUFHO-HQVHQ7( 2FW %U\VRQ6XPOLQ5% 2FW 2UODQGR+XII/% 2FW -DLPH.LPEURXJK5% 1RY :HQGHOO0DWKLV5% 2FW *LDFKLQR&KLDUDPRQWH'(2FW %HUQDUG%HUULDQ35 2FW 3DXO3LQHJDU4% 1RY $QWKRQ\/LPEULFN661RY 7HUHQFH%URZQ6 1RY 'ZD\QH:ULJKW5% 6HSW 7LP6NLSSHU/% 6HSW -DVRQ6LPSVRQ3 6HSW 'ZD\QH:ULJKW5% 1RY %U\FH0F*LOO)6 1RY %HUQDUG%HUULDQ56 6HSW 5\DQ0DWKHZV5% 2FW %U\FH0F*LOO66 6HSW $VHQ$VSDUXKRY3. 2FW 5\DQ0DWKHZV5% 6HSW 1LFN%XUOH\'( 1RY %HUQDUG%HUULDQ56 1RY 5\DQ0DWKHZV5% 6HSW &ODXGH6DQGHUV'( 6HSW 2002 5D\PRQG:DVKLQJWRQ'% 6HSW 5\DQ0DWKHZV5% 2FW 0DUF'DLOH\/% 2FW $VHQ$VSDUXKRY3. 1RY 5\DQ0DWKHZV5% 1RY &DPHURQ:RUUHOO6 1RY $VHQ$VSDUXKRY3. 'HF 1LFN%XUOH\'( 1RY %UHWW9LVLQWDLQHU.3 6HSW -DPHV6DQGHUV66 6HSW 1DWH5D\'% 6HSW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 133 RECORDS & HISTORY ACADEMIC ALL-AMERICANS Payton Williams Andrew Jackson Justin Northern Jacob Vazquez Robert Malone, P Vince Pascoe, FB Derek Carr, QB DB OL OL OL 1999 2009 2009 Second-Team 2010 Second-Team 2013 Second-Team 2015 2016 Second-Team First-Team Second-Team Second-Team OTHER ACADEMIC AWARDS 0DWWKHZ6WHYHQVRQ 'DUUHQ1HZERUQ -HII&DPLOOL -RUGDQ&KULVWHQVHQ 9LQFH3DVFRH 'HUHN&DUU 7\URQH&XOYHU 6KDZQ3OXPPHU 'DUU\O&DVK -DURQ)DLUPDQ %REE\6KHSDUG $GDP'H&RVWD -RH)HUQDQGH] /RUQH%HOO '\ODQ'HWZLOHU .\OH*RRGPDQ 5\DQ&ROEXUQ %UDQGRQ+XJKHV 1DWH5D\ .HYLQ*RHVVOLQJ -XVWLQ-RKQVRQ -RVK6KHUOH\ $QWKRQ\+DUGLQJ 5RGQH\0DWKHZV 6WHSKHQ6SDFK %U\FH+DUULV &ROLQ0F*XLUH -RUGDQ&KULVWHQVHQ 0RVHV+DUULV 0DOLTXH0LFHQKHLPHU .HYLQ&RRSHU =DN+LOO -XVWLQ1RUWKHUQ 7\URQH&XOYHU $QGUHZ-DFNVRQ .\ULDQ2ELGLHJZX -RH)HUQDQGH] %HQ-DFREV $DURQ3HFN .\OH*RRGPDQ 5REHUW0DORQH *DUUHWW6ZDQVRQ *DUUHWW0F,QW\UH )UDQN0DQTXHUR 0DUWH]H:DOOHU 6WHSKHQ6SDFK 6RQQ\0F&UHH &KDUOHV:DVKLQJWRQ 0DWW6WHYHQVRQ 'DUUHQ1HZERUQ 5LOH\%DUQHV -RUGDQ&KULVWHQVHQ 9LQFH3DVFRH %R%RQQKHLP .HYLQ&LFFRQH 6KDZQ3OXPPHU %ULDQ%XUUHOO W\URQH&XOYHU $XVWLQ5DSKDHO 'DUU\O&DVK 6KDQQRQ'RUVH\ $QGUHZ6KDSLUR %UDQGRQ&RQQHWWH Derek Carr DERYH EHLQJKRQRUHGDWWKH1DWLRQDO)RRWEDOO)RXQDWLRQ -RH)HUQDQGH] %REE\6KHSDUG $GDP'H&RVWD $QQXDO$ZDUGV'LQQHUDWWKH:DOGRUI$VWRULDLQ1HZ QB David Carr QB Trent Dilfer RB Ryan Mathews CB J.D. Williams OG Logan Mankins No. 1 overall - 2002 No. 6 overall - 1994 No. 12 overall - 2010 No. 16 overall - 1990 No. 32 overall - 2005 Houston Texans Tampa Bay Buccaneers San Diego Chargers Buffalo Bills New England YEAR ROUND (PICK) PLAYER, POSITION TEAM WK 'DYH3OXPS'% 6DQ)UDQFLVFRHUV WK 7\HOHU'DYLVRQ1* 1HZ2UOHDQV6DLQWV WK -LP/RQJ% 6DQ)UDQFLVFRHUV WK 'HUURQ6PLWK6 &LQFLQQDWL%HQJDOV WK -DQ%DUUHWW( *UHHQ%D\3DFNHUV WK &RG\:LFKPDQQ2* 6W/RXLV5DPV WK 0RQWH'D\7 &KLFDJR%HDUV QG 'HUHN&DUU4% 2DNODQG5DLGHUV WK 3DXO:LFNHU7 'DOODV&RZER\V QG 'DYDQWH$GDPV:5 *UHHQ%D\3DFNHUV WK +HUPDQ+DPS% *UHHQ%D\3DFNHUV WK 3KLOOLS7KRPDV6 :DVKLQJWRQ5HGVNLQV UG -RQ$QDER4% 2DNODQG5DLGHUV WK 'HYRQ:\OLH:5 .DQVDV&LW\&KLHIV WK -5:LOOLDPV& 1HZ Henry EllardZKRHQMR\HGDSUROL¿F\HDU1)/FDUHHU Trent DilferSOD\HGVHDVRQVLQWKH1)/ZRQD6XSHU DQGZDVDWKUHHWLPH3UR%RZOHUDOVRFRDFKHGLQWKH1)/ %RZODQGZDVD3UR%RZOVHOHFWLRQLQ+HFXUUHQWO\ IRUVHDVRQVPRVWUHFHQWO\DVZKHQKHZDVWKHwide VHUYHVDVD1)/DQDO\VWIRU(631 UHFHLYHUVFRDFKIRUWKH1HZ2UOHDQV6DLQWV 136 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY ALL-TIME NFL LIST +HQGHUVRQ:\DWW:5 ...... /RV$QJHOHV5DPV 0DWKLV:HQGHOO5% ...... 0LQQHVRWD9LNLQJV 3LWWPDQ0LFKDHO5% ...... $UL]RQD&DUGLQDOV ...... 6DQ'LHJR&KDUJHUV 0DWWR[-DFN7 ...... 'HQYHU%URQFRV ...... 7DPSD%D\%XFFDQHHUV ...... ,QGLDQDSROLV&ROWV 0F&DXOH\0DUFXV&% ...... 0LQQHVRWD9LNLQJV ...... 'HQYHU%URQFRV +HUQDQGH]*DU\3 ...... 'DOODV&RZER\V ...... 1HZ2UOHDQV6DLQWV 3KLOSRWW'HDQ)% ...... &KLFDJR&DUGLQDOV +RRNV'HOPR/% ...... 2DNODQG5DLGHUV ...... :DVKLQJWRQ5HGVNLQV 3OXPS'DYH5% ...... 6DQ)UDQFLVFRHUV +RXVWRQ6WHYH2* ...... 'HWURLW/LRQV 0F&R\.HLWK&%.... 3KRHQL[&DUGLQDOV VWSLFN ...... 6DQ'LHJR&KDUJHUV $)/ +XII2UODQGR/% ...... 6HDWWOH6HDKDZNV 0F,QWU\H*DUUHWW/% ...... 1HZ Lorenzo NealSOD\HGVHDVRQVLQWKH1)/DVDIXOOEDFN Logan MankinsDQ\HDU1)/YHWHUDQDQGVHYHQWLPH Ryan MathewsD¿UVWURXQGGUDIWSLFNRIWKH6DQ ZLWKVHYHQWHDPVDQGZDVVHOHFWHGWRIRXU3UR%RZOV1HDO 3UR%RZOVHOHFWLRQKDVSOD\HGLQWZR6XSHU%RZOVZLWKWKH 'LHJR&KDUJHUVZDVLQYLWHGWRWKH3UR%RZOLQKLVVHFRQG EORFNHGIRUD\DUGUXQQLQJEDFNLQHOHYHQVWUDLJKW 1HZ(QJODQG3DWULRWV \HDULQWKH1)/ VHDVRQVIURPWR 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 137 RECORDS & HISTORY ALL-TIME NFL LIST 6SHQFHU.HYLQ:5 ...... 3KLODGHOSKLD(DJOHV :LOOLDPV-DPHV7% ...... 6HDWWOH6HDKDZNV 6WDKO-RKQ7 ...... 'HWURLW/LRQV ...... /RV$QJHOHV5DLGHUV 6WHYHQV-RKQ& ...... 1HZ(QJODQG3DWULRWV :LOOLDPV-'&% ...... %XIIDOR%LOOV ...... 6DQ)UDQFLVFRHUV :LOOLDPV-5& ...... 1HZ Ryan WendellVLJQHGDVDQXQGUDIWHGIUHHDJHQWZLWKWKH Billy VolekSOD\HGVHDVRQVLQWKH1)/ZLWKWKH 1HZ(QJODQG3DWULRWVLQDQGVWDUWHGHYHU\JDPHDW Sam WilliamsSOD\HGOLQHEDFNHUIRUWKH2DNODQG5DLGHUV 7HQQHVVHH7LWDQVDQG6DQ'LHJR&KDUJHUV FHQWHULQSOD\LQJLQWKHPRVWVQDSVRIDQ\SOD\HULQWKH IRUHLJKWVHDVRQVIURP 1)/WKDWVHDVRQ LQUHJXODUVHDVRQ 138 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY BULLDOGS IN THE SUPER BOWL Super Bowl Player Team 50 (2016) Ben Jacobs, OB Carolina Panthers XLVIV (2015) Ryan Wendell, RG New England Patriots XLVII (2013) Lonyae Miller, RB* Baltimore Ravens Kenny Wiggins, OL* San Francisco 49ers XLVI (2012) David Carr, QB New York Giants Bear Pascoe, TE New York Giants Logan Mankins, G New England Patriots Ryan Wendell, C New England Patriots XLV (2011) Chastin West, WR* Green Bay Packers XLIII (2009) Bryan Robinson, DT Arizona Cardinals Stephen Spach, TE Arizona Cardinals XLII (2008) Derrick Ward, RB New York Giants Logan Mankins, G New England Patriots Stephen Baker “The Touchdown Maker” FDXJKWD James Sanders, DB New England Patriots \DUGWRXFKGRZQSDVVIURP-HII+RVWHWOHUODWHLQWKHVHFRQG TXDUWHULQWKH1HZ Bear Pascoe (left) and David Carr (right)VKRZRIIWKHLU Michael Pittman UXVKHGWLPHVIRU\DUGVKHOSLQJ Trent Dilfer ZDVWKHVWDUWLQJTXDUWHUEDFNIRUWKH%DOWLPRUH 6XSHU%RZO;/9,ULQJVDIWHUKHOSLQJWKH1HZ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 139 RECORDS & HISTORY NATIONAL TELEVISION APPEARANCES (SINCE 1992) 1992 2008 2015 1RY $%& )UHVQR6W6DQ'LHJR6W 6HSW (631 )UHVQR6W5XWJHUV 6HSW (631 2OH0LVV)UHVQR6WDWH 'HF 5D\FRP )UHVQR6W86& 6HSW (631 :LVFRQVLQ)UHVQR6W 6HSW &%66SRUWV 8WDK)UHVQR6WDWH 1993 6HSW (6318 )UHVQR6W7ROHGR 27 6HSW &%66SRUWV 6DQ-RVH6WDWH)UHVQR6WDWH 2FW $%& )UHVQR6W%<8 6HSW $%& )UHVQR6W8&/$ 2FW &%66SRUWV 6DQ'LHJR6WDWH)UHVQR6WDWH 1993 1RY (631 1HYDGD)UHVQR6W 2FW &%66SRUWV 8WDK6WDWH)UHVQR6WDWH 2FW $%& )UHVQR6W%<8 1RY $/7 )UHVQR6W1HZ0H[LFR6W 2FW (631 )UHVQR6WDWH81/9 'HF $%& &RORUDGR)UHVQR6W 1RY (631 )UHVQR6W6DQ-RVH6W 1RY (631 1HYDGD)UHVQR6WDWH 1RY (631 %RLVH6W)UHVQR6W 1RY &%66SRUWV &RORUDGR6WDWH)UHVQR6WDWH 2FW (631 )UHVQR6W8WDK 'HF (631 &RORUDGR6W)UHVQR6W 2016 1998 2009 6HSW %,*1HW 1HEUDVND)UHVQR6WDWH 1RY $%& 6DQ'LHJR6W)UHVQR6W 6HSW (631 :LVFRQVLQ)UHVQR6W 27 2FW &%66SRUWV 81/9)UHVQR6WDWH 1999 6HSW (631 %RLVH6W)UHVQR6W 2FW &%66SRUWV 6DQ'LHJR6WDWH)UHVQR6WDWH 2FW )61 608)UHVQR6W 6HSW (57 &LQFLQQDWL)UHVQR6W 2FW &%66SRUWV 8WDK6WDWH)UHVQR6WDWH 1RY )65 +DZDL¶L)UHVQR6W 2FW (6318 )UHVQR6W1HZ0H[LFR6W 2FW (631 $LU)RUFH)UHVQR6WDWH 'HF (631 8WDK)UHVQR6W 1RY (6318 )UHVQR6W,GDKR 1RY &%66SRUWV 6DQ-RVH6WDWH)UHVQR6WDWH 2000 'HF %LJ7HQ )UHVQR6W,OOLQRLV 6HSW )65 8&/$)UHVQR6W 'HF (631 :\RPLQJ)UHVQR6W 27 6HSW )61 )UHVQR6W&DOLIRUQLD 2010 2FW )61 )UHVQR6W5LFH 6HSW (631 )UHVQR6W&LQFLQQDWL 1RY )61 7&8)UHVQR6W 6HSW :61 )UHVQR6W8WDK6WDWH 'HF )61 $LU)RUFH)UHVQR6W 2FW (6318 )UHVQR6W1HZ0H[LFR6W 2001 2FW :61 )UHVQR6W6DQ-RVH6W $XJ (631 )UHVQR6W&RORUDGR 1RY :61 )UHVQR6W/RXLVLDQD7HFK 6HSW (631 )UHVQR6W2UHJRQ6W 1RY (631 1HYDGD)UHVQR6W 6HSW (631 )UHVQR6W:LVFRQVLQ 1RY (631 %RLVH6W)UHVQR6W 6HSW )65 )UHVQR6W7XOVD 1RY :61 )UHVQR6W,GDKR 2FW (631 )UHVQR6W&RORUDGR6W 27 'HF (631 )UHVQR6W,OOLQRLV 2FW (631 %RLVH6W)UHVQR6W 'HF (631 1RUWKHUQ,OOLQRLV)UHVQR6W 2FW (631 +DZDL¶L)UHVQR6W 2011 'HF )61 0LFKLJDQ6W)UHVQR6W 6HSW &61 &DOLIRUQLD)UHVQR6WDWH 2002 6HSW %LJ7HQ 1HEUDVND)UHVQR6WDWH $XJ (631 :LVFRQVLQ)UHVQR6W 6HSW :61 )UHVQR6WDWH,GDKR $XJ (631 )UHVQR6W6DQ'LHJR6W 2FW (631 2OH0LVV)UHVQR6WDWH 6HSW )65 2UHJRQ)UHVQR6W 2FW (631 %RLVH6WDWH)UHVQR6WDWH 6HSW )65 2UHJRQ6W)UHVQR6W 2FW :61 1HYDGD)UHVQR6WDWH 2FW (631 )UHVQR6W&RORUDGR6W 1RY (6318 /RXLVLDQD7HFK)UHVQR6WDWH 2FW )65 )UHVQR6W608 1RY :61 1HZ0H[LFR6WDWH)UHVQR6WDWH 2FW (631 %RLVH6W)UHVQR6W 1RY :61 )UHVQR6WDWH+DZDL¶L 2FW (631 +DZDL¶L)UHVQR6W 'HF &%66SRUWV 6DQ'LHJR6WDWH)UHVQR 'HF (631 )UHVQR6W/RXLVLDQD7HFK 2012 'HF (631 )UHVQR6W*HRUJLD7HFK 6HSW 3DF 2UHJRQ)UHVQR6W 2003 6HSW &%66SRUWV )UHVQR6W&RORUDGR $XJ (631 7HQQHVVHH)UHVQR6W 6HSW &%66SRUWV 7XOVD)UHVQR6W 6HSW (631 )UHVQR6W2UHJRQ6W 6HSW &61%$ )UHVQR6W6DQ'LHJR6W 6HSW 6: )UHVQR6W/RXLVLDQD7HFK 2FW &61%$ )UHVQR6W&RORUDGR6W 1RY 6: )UHVQR6W1HYDGD 2FW 1%&6SRUWV %RLVH6W)UHVQR6W 1RY (631 %RLVH6W)UHVQR6W 2FW &61&$ )UHVQR6W:\RPLQJ 'HF (631 )UHVQR6W8&/$ 2FW &61&$ )UHVQR6W1HZ0H[LFR 2004 1RY &61 )UHVQR6W+DZDL¶L 6HSW )61 )UHVQR6W:DVKLQJWRQ 1RY 1%&6SRUWV )UHVQR6W1HYDGD 6HSW )61 )UHVQR6W.DQVDV6W 1RY 1%&6SRUWV )UHVQR6W$LU)RUFH 2FW (631 %RLVH6W)UHVQR6W 'HF (631 608)UHVQR6W 1RY (631 )UHVQR6W+DZDL¶L 2013 1RY 6: )UHVQR6W1HYDGD $XJ (6318 )UHVQR6WDWH5XWJHUV 27 1RY 6: )UHVQR6W6DQ-RVH6W 6HSW (631 )UHVQR6WDWH%RLVH6WDWH 'HF (631 )UHVQR6W9LUJLQLD 27 2FW (631 )UHVQR6WDWH6DQ'HLJR6WDWH 27 2005 1RY (6318 )UHVQR6WDWH1HYDGD 6HSW (6318 )UHVQR6W:HEHU6W 1RY (631 )UHVQR6WDWH:\RPLQJ 6HSW 7%6 2UHJRQ)UHVQR6W 1RY (631HZV )UHVQR6WDWH1HZ0H[LFR 6HSW (631 )UHVQR6W7ROHGR 1RY &%66SRUWV 6DQ-RVH6WDWH)UHVQR6WDWH 2FW (6318 )UHVQR6W1HZ0H[LFR6W 'HF &%6 )UHVQR6WDWH8WDK6WDWH 2FW $%& )UHVQR6W+DZDL¶L 'HF $%& 86&)UHVQR6WDWH 1RY 6: )UHVQR6W6DQ-RVH6W 2014 1RY (631 )UHVQR6W%RLVH6W $XJ )2; 86&)UHVQR6WDWH 1RY )61 86&)UHVQR6W 6HSW 3DF 8WDK)UHVQR6WDWH 1RY (631 1HYDGD)UHVQR6W 6HSW &%66SRUWV 1HEUDVND)UHVQR6WDWH 'HF (631 /RXLVLDQD7HFK)UHVQR6W 6HSW (631 )UHVQR6WDWH1HZ0H[LFR 'HF (631 7XOVD)UHVQR6W 2FW &%66SRUWV )UHVQR6WDWH6DQ'LHJR6WDWH 2006 2FW &%66SRUWV 81/9)UHVQR6WDWH 27 6HSW (631 )UHVQR6W1HYDGD 2FW (631 %RLVH6WDWH)UHVQR6WDWH 6HSW (631 2UHJRQ)UHVQR6W 1RY (631 :\RPLQJ)UHVQR6WDWH 6HSW )61 :DVKLQJWRQ)UHVQR6W 1RY &%66SRUWV )UHVQR6WDWH6DQ-RVH6WDWH 2FW (631 /68)UHVQR6W 1RY (6318 )UHVQR6WDWH1HYDGD 1RY (631 %RLVH6W)UHVQR6W 'HF &%6 %RLVH6WDWH)UHVQR6WDWH 1RY (631 )UHVQR6W/RXLVLDQD7HFK 'HF (631 5LFH)UHVQR6WDWH 6HSW )61 7H[DV$ 0)UHVQR6W 27 2FW $/7 )UHVQR6W,GDKR 2FW (631 %RLVH6W)UHVQR6W 1RY (631 +DZDL¶L)UHVQR6W 1RY (631 )UHVQR6W.DQVDV6W 1RY (631 )UHVQR6W1HZ0H[LFR6W 'HF (631 )UHVQR6W*HRUJLD7HFK 140 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES /,77/($//$0(5,&$1%2:/ 5$,6,1%2:/ FRESNO STATE 27, DRAKE 13, ARKANSAS STATE 26 FRESNO STATE 12 'HF/RV$QJHOHV&DOLI -DQ)UHVQR&DOLI 6FRULQJ%\4XDUWHUV 6FRULQJ%\4XDUWHUV )UHVQR6WDWH ± 'UDNH ± $UNDQVDV6WDWH ± )UHVQR6WDWH ± 6FRULQJ6XPPDU\ 6FRULQJ6XPPDU\ )6 7RE\+HHE\DUGSDVVIURP.HQ*OHDVRQ 5D\6WXUJLOONLFN '8 :DOODFH5RRNHU\DUGUXQ NLFNIDLOHG $68 