Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic KIAA1530 purified MaxPab mouse polyclonal antibody (B01P)

Catalog # : H00057654-B01P 規格 : [ 50 ug ] List All

Specification Application Image

Product Mouse polyclonal antibody raised against a full-length human KIAA1530 Western Blot (Transfected lysate) Description: protein.

Immunogen: KIAA1530 (AAH21930.1, 1 a.a. ~ 260 a.a) full-length human protein.

Sequence: MDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQKLAAERA RAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADIS EMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPR enlarge DDEGRPLDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLG SSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRVVAA MNRMDQKKHEKFSNQFNYALN

Host: Mouse

Reactivity: Human

Quality Control Antibody reactive against mammalian transfected lysate. Testing:

Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Publication Reference 1. Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair. Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura KI, Ogi T.Nat Genet. 2012 Apr 1. doi: 10.1038/ng.2229. [Epub ahead of print]

Applications Western Blot (Transfected lysate)

Page 1 of 2 2020/6/26 Western Blot analysis of KIAA1530 expression in transfected 293T cell line (H00057654- T01) by KIAA1530 MaxPab polyclonal antibody.

Lane 1: KIAA1530 transfected lysate(28.6 KDa). Lane 2: Non-transfected lysate. Protocol Download

Gene Information

Entrez GeneID: 57654

GeneBank BC021930 Accession#:

Protein AAH21930.1 Accession#:

Gene Name: KIAA1530

Gene Alias: MGC117169

Gene KIAA1530 Description:

Gene Ontology: Hyperlink

Other hypothetical protein LOC57654 Designations:

Page 2 of 2 2020/6/26