RGH19 (ARHGAP19) Rabbit Polyclonal Antibody – TA343036

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA343036

RGH19 (ARHGAP19) Rabbit Polyclonal Antibody Product data:

Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-ARHGAP19 antibody: synthetic peptide directed towards the C terminal of human ARHGAP19. Synthetic peptide located within the following region: PTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 56 kDa Gene Name: Rho GTPase activating protein 19 Database Link: NP_116289 Entrez Gene 84986 Human Q14CB8 Background: Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases, which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression. Synonyms: DKFZp313K217; MGC14258; MGC138804; MGC138805 Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Bovine: 91%; Rat: 83%; Mouse

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 RGH19 (ARHGAP19) Rabbit Polyclonal Antibody – TA343036

Product images:

WB Suggested Anti-ARHGAP19 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell ARHGAP19 is supported by BioGPS gene expression data to be expressed in PANC1