5DEELW%XUQHWW\DUGUXQ &7XUWQHUNLFN )6 -DFN.HOOH\\DUGUXQ NLFNEORFNHG $68 3HHZHH0RQWJRPHU\\DUGUXQ 7XUQHUNLFN )6 0HO*XVWDIVRQ\DUGUXQ NLFNIDLOHG )6 *UDQQ\+ROEURRN\DUGSDVVIURP*OHDVRQ 6WXUJLOO.LFN '8 &KDUOHV0F'RZHOO\DUGSDVVIURP-DFN&RXSH -LP%DHUNLFN )6 +HHE\DUGUXQ NLFNIDLOHG Attendance: 10,000 $68 7XUQHU\DUGSDVVIURP%XUQHWW NLFNIDLOHG )6 +ROEURRN\DUGUXQ 6WXUJLOONLFN )5(612&DOLI±5DWFOLII6WDGLXPDQGWKH)UHVQR6WDWH%XOOGRJVSOD\HG $68 0RQWJRPHU\\DUGNLFNRIIUHWXUQ NLFNEORFNHG KRVWWRIDQVDQGWKH'UDNH%XOOGRJVIRUWKH¿UVWHYHU5DLVLQ%RZO Attendance: 5,000 )UHVQR6WDWHOHGIRUPRVWRIWKHJDPHHQWHULQJWKHIRXUWKTXDUWHUZLWKD VSUHDGRYHU'UDNH:LWKRQO\UHPDLQLQJLQWKHJDPHWKH%XOOGRJV LOS ANGELES – ,Q D EHQH¿W FKDULW\ ERZO DLGLQJ WKH 8QGHU 3ULYLOHJHG RSWHGQRWWRXWLOL]HWKHLUVXFFHVVIXOUXQQLQJJDPHEXWLQVWHDGZHQWWRWKHLU &KLOGUHQ¶V 0LON )XQG RI /RV$QJHOHV WKH %XOOGRJV VSHQW &KULVWPDV GD\ SDVVLQJJDPHRQWKHVHFRQGGRZQ7RTXDUWHUEDFN0HO*XVWDIVRQ¶VGLVPD\ EDWWOLQJWKURXJKDJDPH¿OHGZLWKGHDGORFNHGVFRUHVLQWULFDWHSDVVLQJDQGD WKHSDVVGLGQRW¿QG%XOOGRJKDQGVEXWZDVLQWHUUXSWHGE\'UDNHJXDUG5DOSK VWURQJUXQQLQJJDPH *UXEHQZKRDGYDQFHGWKHEDOOWRWKH)6\DUGOLQH %HIRUH URDULQJ IDQV LQ *LOPRUH 6WDGLXP /RV $QJHOHV WKH 7KHIROORZLQJSOD\SURYHGIDWDOIRU)UHVQR6WDWHDV'UDNH¶VKDOIEDFN )UHVQR6WDWH&ROOHJH%XOOGRJVFOLQFKHGDODVWVHFRQGYLFWRU\RYHUWKH -DNH&RXSHFRQQHFWHGDSDVVWR&KDUOHV0F'RZHOOZKRUDQWKHEDOOLQIURP $UNDQVDV6WDWH&ROOHJH7HDFKHUV $68%HDUV IURP&RQZD\$UNDQVDV WKH \DUG OLQH -LP %DHU FRQYHUWHG IRU WKH ¿QDO SRLQW QHHG WR GHIHDW WKH )UHVQR6WDWHMXPSHGRXWZLWKDQHDUO\OHDGLQWKH¿UVWSHULRGVWDUWLQJ %XOOGRJV IURPWKH\DUGOLQHDQGVFRULQJZLWKDQDFUREDWLFFDWFKE\7RE\+HHEIURP )UHVQR6WDWHIRXQGVL[RIWKHLUWRWDOSRLQWVLQWKH¿UVWKDOIEXWQRWXQWLO TXDUWHUEDFN.HQ*OHDVRQ$68DQVZHUHGHQGLQJWKH¿UVWKDOI DIWHUWKH'UDNHµ'RJVVHQWWKHLU¿UVWVHYHQWRWKHVFRUHERDUG 7KH ¿QDO KDOI RI WKH JDPH VWDUWHG ZLWK D TXLFN VHYHQ IRU $68 DV 'RZQE\VL[WKH%XOOGRJVRSHQHGWKHVHFRQGTXDUWHUZLWKDQLPSUHVVLYH 0RQWJRPHU\ FURVVHG LQWR WKH HQG]RQH VWDQGLQJ XS DIWHU D QHDUO\ \DUG RIIHQVLYHGULYH-DFN.HOOH\SURGXFHGD\DUGUXQQLQJWRXFKGRZQSOD\RQ GULYH DGRXEOHUHYHUVHFURVVLQJLQWRWKHHQG]RQHVWDQGLQJ:LWKDIDLOHG¿HOGJRDO 'RZQE\VHYHQWKH%XOOGRJVWRRNWKHEDOODWWKH\DUGOLQHEHJLQQLQJ DWWHPSWWKHVFRUHVWRRGDWKHDGLQJLQWRWKHKDOI DQRIIHQVLYHDWWDFNWKDWUHVXOWHGLQDVHYHQSRLQWERRVWZLWKDWRXFKGRZQ 2SHQLQJ WKH ¿QDO SHULRG )6 VFRUHG ZKHQ /RXLV 3DSDF UHFHLYHG D IURP*UDQYLOOH+ROEURRNDQGDQH[WUDSRLQWIURP5D\6WXUJLOO VKDOORZ'UDNHSXQWRQWKH'UDNH3DSDFSXOOHGGHIHQGHUVWRKLVULJKWWKHQ 7LHG DW WKH IRXUWK TXDUWHU RSHQHG ZLWK D \DUG SXQW UHWXUQ UHYHUVHGKLVPRWLRQWRKXVWOHWKHEDOODOOWKHZD\WRWKH'UDNH\DUGOLQH SODFLQJWKHEDOORQ)UHVQR¶V7KHRIIHQVHGLGQRWVWRSWKHUHDVWKH%XOOGRJV ZKHUH+RE]DNQRFNHGKLPRXWRIERXQGV*XVWDIVRQZDVFUHGLWHGZLWKWKH UDQWKHEDOO\DUGVWRVFRUH7KHH[WUDSRLQWZHQWZLGHSXWWLQJ)UHVQR6WDWH 7'EXOOGR]LQJLQWRWKHHQG]RQHWRVFRUH7D\ORU¶VNLFNVRDUHGZLGHEXWWKH XS µ'RJVZHUHRQWRSDJDLQOHDGLQJ 7KH %HDUV \HW DJDLQ UHWDOLDWHG W\LQJ WKH JDPH ZLWK D \DUG :LWK OHVV WKDQ VHYHQ PLQXWHV UHPDLQLQJ WKH JDPH DSSHDUHG WR EH GULYHDQGDQHQG]RQHWULSE\7XUQHU7KHH[WUDSRLQWHGJHG$68RQFHDJDLQ ZUDSSHGXSEXWWKH%XOOGRJVFRXOGQRWIRUHVHHWKHIDWDOLQWHUFHSWHGSDVVWKDW RQSDUZLWKWKH%XOOGRJV ZRXOGSXWWKHJDPHDZD\IRUJRRG )UHVQR6WDWHIRXQGWKHLUZD\RQWRSVFRULQJWKHLUIRXUWKWRXFKGRZQE\ +ROEURRNRQD\DUGUXQDQGVXFFHVVIXOO\SODFLQJWKHH[WUDSRLQW Team Stats )6 'UDNH $UNDQVDV6WDWHZRXOGQRWJLYHXSDVWKHJDPHPLQXWHVZHUHGLPLQLVKLQJ )LUVW'RZQV 5HWXUQLQJWKHNLFNRII%HDUV¶0RQWJRPHU\IDNHGDSDVVWRWHDPPDWH%XUQHWW 5XVKLQJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 141 RECORDS & HISTORY FRESNO STATE BOWL GAMES 0(5&<%2:/ TEAM STATS FS BG )LUVW'RZQV FRESNO STATE 36, 5XVKLQJ 5HFHLYLQJ %RZOLQJ*UHHQ )UHVQR6WDWH 1961 ĊėĈĞĔĜđͳ 142 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES &$0(//,$%2:/ 0(5&<%2:/ HUMBOLDT STATE 29, CAL STATE FULLERTON 17, FRESNO STATE 14 FRESNO STATE 14 'HF6DFUDPHQWR&DOLI 'HF$QDKHLP&DOLI Score by Quarters 1234Score Score by Quarters 1 2 3 4 Score +XPEROGW6WDWH &6)XOOHUWRQ )UHVQR6WDWH )UHVQR6WDWH 6FRULQJ6XPPDU\ 6FRULQJ6XPPDU\ &6) 'RQ&RWDOLF\DUGEORFNSXQWUHFRYHU\ &UDLJ+LDWWNLFN )6 :DOW-HQVHQ\DUGUXQ .HQ&DVLGDNLFN &6) +LDWW\DUG)* +68 0LNH&UHPHU\DUGUXQ 'DYH%DQGXFFLNLFN )6 %HQ&KLOGHUV\DUGSDVVIURP-RKQ%HKUHQV 6WRHW]ONLFN +68 %DQGXFFL\DUG)* )6 *HQH$XVWLQ\DUGSDVVIURP%HKUHQV 6WRHW]ONLFN +68 %DQGXFFL\DUG)* &6) 7\URQH3HUU\\DUGSDVVIURP0LNH(UQVW +LDWWNLFN +68 %DQGXFFL\DUG)* Attendance: 16,854 )6 -HQVHQ\DUGUXQ &DVLGDNLFN +68 'RQ'HO*UDQGH\DUGSDVVIURP-LP&RVWHOOR %DQGXFFLNLFN $1$+(,0&DOLI±3OD\LQJIRUWKHVXUYLYLQJFKLOGUHQRIWKUHH)XOOHUWRQ6WDWH +68 'HQQLV6RXVD\DUGSDVVIURP%DQGXFFL NLFNIDLOHG DVVLVWDQWFRDFKHVDQGDSLORWZKRGLHGLQDQDLUSODQHFUDVKRQO\DPRQWKHDUOLHUWKH Attendance: 8,168 )XOOHUWRQ6WDWH7LWDQVFDPHIURPEHKLQGWRWDNHWKH0HUF\%RZO,,YLFWRU\RYHU WKH)UHVQR6WDWH%XOOGRJV ,QWKHVHFRQGERZOLQ)UHVQR6WDWHKLVWRU\SOD\HGIRUSODQHFUDVKYLFWLPV 6$&5$0(172 &DOLI ± 7KH HLJKWK DQQXDO &DPHOOLD %RZO SOD\HG LQ D PXGG\ 0HUF\%RZO WKHµ'RJVZHUHQHYHUDEOHWR¿QGDUK\WKPWKDWZRXOGGLVDVVHPEOHWKH +XJKHV6WDGLXPLQ6DFUDPHQWR&DOLISURGXFHGD)UHVQR6WDWHGHIHDWDVWKH%XOOGRJV IHOOWRWKH+XPEROGW6WDWH/XPEHUMDFNV )XOOHUWRQ6WDWHRIIHQVH %ORFNLQJWKUHH/XPEHUMDFNNLFNVZRXOGJHQHUDOO\SUHGLFWD)UHVQR6WDWHZLQ 7KH7LWDQVOHGIRUWKHJUHDWHUSDUWRIWKHPDWFKKHDGLQJLQWRWKHVHFRQGKDOI EXWWKH%XOOGRJV¶WXUQRYHUVVHYHQLQWHUFHSWHGSDVVHVDQG¿YHIXPEOHVPDGHXSWKH ZLWKDOHDGRYHUWKH%XOOGRJV:LWKUHPDLQLQJLQWKH¿UVWSHULRG7LWDQ'RQ GLIIHUHQFH7KH&DOLIRUQLD&ROOHJLDWH$WKOHWLF$VVRFLDWLRQFKDPSLRQ%XOOGRJV¶HIIRUW &RWDOLFEORFNHGD%XOOGRJSXQWVFRULQJRQD\DUGUXQ%DUHIRRWNLFNHU&UDLJ+LDWW ZDVVWXQWHGHYHQPRUHZLWKRXWRIVHUYLFHSKRQHFRPPXQLFDWLRQEHWZHHQWKHSUHVV HDUQHGWKHH[WUDSRLQWIRUWKH7LWDQV¿QGLQJWKHHDUO\OHDG%HIRUHWKHKDOIHQGHG ER[FRDFKLQJVWDIIDQG¿HOGVWDII 'HVSLWHWKHFRQIXVLRQWKH%XOOGRJVRSHQHGWKHVFRULQJE\7RQ\:HOFKEORFNLQJ )XOOHUWRQ6WDWHFDSLWDOL]HGRQPRUH%XOOGRJWURXEOHDVDZLOGSDVVIURP%XOOGRJFHQWHU D/XPEHUMDFNSXQW:HOFKUHFRYHUHGWKHEDOODQGUDQLWWRWKH+XPEROGW6WDWHZKHUH +DUU\0HVWMLDQFDXVHGGHVSHUDWLRQNLFNIURP$WRPLF7RURVLDQQHWWLQJRQO\¿YH\DUGV :DOW-HQVHQGURYHLWLQWRVFRUHDQG.HQ&DVLGDQDLOHGWKHH[WUDSRLQW %XOOGRJSHQDOWLHVPRYHG)XOOHUWRQ6WDWHWRWKHQLQH\DUGOLQHZKHUHWKHVKRHOHVV7LWDQ :LWKDVHYHQSRLQWGH¿FLWWKH/XPEHUMDFNVDQG)DU:HVWHUQ&RQIHUHQFH QDLOHGD\DUG¿HOGJRDOIRUWKHOHDG FKDPSLRQVFDSLWDOL]HGRQWKH%XOOGRJV¶RIIHQVLYHJOLWFKHVDQGSKRQHVHUYLFHSUREOHPV 7KH %XOOGRJV IRXQG WKHLU VWUHQJWK DIWHU KDOIWLPH GULYLQJ \DUGV LQ MXVW VL[ FRPLQJIURPEHKLQGWRWDNHDOHDGKHDGLQJLQWRWKHKDOI 7KHVHFRQGKDOIZDVPRUHRIWKH¿UVWDVWKH%XOOGRJVFDPHRXWVWURQJ-DFN SOD\VDQGVFRULQJRIID\DUGVWULNHIURP-RKQ%HKUHQVWR%HQ&KLOGHUV&KLOGHUV 2OVRQ LQWHUFHSWHG D OLNHO\7' SDVV IURP /XPEHUMDFN 'HQQLV 6RPPHU DQG UDQ WKH FDXJKWWKHSLJVNLQDWWKHWKUHH\DUGOLQHDQGEDUUHOHGKLVZD\LQWRWKHHQG]RQHZLWK OHQJWKRIWKH¿HOGWRVHWWKHµ'RJVXSRQWKH+XPEROGW6WDWH\DUGOLQH-HQVHQVFRUHG WZR)XOOHUWRQ6WDWHGHIHQGHUVKDQJLQJRQKLVVKLUWWDLO/XLV6WRHW]OVHFXUHGWKHH[WUD DQG&DVLGDFRQYHUWHGFXWWLQJWKHVSUHDGWR+XPEROGW6WDWH)UHVQR6WDWH SRLQWFXWWLQJWKH7LWDQOHDGWRRQO\WKUHH 7KH/XPEHUMDFNVDYHQJHGWKH%XOOGRJVHYHQZLWKD&RVWHOORSDVVWR'RQ'HO )UHVQR6WDWHIHGRIIWKH%XOOGRJPRPHQWXP¿QGLQJVHYHQPRUHSRLQWVWRVHQG *UDQGHZKRIRXQGWKHHQG]RQH&DVLGDFRQYHUWHGIRUWKHOHDG +XPEROGW ZDV QRW ¿QLVKHG \HW KRZHYHU ¿QGLQJ 6RXVD FURVVLQJ LQWR )UHVQR WRWKHVFRUHERDUGIURPD)XOOHUWRQIXPEOHUHFRYHU\DQGD\DUGURFNHWIURP%HKUHQV 6WDWHWHUULWRU\RQD\DUGSDVVIURP%DQGXFFL7KHH[WUDSRLQWVDLOHGZLGHFHPHQWLQJ WRÀDQNHU*HQH$XVWLQ6WRHW]OQDLOHGWKHH[WUDSRLQWJLYLQJWKH%XOOGRJVWKHLU¿UVW WKH¿QDOVFRUH+XPEROGW6WDWH)UHVQR6WDWH OHDGRIWKHJDPH 7KH7LWDQVUHWDOLDWHGKRZHYHU¿QGLQJWKHLUODVWVHYHQRQDQ\DUGGULYH )UHVQR6WDWH/LQHXSV SOD\\DUGSDVV7'ZLWKRQO\OHIWWRSOD\ 2IIHQVH²7('DYH+DUULV7-RKQ6WDKO/*+DQN&RUGD&'DU\O:DURQLHFNL 5*%UDG)LVKHO7%RE,QGHUEOHWHQ6(6WHYH6RPPHU)/)UHG9LFNHUV4% )UHVQR6WDWH/LQHXSV 5RQ+XGVRQ+%:DOW-HQVHQ)%0LNH)ORUHV 2IIHQVH²6('DUHQ*HH73DW3LFNIRUG*6WHYH9HUU\&/HH0XQVRQ*3DW3OXPPHU7'DYH 'HIHQVH²'(*HQH6XJOLDQ'77RQ\:HOFK1*-RKQ)RFNH'75RQ5HP- 9LHWW\7(%HQ&KLOGHUV4%-RKQ,QJOHKDUW+%+HUELH3KLOOLSV)%$WRPLF7RURVLDQ)/0LNH +DUULV LQJWRQ'('DYH$X[LHU/%7RP0F&DOO/%3DW&DOODKDQ&%/OR\G0DGGHQ 'HIHQVH²'(-DFN)LVKHU'7'HQQLV.HUDQ1*7KHRGRUH/DPEHUW'7(OPHU&XPPLQJV'(%RE &%7HG&RZOHV66DP*HUPDQ\6(UYLQ+XQW 6HURZLFN/%%LOO&UDZIRUG/%*DU\:HDYHU&%'ZD\QH&UXPS&%%HQ'DYLV663KLO%RUMDV )65D\6KHUPDQ 1968 1971 ĆĒĊđđĎĆĔĜđ ĊėĈĞĔĜđʹ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 143 RECORDS & HISTORY FRESNO STATE BOWL GAMES &$/,)251,$5$,6,1%2:/ TEAM STATS FRESNO STATE 29, )6 %* )LUVW'RZQV BOWLING GREEN 28 Rushes-Yds. 24-80 44-126 'HF)UHVQR&DOLI 3DVVLQJ )UHVQR6WDWH/LQHXSV Offense — 6(6WHSKRQH3DLJH/7.HYLQ0ROOH/*-HUU\/RFNZRRG&-RKQ%ODFNVLOO5*7RP1HYLOOH57(G&DUWHU7(%LOO*ULHYHU4% -HII7HGIRUG7%7HUU\&DUWHU)%'DYH$GDPV)/9LQFH:HVVRQ Defense —/%.HSD.DDHNXDKLZL7&O\GH*ORYHU1*0RUULV%URZQ(.HYLQ-RQHV0/%.HYLQ-RKQVRQ:/%%REE\6WHYHQVRQ5295RQ 144 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES &$/,)251,$5$,6,1%2:/ TEAM STATS )6 %* FRESNO STATE 51, )LUVW'RZQV) BOWLING GREEN 7 55XVKHV 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 145 RECORDS & HISTORY FRESNO STATE BOWL GAMES &$/,)251,$5$,6,1%2:/ TEAM STATS )6 :08 FRESNO STATE 35, )LUVW'RZQV 5XVKLQJ$WWV WESTERN MICHIGAN 30 5XVKLQJ )UHVQR6WDWH/LQHXSV 2IIHQVH²6('ZLJKW3LFNHQV/7)LO/XMDQ/*3DXO9LDO&-LP5DGHPDQQ5*-HII6NLGPRUH57-HII7UXVFKHO7(&UDLJ-RQHV7%.HOO\ 6NLSSHU)%0\URQ-RQHV4%0DUN%DUVRWWL)/$QGUH$OH[DQGHU 'HIHQVH²6/%7UDF\5RJHUV/(1LFN5XJJHUROL1*&KXFN0F&XWFKHQ5(:LOOLH+RZDUG0/%%ULDQ*UHHU:/%%ODLU+ROORZD\5295RQ &R[/&-DPHV:LOOLDPV667RQ\+DUULV)6&UDLJ%RZHQV5&'DUUHO0DUWLQ 146 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS &$/,)251,$5$,6,1%2:/ )6 %68 FRESNO STATE 27, )LUVW'RZQV 5XVKLQJ$WWV BALL STATE 6 5XVKLQJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 147 RECORDS & HISTORY FRESNO STATE BOWL GAMES &$/,)251,$5$,6,1%2:/ TEAM STATS )6 %* BOWLING GREEN 28, )LUVW'RZQV 5XVKLQJ$WWV FRESNO STATE 21 5XVKLQJ %RZOLQJ*UHHQ 5HF 148 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES )5(('20%2:/ TEAM STATS )6 86& FRESNO STATE 24, )LUVW'RZQV 5XVKLQJ$WWV USC 7 5XVKLQJ 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 149 RECORDS & HISTORY FRESNO STATE BOWL GAMES -((3($*/($/2+$%2:/ TEAM STATS )6 &8 COLORADO 41, )LUVW'RZQV 5XVKLQJ$WWV FRESNO STATE 30 5XVKLQJ 150 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS ($632576/$69(*$6%2:/ )6 87$+ )LUVWGRZQV UTAH 17, 5XVKLQJ$WWHPSWV 1HW 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 151 RECORDS & HISTORY FRESNO STATE BOWL GAMES 6,/,&219$//(<)227%$//&/$66,& TEAM STATS $)$)6 AIR FORCE 37, )LUVW'RZQV 5XVKLQJ$WWHPSWV FRESNO STATE 34 1HW 6$1-26(&DOLI±$IWHUEHLQJGRZQDWKDOIWLPHPDQ\WKRXJKWWKH%XOOGRJVZRXOGEHLQIRUDURXWHEXW)UHVQR )UHVQR6WDWH $WW )UHVQR6WDWH 5HF 152 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES 6,/,&219$//(<)227%$//&/$66,& TEAM STATS 068 )6 )LUVW'RZQV MICHIGAN STATE 44, 5XVKLQJ 3DVVLQJ NO. 20 FRESNO STATE 35 3HQDOW\ 5XVKLQJ$WWHPSWV '(&6$1-26(&$/,) 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 153 RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS 6,/,&219$//(<)227%$//&/$66,& *7 )6 )LUVW'RZQV FRESNO STATE 30, 5XVKLQJ 3DVVLQJ GEORGIA TECH 21 3HQDOW\ 5XVKLQJ$WWHPSWV 'HF6DQ-RVH&DOLI )6 5'DYLV\DUGUXQ $VSDUXKRYNLFN INDIVIDUAL STATS Attendance: 26,524 5XVKLQJ *HRUJLD7HFK $WW 154 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS 6,/,&219$//(<)227%$//&/$66,& 8&/$ )6 )LUVW'RZQV )5(61267$7( 5XVKLQJ 3DVVLQJ 3HQDOW\ 8&/$ 5XVKLQJ$WWHPSWV 'HF6DQ-RVH&DOLI 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 155 RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS 03&&20387(56%2:/ 89$ )6 ),567'2:16 )5(61267$7( 5XVKLQJ 3DVVLQJ 3HQDOW\ 9,5*,1,$ 1(7<$5'6586+,1* 'HF%RLVH,GDKR 5XVKLQJ$WWHPSWV $YHUDJH3HU5XVK 156 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES Team Stats $872=21(/,%(57<%2:/ )67/6 ),567'2:16 78/6$ 5XVKLQJ 3DVVLQJ )5(61267$7( 3HQDOW\ 1(7<$5'6586+,1* 'HF0HPSKLV7HQQ 5XVKLQJ$WWHPSWV $YHUDJH3HU5XVK 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 157 RECORDS & HISTORY FRESNO STATE BOWL GAMES 52$'<¶6+80$1,7$5,$1%2:/ TEAM STATS *7)6 ),567'2:16 )5(61267$7( 5XVKLQJ 3DVVLQJ *(25*,$7(&+ 3HQDOW\ 1(7<$5'6586+,1* 'HF%RLVH,GDKR 5XVKLQJ$WWHPSWV $YHUDJH3HU5XVK 1(7<$5'63$66,1* Score by Quarters 1 2 3 4 Score &RPSOHWLRQV$WWHPSWV,QW )UHVQR6WDWH 727$/2))(16(<$5'6 *HRUJLD7HFK 7RWDORIIHQVHSOD\V $YHUDJH*DLQ3HU3OD\ )XPEOHV1XPEHU/RVW 6FRULQJ6XPPDU\ 3HQDOWLHV1XPEHU %&6FRQIHUHQFHV )UHVQR6WDWH $WW 1HW WKHPRVWDOORZHGE\WKH %UDQGVWDWHUZDV7HFK¶VELJJHVWSUREOHPHDUO\RQEHIRUH6PLWKWRRNRYHUZLWK\DUGVUXVKLQJLQWKHVHFRQG 5HFHLYLQJ KDOIDQGERWKRIKLV7'V%UDQGVWDWHUHYHQDGGHGD\DUG7'UXQLQWKHWKLUGTXDUWHUEHKLQGDQHVFRUWIURPWLJKWHQG *HRUJLD7HFK $WW 158 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES TEAM STATS 1(:0(;,&2%2:/ )6 &68 ),567'2:16 COLORADO STATE 40, 5XVKLQJ 3DVVLQJ 3HQDOW\ FRESNO STATE 35 1(7<$5'6586+,1* 'HF$OEXTXHUTXH10 5XVKLQJ$WWHPSWV $YHUDJH3HU5XVK 5XVKLQJ7RXFKGRZQV Score by Quarters 1234Score 1(7<$5'63$66,1* &RORUDGR6WDWH &RPSOHWLRQV$WWHPSWV,QW $YHUDJH3HU$WWHPSW )UHVQR6WDWH $YHUDJH3HU&RPSOHWLRQ 3DVVLQJ7RXFKGRZQV 727$/2))(16(<$5'6 6FRULQJ6XPPDU\ 7RWDORIIHQVHSOD\V )6 0LOOHU/RQ\DH\GUXQ *RHVVOLQJ.NLFN $YHUDJH*DLQ3HU3OD\ &68 6WXFNHU*UDQW\GUXQ 6PLWK-DVRQNLFN )XPEOHV1XPEHU/RVW 3HQDOWLHV1XPEHU PRVWRIWKHZD\0LOOHUVFRUHG)UHVQR6WDWH¶V¿UVW7'RQD\DUGSOXQJH7KHQKHERXQFHGRXWVLGHIRUD\DUG7' DEFENSIVE LEADERS 7DFNOHV 8$$ UXQWRSXWWKH%XOOGRJVXSODWHLQWKHVHFRQGTXDUWHU &2/25$'267$7(%UHZHU5*DOXVKD-3DJQRWWD0 7KH%XOOGRJVZHUHSOD\LQJLQWKHLUQLQWKERZOJDPHLQWKHODVW\HDUV2QO\RWKHUVFKRROVSOD\LQJLQERZO 6LVVRQ02SSHQQHHU1+RULQHN-&ODUN- 2ZHQV% JDPHVWKLVVHDVRQKDYHEHHQDVVXFFHVVIXO )5(61267$7(&DUWHU&3OXPPHU6%HOO/ -DFREV%+HUURQ1'XQQ'+DUULV0 ,NH,'DYLV6-RUGH- 6DFNV 1R 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 159 RECORDS & HISTORY FRESNO STATE BOWL GAMES 1(:0(;,&2%2:/ TEAM STATS )6:< :<20,1* ),567'2:16 )5(61267$7( 5XVKLQJ 'HF$OEXTXHUTXH10 3DVVLQJ 3HQDOW\ Score by Quarters 12342OT Score 1(7<$5'6586+,1* :\RPLQJ 5XVKLQJ$WWHPSWV )UHVQR6WDWH $YHUDJH3HU5XVK 5XVKLQJ7RXFKGRZQV 6FRULQJ6XPPDU\ 160 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES u'529(+80$1,7$5,$1%2:/ Team Stats 1,8 )6 ),567'2:16 1257+(51,//,12,6 5XVKLQJ )5(61267$7( 3DVVLQJ 'HF%RLVH,GDKR 3HQDOW\ 1(7<$5'6586+,1* Score by Quarters 1 2 3 4 Score 5XVKLQJ$WWHPSWV 1RUWKHUQ,OOLQRLV $YJ3HU5XVK )UHVQR6WDWH 5XVKLQJ7RXFKGRZQV 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 161 RECORDS & HISTORY FRESNO STATE BOWL GAMES 6+(5$721+$:$,¶,%2:/ Team Stats )6 608 608 ),567'2:16 5XVKLQJ )5(61267$7( 3DVVLQJ 'HF+RQROXOX+DZDL¶L $ORKD6WDGLXP 3HQDOW\ Score by Quarters 1 2 3 4 Score 1(7<$5'6586+,1* )UHVQR6WDWH 0: 5XVKLQJ$WWHPSWV 608 &86$ $YJ3HU5XVK 5XVKLQJ7RXFKGRZQV SCORING SUMMARY Drive Time Score 162 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAMES 52<$/3853/(/$69(*$6%2:/ Team Stats )6 86& 1R)5(61267$7( ),567'2:16 5XVKLQJ 86& 3DVVLQJ 'HF/DV9HJDV1HY 6DP%R\G6WDGLXP 3HQDOW\ Score by Quarters 1 2 3 4 Score 1(7<$5'6586+,1* )UHVQR6WDWH 0: 5XVKLQJ$WWHPSWV 86& 3DF $YJ3HU5XVK 5XVKLQJ7RXFKGRZQV SCORING SUMMARY Drive Time Score 164 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE RECORDS & HISTORY FRESNO STATE BOWL GAME RECORDS TEAM BOWL RECORDS TEAM DEFENSE Touchdown passes Rushing Rushing Game:['DYLG&DUUYV$LU)RUFH6LOLFRQ 0RVWUXVKHV ...... YV86&)UHHGRP%RZO,; )HZHVWUXVKHV ...... 7XOVD/LEHUW\%RZO 9DOOH\)RRWEDOO&ODVVLF3DXO3LQHJDUYV9LUJLQLD 0RVWQHW\DUGVJDLQHG ...... )HZHVWQHW\DUGV ...... 03&&RPSXWHUV%RZO ...... YV&RORUDGR6WDWH1HZ0H[LFR%RZO ...... YV%DOO6WDWH&DOLIRUQLD5DLVLQ%RZO,; &DUHHU'DYLG&DUU6LOLFRQ9DOOH\)RRWEDOO&ODV- 0RVW7'V ....YV%RZOLQJ*UHHQ&DOLIRUQLD%RZO9 VLF6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,, Passing Passing )HZHVWDWWHPSWV ...... 1YV'UDNH5DLVLQ%RZO Passes intercepted 0RVWDWWHPSWV .. YV&RORUDGR-HHS(DJOH$ORKD%RZO )HZHVWFRPSOHWLRQV ...... YV'UDNH5DLVLQ%RZO Game:0HO*XVWDIVRQYV'UDNH5DLVLQ%RZO 0RVWFRPSOHWLRQV...... 3DVVHVLQWHUFHSWHG 5RG+XGVRQYV+XPEROGW6WDWH&DPHOOLD%RZO ...... YV&RORUDGR-HHS(DJOH$ORKD%RZO ...... YV+XPEROGW6WDWH&DPHOOLD%RZO &DUHHU0HO*XVWDIVRQ5DLVLQ%RZO5RG+XG- 0RVWKDGLQWHUFHSWHG ...... VRQ&DPHOOLD%RZO ...... YV%DOO6WDWH&DOLIRUQLD5DLVLQ%RZO,; Total Defense 0RVW\DUGVJDLQHG ...... )HZHVWUXVKLQJ SDVVLQJSOD\V ...... Longest pass - 0DUN%DUVRWWLWR6WHSKHQ6KHOOH\YV .... YV0LFKLJDQ6WDWH6LOLFRQ9DOOH\)RRWEDOO&ODVVLF ...... YV86&)UHHGRP%RZO,; %DOO6WDWH&DOLIRUQLD5DLVLQ%RZO,; +LJKHVWSFW ...... )HZHVW\DUGVJDLQHG ...... YV'UDNH5DLVLQ%RZO .... YV%RZOLQJ*UHHQ&DOLIRUQLD5DLVLQ%RZO;, RECEIVING 0RVWWRXFKGRZQV ...... Scoring Pass receptions ...... [YV$LU)RUFH6LOLFRQ9DOOH\)RRWEDOO )HZHVWSWVDOORZHG ...... [ Game: 6WHSKRQH3DLJHYV%RZOLQJ*UHHQ ...... &ODVVLFYV9LUJLQLD03&&RPSXWHUV%RZO ...... YV%RZOLQJ*UHHQ0HUF\%RZO, &DOLIRUQLD%RZO,, ...... YV%DOO6WDWH&DOLIRUQLD%RZO,; &DUHHU5RGQH\:ULJKW($6SRUWV/DV9HJDV Total Offense %RZO6LOLFRQ9DOOH\)RRWEDOO&ODVVLF6LOLFRQ 0RVWSOD\V SDVVLQJ UXVKLQJ ...... Miscellaneous 9DOOH\)RRWEDOO&ODVVLF ...... YV&RORUDGR-HHS(DJOH$ORKD%RZO )HZHVWWRWDO¿UVWGRZQV ...... YV'UDNH5DLVLQ%RZO 0RVW\DUGVJDLQHG ...... Receiving yards ...... YV0LFKLJDQ6WDWH6LOLFRQ9DOOH\)RRWEDOO&ODVVLF INDIVIDUAL BOWL RECORDS Game: 5RGQH\:ULJKW6LOLFRQ9DOOH\)RRWEDOO RUSHING &ODVVLF Punting Rushing attempts &DUHHU5RGQH\:ULJKW($6SRUWV/DV9HJDV 0RVWSXQWV ..... YV:HVWHUQ0LFKLJDQ&DOLIRUQLD%RZO9,,, Game:5RGQH\'DYLVYV*HRUJLD7HFK6LOLFRQ %RZO6LOLFRQ9DOOH\)RRWEDOO&ODVVLF6LOLFRQ 0RVW\DUGV ...... YV86&/DV9HJDV%RZO 9DOOH\)RRWEDOO&ODVVLF,,, 9DOOH\)RRWEDOO&ODVVLF +LJKHVWDYHUDJHSHUSXQW ...... &DUHHU%U\VRQ6XPOLQ6LOLFRQ9DOOH\)RRWEDOO&ODV- ...... YV%RZOLQJ*UHHQ&DOLIRUQLD%RZO9 VLF,,, ,903&&RPSXWHUV%RZO/LEHUW\ Touchdown receptions %RZO Game: SOD\HUV %HUQDUG%HUULDQ6LOLFRQ Punt Returns 9DOOH\)RRWEDOO&ODVVLF-DQ%DUUHWW0HUF\%RZO 0RVWSXQWUHWXUQV ...... YV'UDNH5DLVLQ%RZO Rushing yards (net) ,6WHSKRQH3DLJH&DOLIRUQLD%RZO*HQH7D\ORU 0RVW\DUGVUHWXUQHG ...... Game:5RGQH\'DYLVYV*HRUJLD7HFK6LOL- &DOLIRUQLD%RZO$QGUH$OH[DQGHU&DOLIRUQLD ...... YV%RZOLQJ*UHHQ&DOLIRUQLD%RZO,, FRQ9DOOH\)RRWEDOO&ODVVLF,,, %RZO7\GXV:LQDQV-HHS(DJOH$ORKD%RZO &DUHHU:HQGHOO0DWKLV03&&RPSXWHUV 5RGQH\:ULJKW6LOLFRQ9DOOH\)RRWEDOO&ODVVLF Kickoff Returns %RZO/LEHUW\%RZO &DUHHU SOD\HUV %HUQDUG%HUULDQ6LOLFRQ 0RVWNLFNRIIUHWXUQV...... 9DOOH\)RRWEDOO&ODVVLF-DQ%DUUHWW0HUF\%RZO ...... YV$LU)RUFH6LOLFRQ9DOOH\)RRWEDOO&ODVVLF Touchdowns ,6WHSKRQH3DLJH&DOLIRUQLD%RZO*HQH7D\ORU 0RVWUHWXUQ Field goals attempted Punting yards Game:$VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRWEDOO Game: 0LNH0DQFLQLYV%RZOLQJ*UHHQ &ODVVLF,,, &DOLIRUQLD%RZO9 &DUHHU'HUHN0DKRQH\&DOLIRUQLD5DLVLQ%RZO &DUHHU-DVRQ6LPSVRQ6LOLFRQ9DOOH\)RRWEDOO $VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,,,, &ODVVLF,,,, Field goals made Longest punt Game:$VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRWEDOO Game:*DUUHWW6ZDQVRQYV86&/DV9HJDV &ODVVLF,,, %RZO &DUHHU$VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRWEDOO &ODVVLF,,, DEFENSE Solo tackles /RQJHVW¿HOGJRDOPDGH Game: -DPHV:LOOLDPVYV%DOO6WDWH&DOLIRU- Game: %UHWW9LVLQWDLQHU03&&RPSXWHUV QLD5DLVLQ%RZO,; %RZO Total tackles Most two-point conversions Game: [ Game:7HUU\&DUWHUYV%RZOLQJ*UHHQ&DOLIRU- ...... 'HUURQ6PLWKYV86&/DV9HJDV%RZO QLD%RZO,,$QWKRQ\'DLJOHYV&RORUDGR-HHS ...'RQ7XUQHUYV%RZOLQJ*UHHQ&DOLIRUQLD%RZO,, (DJOH$ORKD%RZO ...... &DUHHU7HUU\&DUWHU&DOLIRUQLD%RZO,, Sacks $QWKRQ\'DLJOH-HHS(DJOH$ORKD%RZO Game:&O\GH*ORYHUYV%RZOLQJ*UHHQ&DOL- IRUQLD%RZO,,*UHJ5DPVH\YV%RZOLQJ*UHHQ Most two-point attempts &DOLIRUQLD%RZO9 Game:7UHQW'LOIHUYV&RORUDGR-HHS(DJOH &DUHHU&O\GH*ORYHU&DOLIRUQLD%RZO*UHJ $ORKD%RZO 5DPVH\&DOLIRUQLD%RZO9 &DUHHU7UHQW'LOIHU-HHS(DJOH$ORKD%RZO Interceptions Passes intercepted Most kicking points Game: 5RG:HEVWHUYV%RZOLQJ*UHHQ&DOLIRU- Game: $VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRW- QLD%RZO9'HH0H]DYV*HRUJLD7HFK6LOLFRQ EDOO&ODVVLF,,, 9DOOH\)RRWEDOO&ODVVLF,,,6HDQ$OVWRQ6KHUDWRQ &DUHHU$VHQ$VSDUXKRY6LOLFRQ9DOOH\)RRWEDOO +DZDL¶L%RZO &ODVVLF,,,, &DUHHU5RG:HEVWHU&DOLIRUQLD%RZO'HH 0H]DYV*HRUJLD7HFK6LOLFRQ9DOOH\)RRWEDOO RETURNS &ODVVLF,,,6HDQ$OVWRQ6KHUDWRQ+DZDL¶L%RZO Longest punt return Game:(ULF)R[YV%RZOLQJ*UHHQ&DOLIRUQLD Interception yards %RZO,,$QGUH$OH[DQGHUYV:HVWHUQ0LFKLJDQ Game: 5RQ&R[YV%DOO6WDWH&DOLIRUQLD &DOLIRUQLD%RZO9,,, 5DLVLQ%RZO,; &DUHHU5RQ&R[&DOLIRUQLD5DLVLQ%RZO Kickoff returns *DPH,VDLDK%XUVHYV6086KHUDWRQ+DZDL¶L%RZO ,VDLDK%XUVHYV1RUWKHUQ,OOLQRLVX'URYH+XPDQLWDULDQ Most touchdowns %RZO Game:[ &DUHHU,VDLDK%XUVHX'URYH+XPDQLWDULDQ ...... 'HUURQ6PLWKYV86&/DV9HJDV%RZO %RZO6KHUDWRQ+DZDL¶L%RZO .. 5RQ&R[YV%DOO6WDWH&DOLIRUQLD5DLVLQ%RZO,; ...... 'HH0H]D6LOLFRQ9DOOH\)RRWEDOO&ODVVLF,,, Kickoff yards &DUHHU[ Game:,VDLDK%XUVHX'URYH+XPDQLWDULDQ %RZO &DUHHU,VDLDK%XUVHX'URYH+XPDQLWDULDQ %RZO6KHUDWRQ+DZDL¶L%RZO Touchdowns from kickoff returns Game:DOOWHDPV &DUHHUDOOWHDPV Longest return Game: ,VDLDK%XUVHYV1RUWKHUQ,OOLQRLV X'URYH+XPDQLWDULDQ%RZO 166 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 OPPONENTS INCARNATE WORD ALABAMA WASHINGTON NEVADA Sept. 2, 2017 Sept. 9, 2017 Sept. 16, 2017 Sept. 30, 2017 Fresno, Calif. Tuscaloosa, Ala. Seattle, Wash. Fresno, Calif. TBD 12:30 p.m. PT 6:30 p.m. PT TBD TBD ESPN2 PAC-12 NETWORK TBD General Information General Information General Information General Information Location ...... San Antonio, Texas Location ...... Tuscaloosa, Ala. Location ...... Seattle, Wash. Location ...... Reno, Nev. Founded ...... 1881 Founded ...... 1831 Founded ...... 1861 Founded ...... 1874 Enrollment ...... 10,984 Enrollment ...... 37,655 Enrollment ...... 46,081 Enrollment ...... 20,000 Nickname ...... Cardinals Nickname ...... Crimson Tide Nickname ...... Huskies Nickname ...... Wolf Pack Colors ...... Red, Black & White Colors ...... Crimson and White Colors ...... Purple & Gold Colors ...... Navy Blue and Silver $IÀOLDWLRQ...... NCAA Division I - FCS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS Conference ...... Southeastern Conference ...... 3DFLÀF Conference ...... Mountain West Conference ...... Southland President ...... Dr. Stuart Bell President ...... Ana Mari Cauce President ...... Dr. Marc Johnson President ...... Dr. Thomas Evans Athletic Director ...... Greg Byrne Athletic Director ...... Jennifer Cohen Athletic Director ...... Doug Knuth Interim Athletic Director .....Mark Papich Stadium Information Stadium Information Stadium Information Stadium Information Stadium ...Gayle & Tom Benson Stadium Stadium ...... Bryant-Denny Stadium Stadium ...... Husky Stadium Stadium ...... Mackay Stadium Capacity ...... 6,000 Capacity ...... 101,821 Capacity ...... 70,338 Capacity ...... 30,000 Surface ...... Hellas Matrix Surface ...... Grass Surface ...... FieldTurf Surface ...... FieldTurf Coaching Staff Coaching Staff Coaching Staff Coaching Staff Head Coach ...... Larry Kennan Head Coach ...... Nick Saban Head Coach ...... Chris Peterson Head Coach ...... Jay Norvell Career Record (Yrs) ...... 32-53-3 (9) Career Record (Yrs) ...... 220-78-1 (23) Career Record (Yrs) ...... 119-26 (11) Career Record (Yrs) ...... 0-0 (0) At School (Yrs) ...... 19-36 (5) At School (Yrs) ...... 114-19 (10) At School (Yrs) ...... 27-14 (3) At School (Yrs) ...... 0-0 (0) Assistant Coaches Assistant Coaches Assistant Coaches Assistant Coaches Larry Moore .....Assoc. HC (Off.)/OL Burton Burns ...... Asst. HC/RB/ST Keith Bhonapha ...... RC/RBs Jeff Casteel ...... DC/LBs Robert Lyles ..Assoc. HC (Def.)/OLB Brian Daboll...... OC/QBs Bob Gregoy...... Asst. HC/LB/ST Matt Mumme ...... OC/QBs Kyle Kennan ...... OC/WRs Jeremy Pruitt ...... DC/ILB Scott Huff ...... OL/RG Coor. Timmy Chang ...... Inside WRs Brian Gamble ...... DC/ILBs Karl Dunbar...... DL Pete Kwiatkowski ...... DC Mason Miller ...... OL Sean Davis ...... Pass Game Coor./QBs Brent Key ...... OL Jimmy Lake ...... Co-DC/DBs David White ...... RBs Nick Debose ...... Def. Pass Game Coor./DBs Derrick Ansley ...... DBs Matt Lubick ...... Co-OC/WRs Eric Scott ...... Outside WRs Mike Barela ...... Run Game Coor./TEs Michael Locksley ...... Co-OC/WR Ikaika Malloe ...... DL Jason Kaufusi ...... DL Tres Sullivan ...... RBs Tosh Lupoi ...... Co-DC/OLB Jordan Paopao ...... TEs Matt Kirk ...... Safeties Polo Gutierrez ...... ST Coor./DL Joe Pannunzio ...... STC/TEs Jonathan Smith ...... OC/QBs Courtney Viney ...... CBs Team Information Team Information Team Information Team Information 2016 Record ...... 14-1 2016 Record ...... 12-2 2016 Record ...... 5-7 2016 Record ...... 3-8 Conference Record/Finish ..3-5/T-3rd W Conference Record/Finish ..8-0/1st (West) Conference Record/Finish ...... 8-1/1st Conference Record/Finish ...... 3-6/9th Basic Offense ...... Spread Pistol Basic Offense ...... Pro-Style (Multiple) Basic Offense ...... Multiple Basic Offense ...... Multiple Basic Defense ...... 4-3 Basic Defense ...... 3-4 Basic Defense ...... 3-4 Basic Defense ...... 3-4 Lettermen Returning/Lost ...... 33/19 Lettermen Returning/Lost ...... 52/21 Lettermen Returning/Lost ...... 53/17 Lettermen Returning/Lost ...... 74/21 Starters Returning/Lost ...... 12/12 Starters Returning/Lost ...... 13/13 Starters Returning/Lost ...... 16/8 Starters Returning/Lost ...... 19/9 Sports Information Sports Information Sports Information Sports Information Football SID ...... Chad Hartley Football SID ...... Zachary Carlton Football SID ...... Josh Maxson Football SID ...... Jeff Bechthold 2IÀFH ...... 205-348-3600 2IÀFH ...... 775-682-6982 2IÀFH ...... 210-805-3071 2IÀFH ...... 206-685-7910 E-Mail ...... [email protected] E-Mail ...... [email protected] E-Mail ...... [email protected] E-Mail ...... [email protected] 2017 Schedule 2017 Schedule 2017 Schedule 2017 Schedule Date Opponent Time Date Opponent Time Date Opponent Time Date Opponent Time 9/1 at Rutgers 5 p.m. 9/2 at Northwestern 12:30 p.m. 9/2 Fresno State TBA 9/2 Florida State 7 p.m. 9/9 Montana 5 p.m. 9/9 Toledo 4 p.m. 9/9 at Sacramento State TBA 9/9 Fresno State 2:30 p.m. 9/16 Fresno State 6:30 p.m. 9/16 Idaho State 4 p.m. 9/16 at Stephen F. Austin* 6 p.m. 9/16 Colorado State 6 p.m. 9/23 at Colorado* TBD 9/23 at Washington State TBA 9/30 Abilene Christian* 6 p.m. 9/23 at Vanderbit* TBA 9/30 at Oregon State* TBD 9/30 at Fresno State* TBA 10/7 at Southeastern La.* 4 p.m. 9/30 Ole Miss* TBA 10/7 California* TBD 10/7 Hawai’i* 7:30 p.m. 10/14 Lamar* 6 p.m. 10/7 at Texas A&M* TBA 10/14 at Arizona State* TBD 10/14 at Colorado State* TBA 10/21 at McNesse State* TBA 10/14 Arkansas* TBA 10/28 UCLA* TBD 10/20 Air Force* 6:30 p.m. 10/28 Nichols State* 2 p.m. 10/21 Tennessee* TBA 11/4 Oregon* TBD 11/4 at Boise State* TBA 11/4 at Sam Houston State* TBA 11/4 LSU* TBA 11/10 at Stanford* 7:30 p.m. 11/11 San Jose State* TBA 11/11 Central Arkansas* 6 p.m. 11/11 at Mississippi State* TBA 11/18 Utah* TBD 11/18 at San Diego State* 7:30 p.m. 11/16 Prairie View A&M* 6 p.m. 11/18 Mercer TBA 11/25 Washington State* TBD 11/25 UNLV* 1 p.m. - All Times Central 11/25 at Auburn* TBA $OO7LPHV3DFLÀF $OO7LPHV3DFLÀF - All Times Central 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 167 2017 OPPONENTS SAN JOSE STATE NEW MEXICO SAN DIEGO STATE UNLV Oct. 7, 2017 Oct. 14, 2017 Oct. 21, 2017 Oct. 28, 2017 San Jose, Calif. Fresno, Calif. San Diego, Calif. Fresno, Calif. TBA TBA 7:30 p.m. PT TBA TBA AT&T Sports Networks CBS Sports Network AT&T Sports Networks General Information General Information General Information General Information Location ...... San Jose, Calif. Location ...... Albuquerque, N.M. Location ...... San Diego, Calif. Location ...... Las Vegas, Nev. Founded ...... 1857 Founded ...... 1889 Founded ...... 1897 Founded ...... 1957 Enrollment ...... 32,471 Enrollment ...... 27, 353 Enrollment ...... 33,726 Enrollment ...... 29,000 Nickname ...... Spartans Nickname ...... Lobos Nickname ...... Aztecs Nickname ...... Rebels Colors ...... Gold, White & Blue Colors ...... Cherry & Silver Colors ...... Scarlet and Black Colors ...... Scarlet & Gray $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS Conference ...... Mountain West Conference ...... Mountain West Conference ...... Mountian West Conference ...... Mountain West President ...... Dr. Mary Papazian President ...... Dr. Robert Frank President ...... Dr. Elliot Hirshman President ...... Len Jessup Athletic Director ...... Gene Bleymaier Athletic Director ...... Janice Ruggiero Athletic Director ...... John David Wicker Athletic Director ...... Tina Kunzer-Murphy Stadium Information Stadium Information Stadium Information Stadium Information Stadium ...... Spartan Stadium Stadium ...... Dreamstyle Stadium Stadium ...... Qualcomm Stadium Stadium ...... Sam Boyd Stadium Capacity ...... 30,456 Capacity ...... 39, 224 Capacity ...... 54,000 Capacity ...... 35,500 Surface ...... FieldTurf Surface ...... FieldTurf Surface ...... Natural Grass Surface ...... SPRINTURF Coaching Staff Coaching Staff Coaching Staff Coaching Staff Head Coach ...... Brett Brennan Head Coach ...... Bob Davie Head Coach/DC ...... Rocky Long Head Coach ...... Tony Sanchez Career Record (Yrs) ...... 0-0 (0) Career Record (Yrs) ...... 62-61 (10) Career Record (Yrs) ...... 119-95 (17) Career Record (Yrs) ...... 7-17 (2) At School (Yrs) ...... 0-0 (0) At School (Yrs) ...... 27-36 (5) At School (Yrs) ...... 54-26 (6) At School (Yrs) ...... 7-17 (2) Assistant Coaches Assistant Coaches Assistant Coaches Assistant Coaches Kent Baer ...... DC/LBs Derrick Odum ...... DC Bob DeBesse ...... OC/WRs Jeff Horton ...... Assoc. HC/OC/RBs Barney Cotton ...... OC/TEs Andrew Sowder ...... OC/TEs Kevin Cosgrove ...... DC/LBs Bobby Hauck ...... Assoc. HC/STC Cedric Cormier ...... WRs Joe Bernardi ...... OL Apollo Wright ...... STC/QBs Zach Arnett ...... LBs John Garrison ...... OL Alonzo Carter ...... RBs Charles McMillian ....Def. PG Coor./Saf. Hunkie Cooper ...... WRs Andy LaRussa ...... S/STC Kevin Cummings ...... WRs Saga Tuitele .....Run Game Coor./ OL Daniel Gonzales ...... S Ron O’Dell ...... QBs Bojay Filimoeatu ...... LBs Scott Baumgartner ...... RBs Ernie Lawson ...... DL Travis Burkett ...... RBs Ryan Gunderson ...... QBs Clay Davie ...... TEs Blane Morgan ...... QBs Tony Samuel...... DL David Lockwood ...... CBs Will Harris ...... DBs Stan Eggen ...... DL Mike Schmidt ...... OL Joe Seumalo...... OL Al Simmons...... CBs Tony White...... CBs Team Information 2016 Record ...... 4-8 Team Information Team Information Team Information Conference Record/Finish ...3-5/T-3rd W 2016 Record ...... 4-8 2016 Record ...... 9-4 2016 Record ...... 11-3 Basic Offense ...... Pro-Style Conference Record/Finish ...3-5/T-3rd W Conference Record/Finish ....6-2/T-1st Mtn Conference Record/Finish ...... 6-2/1st W Basic Defense ...... 4-3 Basic Offense ...... Multiple Basic Offense ...... Multiple Basic Offense ...... Pro-Style Lettermen Returning/Lost ...... 46/20 Starters Returning/Lost ...... 13/11 Basic Defense ...... 4-3 Multiple Basic Defense ...... 4-3 Multiple Basic Defense ...... 3-3-5 Lettermen Returning/Lost ...... 35/16 Lettermen Returning/Lost ...... 41/27 Lettermen Returning/Lost ...... 11/12 Starters Returning/Lost ...... 17/7 Starters Returning/Lost ...... 9/13 Sports Information Starters Returning/Lost ...... 35/20 Football SID ...... Mark Wallington 2IÀFH ...... 702-895-4472 Sports Information Sports Information E-Mail ...... [email protected] Football SID ...... Lawrence Fan Football SID ...... Frank Mercogliano Sports Information Football SID ...... Mike May 2IÀFH ...... 408-924-1217 2IÀFH ...... 505-410-4844 2017 Schedule E-Mail ...... [email protected] E-Mail ...... [email protected] 2IÀFH ...... 619-957-8372 E-Mail ...... [email protected] Date Opponent Time 2017 Schedule 2017 Schedule 9/2 Howard 6 p.m. Date Opponent Time Date Opponent Time 2017 Schedule 9/9 at Idaho 6 p.m. 8/26 South Florida 4:30 p.m. 9/2 Abilene Christian TBA Date Opponent Time 9/23 at Ohio State TBA 9/2 Cal Poly TBA 9/9 New Mexico State TBA 9/2 UC Davis 5:30 p.m. 9/30 San Jose State* TBA 9/9 at Texas 2:30 p.m. 9/14 at Boise State* 6 p.m. 9/9 at Arizona State 8 p.m. 10/7 San Diego State* TBA 9/16 at Utah 7 p.m. 9/23 at Tulsa TBA 9/16 Stanford 7:30 p.m. 10/14 at Air Force* TBA 9/23 Utah State* TBA 9/30 Air Force* 5 p.m. 9/23 at Air Force* 4 p.m. 10/21 Utah State* TBA 9/30 at UNLV* TBA 10/14 at Fresno State* TBA 9/30 Northern Illinois 7:30 p.m. 10/28 at Fresno State* TBA 10/7 Fresno State* TBA 10/20 Colorado State* 8:15 p.m. 10/7 at UNLV* TBA 11/4 Hawai’i* TBA 10/14 at Hawai’i* TBA 10/28 at Wyoming* TBA 10/14 Boise State* 7:30 p.m. 11/10 BYU* 7:30 p.m. 10/28 at BYU* TBA 11/4 Utah State* TBA 11/17 at New Mexico* 6:30 p.m. 11/4 San Diego State* TBA 11/11 at Texas A&M* TBA 10/21 Fresno State* 7:30 p.m. 11/25 at Nevada* 1 p.m. 11/11 at Nevada* TBA 11/17 UNLV* 7:30 p.m. 10/28 at Hawai’i* TBA 11/18 at Colorado State* 12:30 p.m. 11/24 at San Diego State* 1:30 p.m. 11/4 at San Jose State* TBA $OO7LPHV3DFLÀF 11/25 Wyoming* TBA - All Times Mountain 11/18 Nevada* 7:30 p.m. $OO7LPHV3DFLÀF 11/24 New Mexico* 12:30 p.m. $OO7LPHV3DFLÀF 168 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE 2017 OPPONENTS BYU HAWAI’I WYOMING BOISE STATE Nov. 4, 2017 Nov. 11, 2017 Nov. 18, 2017 Nov. 28, 2017 Fresno, Calif. Honolulu, Hawai’i Laramie, Wyo. Fresno, Calif. TBA TBA TBA 12:30 p.m. PT ESPN Networks TBA AT&T Sports Networks CBS Sports Network General Information General Information General Information General Information Location ...... Provo, Utah Location ...... Honolulu, Hawai’i Location ...... Laramie, Wyoming Location ...... Boise, Idaho Founded ...... 1875 Founded ...... 1907 Founded ...... 1886 Founded ...... 1932 Enrollment ...... 30, 395 Enrollment ...... 20,000 Enrollment ...... 13, 551 Enrollment ...... 23,886 Nickname ...... Cougars Nickname ...... Rainbow Warriors Nickname ...... Cowboys Nickname ...... Broncos Colors ...... Blue and White Colors ...... Green, Black, White and Silver Colors ...... Brown & Gold Colors ...... Blue & Orange $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS $IÀOLDWLRQ...... NCAA Division I - FBS Conference ...... Independent Conference ...... Mountain West Conference ...... Mountain West Conference ...... Mountain West President ...... Kevin J. Worthen Interim Chancellor ...... David Lassner President ...... Laurie Nichols President ...... Dr. Robert Kustra Athletic Director ...... Tom Holmoe Athletic Director ...... David A.K. Matlin Athletic Director ...... Tom Burman Athletic Director ...... Curt Apsey Stadium Information Stadium Information Stadium Information Stadium Information Stadium ...... LaVell Edwards Stadium Stadium ...... Aloha Stadium Stadium ...... War Memorial Stadium Stadium ...... Albertsons Stadium Capacity ...... 63,470 Capacity ...... 50,000 Capacity ...... 29, 181 Capacity ...... 36,387 Surface ...... Grass Surface ...... 6\QWKHWLF,QÀOOHG7XUI Surface ...... FieldTurf Surface ...... Blue Field Turf Coaching Staff Coaching Staff Coaching Staff Coaching Staff Head Coach ...... Kalani Sitake Head Coach ...... Nick Rolovich Head Coach ...... Craig Bohl Head Coach ...... Bryan Harsin Career Record (Yrs) ...... 9-4 (1) Career Record (Yrs) ...... 7-7 (1) Career Record (Yrs) ...... 118-56 Career Record (Yrs) ...... 38-14 (4) At School (Yrs) ...... 9-4 (1) At School (Yrs) ...... 7-7 (1) At School (Yrs) ...... 14-24 (3) At School (Yrs) ...... 31-9 (3) Assistant Coaches Assistant Coaches Ed Lamb ...... Asst. HC/STC/S Assistant Coaches Assistant Coaches Kent Riddle ...... Assoc. HC/TE/STC Ty Detmer ...... OC/QBs Brian Smith ...... Assoc. HC/OC/RB/TE Brent Vigen ...... OC/ QBs Steve Caldwell ...... Asst. HC/DL ‘Illaisa Tuiaki ...... DC/DL Legi Suiaunoa ...... DC Scottie Hazelton ...... DC/LBs Zak Hill ...... OC/QBs Mike Empey ...... OL Mayur Chaudhari ...... STC/DEs Mike Bath ...... RB/FBs Andy Avalos ...... DC/LBs Reno Mahe ...... RBs Sean Duggan ...... LBs AJ Cooper ...... STC/DEs Ashley Ambrose ...... DBs Ben Cahoon ...... WRs Abe Elimimian...... CBs Jake Dickert ...... S Brad Bedell ...... OL Steve Clark ...... TEs Kefense Hynson ...... WRs Scott Fuchs...... OL Gabe Franklin ...... S Steve Kaufusi ...... LBs Chris Naeole ...... OL Mike Grant ...... WRs Eric Kiesau ...... WRs Jernaro Gilford ...... CBs Lee Marks ...... RBs Craig Stutzmann . Pass Game Coor./QBs Peter Kaligis ...... DTs Jacob Yoro ...... S John Richardson ...... CBs Team Information Team Information 2016 Record ...... 9-4 Team Information Team Information 2016 Record ...... 10-3 Conference Record/Finish...... N/A Conference Record/Finish ...6-2/ T-1st M Basic Offense ...... Pro Style, Multiple 2016 Record ...... 7-7 2016 Record ...... 8-6 Basic Offense ...... Multiple Basic Defense ...... 4-3 Conference Record/Finish ....4-4/2nd W Conference Record/Finish ..6-2/T-1st M Basic Defense ...... Multiple Lettermen Returning/Lost ...... 59/21 Basic Offense ...... Multiple Basic Offense ...... Pro-Style (West Coast) Lettermen Returning/Lost ...... 47/27 Starters Returning/Lost ...... 14/10 Basic Defense ...... 4-3 Basic Defense ...... Tampa 2 (4-3) Starters Returning/Lost ...... 10/15 Lettermen Returning/Lost ...... 54/19 Lettermen Returning/Lost ...... 51/21 Sports Information Sports Information Football SID ...... Brett Pyne Starters Returning/Lost ...... 15/10 Starters Returning/Lost ...... 15/9 Football SID ...... Joe Nickell 2IÀFH ...... 801-422-4912 2IÀFH ...... 208-426-3868 E-Mail ...... N/A Sports Information Sports Information E-Mail ...... [email protected] Football SID ...... Derek Inouchi Football SID ...... Tim Harkins 2IÀFH ...... 808-956-4478 2IÀFH ...... 307-766-2321 2017 Schedule 2017 Schedule E-Mail ...... [email protected] E-Mail ...... [email protected] Date Opponent Time Date Opponent Time 9/2 Troy 1:45 p.m. 8/26 Portland State 1 p.m. 2017 Schedule 2017 Schedule 9/9 at Washington State 8:30 p.m. 9/3 LSU (Houston, Tex.) 7:30 p.m. Date Opponent Time Date Opponent Time 9/14 New Mexico* 6 p.m. 9/9 Utah 8:15 p.m. 8/26 at UMass TBA 9/2 at Iowa 10 a.m. 9/22 Virginia 6 p.m. 9/16 Wisconsin 1:30 p.m. 9/2 Western Carolina TBA 9/9 Gardner-Webb TBA 10/6 at BYU 8:15 p.m. 9/29 at Utah State 6 p.m. 9/9 at UCLA 11 a.m. 9/16 Oregon 5 p.m.. 10/14 at San Diego State* 8:30 p.m. 10/6 Boise State 8:15 p.m. 9/23 at Wyoming* TBA 9/23 Hawai’i* TBA 10/21 Wyoming* TBA 10/14 at Mississippi State TBA 9/30 Colorado State* TBA 9/30 Texas State TBA 10/28 at Utah State* 8 p.m. 10/21 at East Carolina TBA 10/7 at Nevada* 4:30 p.m. 10/14 at Utah State* TBA 11/4 Nevada* TBA 10/28 San Jose State TBA 10/14 San Jose State* TBA 10/21 at Boise State* TBA 11/11 at Colorado State* 8:30 p.m. 11/4 at Fresno State TBA 10/28 San Diego State* TBA 10/28 New Mexico* TBA 11/18 Air Force* TBA 11/10 at UNLV 8:30 p.m. 11/4 at UNLV* TBA 11/4 Colorado State* 5 p.m. 11/25 at Fresno State* 1:30 p.m. 11/18 Massachusetts 1 p.m. 11/11 Fresno State* TBA 11/11 at Air Force* TBA - All Times Mountain 11/25 at Hawai’i 7 p.m. 11/18 at Utah State* TBA 11/18 Fresno State* TBA - All Times Mountain 11/25 BYU 4 p.m. 11/25 at San Jose State* TBA - All Times Hawaiian - All Times Mountain 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 169 MEDIA INFORMATION FRESNO STATE ATHLETIC COMMUNICATIONS FRESNO STATE ATHLETIC COMMUNICATIONS Mailing Address: MATT BURKHOLDER Fresno State Athletic Coummunicationsons Director of Communications 5305 N. Campus Drive NG 27 (Football, W Golf) Office: 559-278-6186 | Cell: 559-862-3771 Fresno, CA 93740 E-mail: [email protected] Phone: 559.278.2509 Fax: 559.278.4689 STEPHEN TREMBLEY Director of New Media (Men’s Basketball) gobulldogs.com Office: 559-278-6178 | Cell: 559-270-4291 E-mail: [email protected] MEDIA/PHOTO CREDENTIALS Requests for media and/or photo credentials should be submitted via email to Matt TRAVIS BLANSHAN Burkholder at [email protected] at least 48 hours prior to the event. Assistant Director of Communications Since space is limited in the press box, accommodations are on the following priority (FB-3, Wrestling, Baseball) basis: daily newspapers, originating radio and television stations, national weekly or Office: 559-278-4647 | Cell: 559-575-1399 monthly publications, electronic media outlets, local and regional television crews. E-mail: [email protected] Priority is granted to full-time employees of media entities that cover Fresno State football on a regular basis, which includes coverage of press conferences, open practices, home and road games and to visiting media members. JOSH MITCHELL Assistant Director of Communications Freelance and amateur photographers not on assignment are not eligible for (FB-2, Women’s Basketball, W Tennis, Track & Field) photo credentials, except with prior approval from the Fresno State Athletics Office: 559-278-7301 | Cell: 559-389-1960 E-mail: [email protected] &RPPXQLFDWLRQV2IÀFH Note: Websites that sponsor message boards, message centers or chat rooms where ANDREW TOMSKY people are allowed to post anonymous information will not be issued credentials. Assistant Director of Communications If a medium has an online site that sponsors these anonymous forums, they may (Volleyball, Swim/Dive, Softball) continue to receive credentials under its traditional medium (newspaper, magazine, Office: 559-278-8212 | Cell: 559-326-8329 radio, television), but will not be granted additional passes for online staff. E-mail: [email protected] CREDENTIAL PICK-UP & WILL CALL Credentials may be picked up at Jeff Tedford’s weekly press conference on Monday TAYLOR MARTINEZ PRUQLQJRUE\FRQWDFWLQJ7D\ORU0DUWLQH]LQWKH$WKOHWLFV&RPPXQLFDWLRQV2IÀFH Communications Assistant prior to the day of the game. On game days, credentials may be picked up at (Soccer, Lacrosse, M Tennis) the Ricchiuti Academic Center (where the photo work room is located), located Office: 559-278-4647 | Cell: 559-394-6492 E-mail: [email protected] southeast of Bulldog Stadium, inside the Fresno State Student-Athlete Village. Non-working individuals will not be permitted in the press box. WEEKLY RELEASE JUSTIN CLARK Fresno State’s weekly release and statistical package, which includes notes and two- Communications Intern (Cross Country, M Golf, Water Polo) deep charts, is available each Monday during the football season at GoBulldogs. Office: 559-278-4645 | Cell: 559-326-8329 com. E-mail: TBA FOOTBALL E-MAIL LIST If you would like to be added to the Fresno State football E-mail list to receive breaking SAVANNAH STOECKLE news about the team, please E-mail Matt Burkholder at [email protected]. Communications Student Assistant (Equestrian) MOUNTAIN WEST MEDIA INFORMATION Office: TBA Stuart Buchanan, Mountain West Assistant Director for Communications, will E-mail: TBA handle all information related to football at the Mountain West. He may be reached at 719-488-4042. INTERVIEW POLICY Requests for interviews with players and coaches should be made through the )UHVQR6WDWH$WKOHWLF&RPPXQLFDWLRQV2IÀFHDQGVKRXOGEHPDGHDWOHDVWKRXUV in advance to ensure availability. PHOTO REGULATIONS 1&$$ UHJXODWLRQV OLPLW WKH VKRRWLQJ RI SKRWRV WR DQ DUHD RXWVLGH D ÀYHIRRW UHVWUDLQLQJ DUHD VXUURXQGLQJ WKH SOD\LQJ ÀHOG 3KRWRJUDSKHUV PXVW VKRRW IURP behind the white lines between the 25-yard line and the back of the end zone on HLWKHUVLGHRI WKHÀHOGDQGVWD\FRPSOHWHO\RXWRI WKHWHDPER[HVRQWKHVLGHOLQH7KH 170 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE MEDIA INFORMATION Fresno State Athletics Department reserves all commercial and non-commercial WKH SUDFWLFH ÀHOGV 0HPEHUV RI WKH PHGLD DUH DVNHG WR UHPDLQ RQWKHEHUP ULJKWVWRWKHXVHRI ÀOPYLGHRWDSHVDQGVWLOOSKRWRJUDSKVRI LWVDWKOHWLFVHYHQWV VXUURXQGLQJWKHÀHOGGXULQJWKRVHDOORWWHGWLPHV student-athletes, staff and facilities. A work room for photographers is located in the Ricchiuti Academic Center and can be accessed through the Student-Athlete PARKING Village. Game day media parking at Bulldog Stadium is available on a limited basis and requires a pass - parking is available in three locations, through Gate 10 off of BULLDOG STADIUM PRESS BOX Bulldog Lane at the Fresno Lexus Blue Lot (blue lot-west pass required), in the The Bulldog Stadium press box is located on the west side of the stadium above Gunner Andros lot off Ninth Street, or in the Purple Lot located just north of the seating bowl on the second level. The press box opens three hours prior to Bulldog Diamond on the east side of Cedar Avenue. Space is limited and is on a kickoff and remains open three hours after the game. ÀUVWFRPHÀUVWVHUYHGEDVLVIRUHDFKORW7KRVHSODQQLQJWRXVHPHGLDSDUNLQJ should plan accordingly. Complete team and individual statistics by quarter, play-by-play and postgame statistical packages, including quotes and notes, will be provided to each member Parking for practices are designated in the southwest corner of the blue lot, RI WKHZRUNLQJPHGLDRI WKHSUHVVER[$IWHUWKHFRQFOXVLRQRI WKHJDPHÀQDO nearest Valley Growers Practice Field. statistics will be delivered to the Duncan Building interview room as soon as they are available. Bulldog Stadium offers wireless internet connectivity on gameday. Please check with the media relations staff to acquire the necessary username and passwords for access. POSTGAME INTERVIEWS AT BULLDOG STADIUM Head coach Jeff Tedford and select players will be available in the Josephine Theater of the Duncan Building for a postgame media conference. No LQWHUYLHZV ZLOO WDNH SODFH RQ WKH ÀHOG XQOHVV SHUPLWWHG E\ WKH )UHVQR 6WDWH Athletic Communications staff. The opposing head coach and select players may be interviewed outside the visitor’s team locker room, located on the west side of the Duncan Building. Postgame quotes from both teams will be made available WRWKHZRUNLQJPHGLDDIWHUWKHJDPHDQGZLOOEHSRVWHGRQ)UHVQR6WDWH·VRIÀFLDO website, GoBulldogs.com. The Fresno State locker and training rooms are closed to the media. JEFF TEDFORD’S WEEKLY MEDIA CONFERENCE Jeff Tedford’s weekly media conference will be held at 11 a.m. in the Josephine Theater of the Duncan Building on Monday’s during the football season. A select player will be brought in to the weekly press conference. The conference is open to all credentialed media members. The media conference can be viewed live or on an archive via the Mountain West Network, located at gobulldogs.com/videos or livestream.com/mwn. PRACTICES The Fresno State football team practices at the Valley Growers Practice Field, located immediately southwest of Bulldog Stadium. Practices are closed to the SXEOLF DQG WR WKH PHGLD ZLWK WKH H[FHSWLRQ RI WKH ÀUVW PLQXWHV 7XHVGD\ through Thursday when only the media is allowed to shoot the team stretch and individual periods. Once those periods end, the media will be asked to leave WEEKLY MEDIA AVAILABILITY SUNDAY MONDAY TUESDAY WEDNESDAY THURSDAY FRIDAY SATURDAY No media Coach Tedford Bulldog of- Bulldog defensive Coach Tedford Coach Tedford Coach Tedford availability. holds an 11 a.m. fensive players/ players/assistant available 15 and offensive and select players press conference assistant coaches coaches are minutes before and defensive will be available available after coordinators are and select player(s) are available after practice. Coach practice and in the media available at that practice. Coach Tedford avail- after. availabe for net- interview room work television time. Tedford available able 15 minutes postgame. The before practice only. There is no 15 minutes before and after. No player/assistant player availability. Bulldogs’ locker No practice-player practice and after. coaches availability. room is closed to off day. the media. 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 171 ADMINISTRATION Joseph I. Castro Jim Bartko Fresno State President Director of Athletics Joseph I. Castro was appointed as the eighth president of California State University, Jim Bartko, 51, was announced as the new Bulldog Director of Athletics by Fresno )UHVQRLQ+HLVWKHÀUVW&HQWUDO9DOOH\QDWLYHWRVHUYHLQWKLVOHDGHUVKLSSRVLWLRQ State President Joseph I. Castro at a press conference on Nov. 21, 2014 and he took Dr. Castro is also Professor of Educational Leadership in the Kremen School of RIÀFHRQ-DQ Education and Human Development. Bartko, a Central Valley native, served as the executive senior associate athletic director Prior to his appointment at Fresno State, he served as Vice Chancellor, Student at the University of Oregon prior to coming home to the Valley. Now, two-and-a-half Academic Affairs, and Professor of Family and Community Medicine at the University years guiding the Fresno State Athletics Department, the Bulldogs have taken off in of California, San Francisco (UCSF) from 2006-13. Earlier in his career, he held faculty UDLVLQJWKHLUDWKOHWLFSURÀOHDORQJVLGHDFDGHPLFVRQFDPSXVXQGHU&DVWUR·V8QLYHUVLW\ and/or administrative leadership positions at four other University of California mission of having athletics and academics rise together. campuses -- Berkeley, Davis, Merced, and Santa Barbara. While at Oregon, Bartko served on the Athletics Executive Committee and was He received a B.A. in political science and M.P.P. in public policy from the University of responsible for the planning, development and oversight of the day-to-day operations California, Berkeley and Ph.D. in higher education policy and leadership from Stanford of the athletics department. He managed all development efforts, ticket operations, University. major gifts and group sales. In 2016, Dr. Castro received the Alumni Excellence in Education from Standford Bartko started his career in 1989 as a regional director and fundraiser for the Duck University Graduate School of Education and the Ohtli Medal, which is the highest Athletic Fund at the University of Oregon and advanced into assistant and associate honor granted by the Government of Mexico to Mexican-American leaders in the athletic director roles. In 2006-07, he moved to the University of California, Berkeley, United States. He was selected as the 2014 Alumnus of the Year by the University of where he was senior associate athletic director for development. California, Berkeley Richard and Rhoda Goldman School of Public Policy. Dr. Castro is also the recipient of the 2010 Martin Luther King, Jr. Award at UCSF and the 2010 He returned to Oregon as senior associate athletic director and in 2008 was advanced University of California Student Association’s Administrator of the Year Award. to executive senior athletic director. Dr. Castro is the grandson of farmworkers from Mexico. He was born and raised in Born in Stockton, he attended schools there and in Pinole and graduated from Central +DQIRUG&$DQGLVWKHÀUVWSHUVRQLQKLVIDPLO\WRJUDGXDWHIURPDXQLYHUVLW\+HDQG Catholic High School in Modesto. He holds a bachelor’s degree in sports administration his wife, Mary, have three children, Isaac, Lauren and Jess. with a minor in business administration from Washington State University in Pullman. Bartko and his wife, Eileen, have two children, A.J., 20, and Danielle, 14. ATHLETICS ADMINISTRATION Steve Robertello Franklin Alegria Carrie Coll Terry Donovan Paul Ladwig John Kriebs Deputy Director Sr. Associate AD for Sr. Associate AD for Sr. Associate AD for Sr. Associate AD for Associate AD for of Athletics External Development Sport Services/SWA Business Operations External Relations Internal Operations Matt Studwell Kelli Eberlein David Hall Megan O’Quin Anessa Leydig Assistant AD of Assistant AD of Assistant AD for Assistant AD of Administrative Assistant Operations Sports Medicine Compliance Student-Athlete Services for Jim Bartko 172 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE MOUNTAIN WEST MOUNTAIN WEST THIS IS THE MOUNTAIN WEST Bogut, respectively in 2005). With UNLV’s From its inception in 1999, the Mountain West Anthony Bennett claiming the No. 1 pick in the has been committed to excellence in intercollegiate 2013 NBA Draft, the Mountain West is one of athletics, while promoting the academic missions of three conferences to have multiple No. 1 NBA its member institutions. Progressive in its approach, draft selections since 2000. Also, with San Diego the MW continues to cultivate opportunities State’s Stephen Strasburg earning the No. 1 pick in for student-athletes to compete at the highest the 2009 MLB Draft, the Mountain West is one of level, while fostering academic achievement and two conferences to have the No. 1 selection in each The Mountain West sent three women’s volleyball sportsmanship. Now in its 19th year, the MW has of the NFL, NBA and MLB drafts since the MW WHDPVWRWKH1&$$7RXUQDPHQWIRUWKHÀUVWWLPH been assertive in its involvement with the NCAA was founded in 1999. since 2009. MW champion Boise State claimed governance structure and has taken a leadership the league’s automatic bid, while Colorado State role in the overall administration of intercollegiate The Mountain West is noted for its geographic and UNLV joined the Broncos in the postseason athletics. diversity. Some of the most beautiful terrain and as at-large selections. Both Boise State and UNLV landscapes in the nation can be found within FDSWXUHGÀUVWURXQGYLFWRULHV The Mountain West has marked several Mountain West boundaries, including the majestic DFKLHYHPHQWVGXULQJLWVÀUVW\HDUVPRVWQRWDEO\ 5RFN\ 0RXQWDLQ UDQJH ZKLFK ERUGHUV ÀYH 0: )RUWKHÀUVWWLPHVLQFHDQGWKHWKLUGWLPHLQ EHFRPLQJWKHÀUVWWRHVWDEOLVKDVSRUWVWHOHYLVLRQ institutions (Air Force, Boise State, Colorado State, program history, UNLV captured the Mountain network dedicated solely to an intercollegiate New Mexico and Utah State). The high plains West Women’s Soccer Championship crown. athletic conference (The Mtn.). The Mountain West of Wyoming (elevation 7,220 feet – the highest The title earned the Rebels their fourth NCAA DOVRZDVWKHÀUVWWRH[SHULPHQWZLWKWKHFRDFKHV· Division I campus in the nation) contrast with the Tournament appearance as members of the challenge in the college football instant replay desert cities of Las Vegas and Reno, home to UNLV Conference. V\VWHPDQGZDVWKHÀUVWQRQDXWRPDWLFTXDOLI\LQJ and Nevada, respectively, while Fresno State, San BCS conference to participate in four BCS bowl Diego State and San Jose State add a West coast Five Mountain West cross country student-athletes games, winning three. In the inaugural year of the LQÁXHQFHZLWKWKHLUORFDWLRQVLQ&HQWUDO6RXWKHUQ earned all-American accolades at the NCAA new College Football Playoff system, Boise State and Northern California. The inclusion of the Championships. The New Mexico women, placed earned the automatic slot into a New Year’s Six Hawai‘i football program extends the Mountain in the top-10 in the team standings for the seventh bowl game as the highest-ranked champion from :HVWIRRWSULQWWRWKHEHDXWLIXOLVODQGVLQWKH3DFLÀF consecutive year after placing seventh. The Lobos the Group of Five 5 conferences. The Broncos Ocean, while the addition of the women’s soccer earned their ninth consecutive MW women’s title, defeated then 10th-ranked Arizona 38-30 in the program at Colorado College gives the MW an while Boise State claimed the men’s crown for the VIZIO Fiesta Bowl. In 2011-12, the Mountain additional presence in the Rocky Mountains. ÀUVWWLPHLQSURJUDPKLVWRU\ :HVWZDVDPRQJWKHÀUVWFRQIHUHQFHVWRLPSOHPHQW a league-wide state-of-the-art basketball instant 2016-17 IN REVIEW Colorado State’s Mostafa Hassan (Shot Put) and replay system. From the gridiron to the diamond, Mountain West Josh Kerr (Mile Run) of New Mexico became teams enjoyed a strong year in 2016-17. In football, WKH ÀUVW 0RXQWDLQ :HVW PDOH VWXGHQWDWKOHWHV Changes in the NCAA governance structure set the fourth annual MW Football Championship to win individual national titles at the NCAA WKH WDEOH IRU DQRWKHU &RQIHUHQFH ÀUVW ZKHQ WZR game took place on December 3, 2016 at War Championships since the Lobos’ Kendall Spencer members of the MW Student-Athlete Advisory Memorial Stadium in Laramie, Wyoming. The captured the Long Jump crown in 2012. A total of Committee (SAAC) were included in the June Cowboys, champions of the Mountain Division, 23 MW student-athletes were named USTFCCCA 2014 meeting of the Mountain West Board of hosted two-time defending West Division All-Americans, including six individuals who 'LUHFWRUV 1HZ 0H[LFR WUDFN DQG ÀHOG DWKOHWH champion San Diego State with the Aztecs claiming JDUQHUHG ÀUVWWHDP DFFRODGHV $W WKH &RQIHUHQFH Kendall Spencer, the national chair of the 2014- their second-consecutive Conference title, 27-24. Championship meet, Colorado State swept both 15 NCAA Division I Student-Athlete Advisory the men’s and the women’s titles. Committee, and Air Force Academy volleyball For the fourth straight season, the Mountain West player Emma Dridge joined the BOD members sent seven or more teams into postseason bowl New Mexico’s Josh Kerr won gold in the in this historic meeting to advance the discussion games. The league has earned 84 bowl bids since 1,500-Meter Run and Allie Ostrander of Boise on student-athlete involvement in the NCAA and 1999 and holds a 46-38 (.548) all-time record. The State captured the 3,000-Meter Steeplechase title at MW governance structure. During the last three 2016 bowl season marked the 10th consecutive year the NCAA Outdoor Track & Field Championships. academic years, MW student-athletes participated WKH0:VHQWDWOHDVWÀYHWHDPVWRERZOVDQGWKH Kerr and Ostrander were two of 49 Mountain on monthly membership calls and have joined MW 13th time overall since the league’s inception. West student-athletes who earned USTFCCCA administrators in the annual Joint Council Spring All-America accolades. At the MW Outdoor T&F Meetings in Arizona. Nevada captured the Mountain West regular-season Championships, Air Force claimed the men’s title DQG WRXUQDPHQW WLWOHV EHFRPLQJ WKH ÀUVW PHQ·V for the second-straight year, while the San Diego The Mountain West is well-represented within basketball program to win both championships State women captured their fourth league crown in the new NCAA governance structure, including in the same season since New Mexico in 2013. program history. individuals who were appointed to serve on The Wolf Pack earned the league’s lone bid to the committees tasked with managing the day-to-day NCAA Tournament. Colorado State, Boise State Seven MW student-athletes earned all-America business of Division I athletics. Colorado State and Fresno State each participated in the National honors at the 2017 NCAA Women’s Swimming & President Tony Frank currently sits on the DI Invitational Tournament (NIT), while Wyoming Diving Championships, including Sharae Zheng of Board of Directors, while MW Commissioner became the second MW team in as many seasons to Nevada who garnered a pair all-America accolades. Craig Thompson and Fresno State Faculty Athletics win the College Basketball Invitational (CBI). Boise State captured the Mountain West Swimming Representative Dawn Lewis are members of the & Diving title for the third time, while Air Force’s DI Council. Kendall Spencer, the former chair of In women’s basketball, Boise State claimed its *HQHYLHYH 0LOOHU EHFDPH WKH ÀUVW VZLPPHU LQ the DI Student-Athlete Advisory Committee and second Mountain West Tournament title in program league history to win four titles in two different 810WUDFN ÀHOGDWKOHWHZDVWKHÀUVWVWXGHQW history to secure the league’s automatic bid to the events at the Conference championship. athlete in the history of the organization to serve NCAA postseason. MW regular-season champion on the Division I Board. Colorado State was the Conference’s automatic 8WDK 6WDWH PHQ·V WHQQLV ZRQ WKH ÀUVW 0RXQWDLQ TXDOLÀHU LQWR WKH :RPHQ·V 1DWLRQDO ,QYLWDWLRQDO West tournament title in any sport for the Aggies $GGLWLRQDOO\ WKH 0RXQWDLQ :HVW ZDV WKH ÀUVW Tournament (WNIT), where it was joined by since joining the league prior to the 2013-14 season. conference to have a member institution with No. UNLV and Wyoming. Utah State participated in the Utah State earned the Conference’s automatic berth 1 overall picks in both the NFL and NBA drafts Women’s Basketball Invitational (WBI). into the NCAA Tournament. On the women’s side, in the same year (Utah’s Alex Smith and Andrew 6DQ-RVp6WDWHZRQLWVÀUVW0:WLWOHDQGDGYDQFHG 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 173 MOUNTAIN WEST related to the student-athlete experience. Since the inclusion of two SAAC members at the June 2014 meeting of the MW Board of Directors, the Conference maintains its commitment to the participation of student-athletes in its governance structure, which is consistent with the Mountain West’s focus on enhancing the student-athlete experience. ACHIEVEMENT The MW has produced 1,059 All-America selections among its 18 sponsored sports (men’s swimming was discontinued as a Conference sport following the 2010-11 season) in the last 18 years, including a league-record 103 All-America honorees in 2016-17. A total of 190 MW student- athletes have also earned Academic All-America accolades in that span. The Mountain West has sent at least 25 teams to NCAA postseason events in each of the past 18 years, capturing four team national championships in women’s cross country and producing 43 individual national champions in the sports of men’s golf, men’s cross country, women’s diving, and men’s and women’s indoor WUDFN ÀHOGDQGRXWGRRUWUDFN ÀHOG Mountain West members have participated in 84 bowl games under the league umbrella, including four appearances in BCS games and one CFP game. The MW has earned 80 postseason bids in PHQ·VEDVNHWEDOO ZLWK ÀYH 6ZHHW DSSHDUDQFHV among 44 NCAA Tournament slots, as well as three NIT Final Four berths. MW women’s basketball has tallied 75 postseason slots, including 1&$$ELGVÀYH6ZHHWDSSHDUDQFHVDQGRQH to the NCAA postseason for the second time honors, while a total of 25 players were selected Elite Eight berth since 2000. Wyoming won the in program history. In individual competition, in the Major League Baseball draft. New Mexico’s 0:·VÀUVW:1,7FKDPSLRQVKLSLQZLWKDZLQ UNLV’s Carol Zi Yang earned a bid to the NCAA /XLV *RQ]DOH] ZDV WKH ÀUVW 0: SOD\HU RII WKH over Wisconsin. In women’s volleyball, the MW Singles Championship. ERDUGDVWKHFHQWHUÀHOGHUZDVWDNHQLQWKHWKLUG has had 42 NCAA bids with nine Sweet 16 berths round with the 87th overall pick by the Chicago and one Elite Eight appearance. Women’s soccer For the second year in a row, UNLV swept White Sox. has earned 31 NCAA bids since 1999, with two the Mountain West men’s and women’s golf Sweet 16 berths and one Elite Eight appearance. championships. The league sent three men’s teams ACADEMIC CONSORTIUM Mountain West men’s golf has sent at least three and four individuals to the NCAA regionals. It was From the outset, Mountain West member teams to the NCAA Men’s Golf Regionals in each the 18th consecutive season the MW sent at least institutions have been committed to creating of its 18 years, while women’s golf has had at least three teams to NCAA regionals, while the four strong academic relationships, as well as athletic three teams participate in NCAA Regionals 15 of individuals are the most in Conference history. competition. To that end, the chief academic the last 18 years. No. 17-ranked UNLV won the West Lafayette RIÀFHUVRI HDFKLQVWLWXWLRQKDYHH[SORUHGDFDGHPLF Regional and advanced to the NCAA Men’s exchange programs, library crossovers and SPORTSMANSHIP Golf Championship, where it was joined by New shared research. In addition, the faculty athletics Named a Sports Ethics Fellow by the Institute Mexico. The Rebels tied for seventh in the stroke representatives routinely provide academic for International Sport in 1998, Commissioner play event to advance to the match play round, assistance and test-taking services for student- Thompson has been a driving force for before falling to top seed Vanderbilt, 3-2. athletes visiting from fellow member institutions sportsmanship within intercollegiate athletics. As for competition. part of its continuing growth and development, On the women’s side, the MW was represented the Mountain West implemented an extensive by three teams and two individuals in the NCAA OPPORTUNITY Sportsmanship Initiative, endorsed by both the regionals. The league has sent multiple teams to 7KH0RXQWDLQ:HVWSURYLGHVDÀUVWFODVVDWKOHWLF MW Joint Council and MW Board of Directors. the NCAA Women’s Golf Regionals in 17 of its and academic experience for more than 5,100 The program is made up of several elements, which 18 years. It is the 13th time in 14 seasons in which student-athletes each year. Over the past 18 years, are both practical and philosophical in nature. the Conference has sent at least three teams to the 42 Mountain West student-athletes have earned :KLOHWKH0:KDVVLJQLÀFDQWSHQDOWLHVLQSODFHWR postseason. NCAA Postgraduate Scholarships, and since deal with violations, the Sportsmanship Initiative the league’s inception in 1999, an additional 36 is primarily promotional and educational in nature. 6DQ-RVp6WDWHZRQLWVÀUVW0:VRIWEDOOWLWOHDQG student-athletes have been named MW Scholar- The goal is to develop an environment that garnered the Conference’s automatic bid to the Athlete of the Year and awarded league-sponsored fosters appropriate behavior from all Conference NCAA Tournament. Fresno State joined the postgraduate scholarships. Four Mountain West constituencies. Spartans in the NCAA postseason after earning student-athletes have earned distinction as an at-large berth. In addition to the two NCAA Rhodes Scholars (Jessica Mellinger, Wyoming, and Mountain West Quick Facts bids, the Mountain West landed three squads in Delavane Diaz, Brittany Morreale and Rebecca Founded: July 1, 1999 the National Invitational Softball Championships Esselstein, Air Force). Members for the 2017-18 academic year: Air (NISC). Utah State earned an automatic berth into Force, Boise State, Colorado State, Colorado WKH WHDP ÀHOG ZKLOH %RLVH 6WDWH DQG 1HYDGD Conference student-athletes are also given a College (women’s soccer only), Fresno State, garnered at-large selections. MW Player of the voice regarding pertinent issues within the Hawai‘i (football only), Nevada, New Mexico, Year Jenavee Peres of San Diego State was named MW and NCAA governance structure through San Diego State, San José State, UNLV, Utah a second-team all-American by the National representation on the Student-Athlete Advisory State, Wyoming. Fastpitch Coaches Association (NFCA). Committee (SAAC). The Mountain West SAAC Team NCAA Championships: 4 is comprised of 24 members (22 student-athlete Individual NCAA Championships: 43 San Diego State earned the Mountain West’s representatives, the MW representative to the NCAA Postgraduate Scholarship Winners: automatic bid to the NCAA Baseball Tournament Division I National SAAC and one faculty athletics 42 after capturing the 2017 MW Championship title. representative). The committee reviews and reacts Academic All-America Selections: 190 New Mexico won the league’s regular-season to legislation and to other topics referred by the All-America Selections: 1,059 crown. Six student-athletes garnered all-America Conference constituent groups or committees 174 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE MOUNTAIN WEST MOUNTAIN WEST COMMISSIONER CRAIG THOMPSON &UDLJ7KRPSVRQZDVWKH0RXQWDLQ:HVW&RQIHUHQFH·VÀUVWHPSOR\HHZKHQ Executive Committee and the Director’s Cup Committee of the National he was named Commissioner on Oct. 15, 1998. Ever since, Thompson Association of Collegiate Directors of Athletics (NACDA), as well as the has navigated the Conference through the ever-changing landscape of governing NCAA Council and various Council subcommittees. In addition, he intercollegiate athletics. As the league enters its 19th season of competition has played a prominent role in hosting numerous men’s and women’s NCAA in 2017-18, Thompson continues to create and improve the opportunities postseason basketball tournaments in St. Louis, Atlanta, New Orleans and for Mountain West institutions and student-athletes to be successful both Denver. academically and athletically. Prior to his current role, Thompson served as the commissioner of the Since the Mountain West opened its doors on January 4, 1999, Thompson Sun Belt Conference for nearly eight years and as the only commissioner of has been committed to excellence in intercollegiate athletics, while promoting the American South Conference prior to the merger of the two leagues in the academic missions of its member institutions. Progressive in its approach, 1991. WKH0:KDVÁRXULVKHGXQGHUWKHJXLGDQFHRI &RPPLVVLRQHU7KRPSVRQDQG continues to cultivate opportunities for student-athletes to compete at the While at the Sun Belt Conference, he spent the majority of his time addressing highest level, while fostering academic achievement and sportsmanship. He national trends and challenges in intercollegiate athletics, television exposure, has been instrumental in negotiating nearly $300 million in television revenue issues relating to conference membership and promoting corporate involvement. and has been an innovator in the postseason bowl structure as MW teams have In 1997-98, the Sun Belt instituted a comprehensive sportsmanship policy, participated in six inaugural bowl games. which earned Thompson designation as a 1998 Sports Ethics Fellow by the Institute for International Sport. Under Thompson’s leadership, the Sun Belt As conference realignment spread throughout the collegiate landscape, was active in expansion as it continued to strengthen its posture nationally, Thompson positioned the Mountain West for the future with the additions adding Florida International University and the University of Denver. of Fresno State and the University of Nevada on July 1, 2012, and San José State University and Utah State University on July 1, 2013. The University of 3ULRUWRLWVPHUJHUZLWKWKH6XQ%HOW7KRPSVRQVHUYHGDVWKHÀUVWDQGRQO\ Hawai‘i also joined the league as a football-only member on July 1, 2012, while commissioner of the American South Conference, which boasted an NCAA Colorado College became a member in women’s soccer on July 1, 2014. QDWLRQDOFKDPSLRQLQZRPHQ·VEDVNHWEDOOGXULQJLWVÀUVW\HDU7KH$PHULFDQ South also gained immediate national cable television exposure on ESPN and Thompson’s leadership and vision have helped the Conference enhance sent numerous teams into NCAA postseason play during the conference’s its television revenue and exposure through revolutionary agreements four-year history. ZLWK &%6 6SRUWV 1HWZRUN DQG (631 EHFRPLQJ WKH ÀUVW PDMRU FROOHJLDWH Preceding his move to commissioner, Thompson served four years as the athletic conference to launch a dedicated sports channel featuring exclusive Director of Communications for the Metro Conference in Atlanta. While programming around its athletic programs, as well as conference news. In the at the Metro, he directed the communications operations and administered summer of 2006, the centerpiece of this historic relationship was realized with conference championship events. Thompson originated the Metro Conference WKHODXQFKRI 7KH0WQ²0RXQWDLQ:HVW6SRUWV1HWZRUN²WKHÀUVWVSRUWV Sportswriters and Broadcasters Association, began a weekly radio program network dedicated to serving a single collegiate athletic conference. The ZLWKRYHUDIÀOLDWHVWDWLRQVDQGRULJLQDWHGDZHHNO\VDWHOOLWHYLGHRSURJUDP 0RXQWDLQ:HVWZDVDOVRRQHRI WKHÀUVWFRQIHUHQFHVWRGHYHORSLWVRZQGLJLWDO involving all Metro institutions. He also took on administrative duties such as network and in collaboration with Stadium, continues to expand and enhance FRRUGLQDWLRQRI RIÀFLDOVVFKHGXOLQJRI WRXUQDPHQWDQGUHJXODUVHDVRQSOD\ WKHOHDJXH·VSURÀOHE\WDNLQJDGYDQWDJHRI WKHODWHVWLQGLJLWDOWHFKQRORJ\YLD and handling of legislative rules interpretations. the Mountain West Network (MWN). As a result, the Mountain West again EURNHQHZJURXQGLQEHFRPLQJWKHÀUVWOHDJXHWREURDGFDVWDIRRWEDOO Thompson graduated from the University of Minnesota with an undergraduate JDPHOLYHRQ7ZLWWHU7KH0:ZDVDOVRWKHÀUVWFRQIHUHQFHWREURDGFDVWDOLYH degree in journalism. Following graduation, he spent two years as assistant EDVNHWEDOOJDPHRQWKHVDPHSODWIRUPDVZHOODVWKHÀUVWWRKDYHDERZOJDPH sports information director at Kansas State University, earning numerous streamed live on Twitter and Facebook. CoSIDA publication awards. He then spent three years as director of public relations and promotions for the NBA’s Kansas City Kings. Thompson has been instrumental in strengthening the position of the Mountain West in the college football landscape - both in the previous Bowl Thompson and his wife, Carla, have a son (Ted) and a daughter (Emma). Championship Series (BCS) format and in the current College Football Playoff (CFP) structure. In 2006, he spearheaded an effort that resulted in better access for the MW and more than doubled the annual BCS revenue on an annual basis for non-automatic-qualifying conferences. The MW has been steadfast in its HIIRUWVWRÀQGDZD\WRPDNHWKHFROOHJLDWHSRVWVHDVRQIRRWEDOOV\VWHPIDLUIRU DOOXQLYHUVLWLHV7KURXJKLWVÀUVW\HDUVRI FRPSHWLWLRQWKH0RXQWDLQ:HVW has participated in 84 bowl games, amassing a 46-38 (.548) all-time record in those contests. A 39-year veteran of athletic administration, Thompson has spent all but eight of those years sitting in a commissioner’s chair, making him one of only two active FBS commissioners with more than 30 years of experience leading a conference. Throughout his career, Thompson has been an integral part of the national landscape in intercollegiate athletics, holding many prestigious NCAA posts. Thompson currently sits on the NCAA Division I Council and CFB Management Committee while also serving as a member of the College )RRWEDOO2IÀFLDWLQJ%RDUGRI 0DQDJHUV//&,Q-XQHKHZDVDSSRLQWHG to the NCAA Division I Men’s Basketball Committee for the second time in KLVFDUHHUIROORZLQJDÀYH\HDUWHUPIURPWKDWFXOPLQDWHGZLWKKLP serving as Chair of the committee from July 1, 1999 to September 1, 2000. Over the tenure of his career, Thompson has also been a member of the 2017 FRESNO STATE FOOTBALL MEDIA GUIDE | 175 MOUNTAIN WEST 2017 MOUNTAIN WEST BOWL SCHEDULE Las Vegas Bowl Gildan Famous Idaho Hawai’i Bowl Nova Home Loans Dec. 16 New Mexico Bowl Potato Bowl Dec. 24 Arizona Bowl 12:30 p.m. PT Dec. 16 Dec. 22 5:30 p.m. PT Dec. 29 ABC 1:30 p.m. PT 1 p.m. PT ESPN 2:30 p.m. PT ------ESPN ESPN ------CBS Sports Network Pac-12 vs. MW ------AAC vs. MW ------C-USA vs. MW MAC vs. MW Sun Belt vs. MW COLLEGE FOOTBALL PLAYOFF EVERY GAME COUNTS The College Football Playoff is a four-team event to determine college football’s national champion on the field, while preserving the significance of college football’s unique regular season where every game counts. THE BEST TEAMS The selection committee ranks the teams based on the members’ evaluation of the teams’ performance on the field, using conference championships won, strength of schedule, head-to-head results, and comparison of results against common opponents to decide among teams that are comparable. TRADITION The New Year’s holiday period belongs to college football, with two semifinal games rotating annually among the Cotton Bowl, Fiesta Bowl, Orange Bowl, Peach Bowl, Rose Bowl and Sugar Bowl. CHAMPIONSHIP MONDAY The two winning teams from the Playoff Semifinals compete for the College Football Playoff National Championship. The national championship game is in a different city each year, always on a Monday night. 176 | 2017 FRESNO STATE FOOTBALL MEDIA GUIDE