★★ PRICES MAY VARY OUTSIDE METROPOLITAN WASHINGTON AREA HIGH 42, LOW 26 WEDNESDAY, JANUARY 20, 2021 washingtontimes.com $1.50 IMMIGRATION SECURITY Biden aims An Inauguration Day like never before to grant Nation’s capital under lockdown citizenship to prevent attack, to illegals COVID-19 spread BY EMILY ZANTOW Sees nation-building THE WASHINGTON TIMES funds as solution Call it Inauguration Day in the Upside Down. BY STEPHEN DINAN Thousands of armed, masked soldiers
THE WASHINGTON TIMES are replacing throngs of cheering spec- tators outside the U.S. Capitol. Twelve- Abolishing Immigration and Customs foot-high fences topped with razor wire Enforcement is a nonstarter and the fate of are towering over areas where viewing the border wall is uncertain, but the Biden stands once stood. Armored person- team does want to grant citizenship rights to nel carriers are being deployed where most illegal immigrants and to pump money buses fi lled with witnesses to history into Latin America as the way to discourage would park. illegal immigration, Alejandro Mayorkas, the The quadrennial event that brought pick to lead the Department of Homeland an estimated $1 billion in revenue to D.C.- Security, told senators Tuesday. area businesses in 2017 now looks to add Appearing for his confi rmation hearing, insult to injury to the pandemic-battered Mr. Mayorkas cast himself as a boundary- regional economy. breaking leader ready to shake up a depart- Between coronavirus lockdowns and ment that has lacked a confi rmed secretary the deadly insurrection at the Capitol on for nearly two years. Jan. 6, the National Mall is closed, indoor He promised an aggressive eff ort to over- dining at restaurants is prohibited and turn Trump policies focused on turning back ASSOCIATED PRESS PHOTOGRAPHS stores are boarded up. Opportunities illegal immigrants at the border and said the WAR ZONE: National Guard troops have been activated in response to an FBI warning of a potential threat at the presidential for an inaugural economic boost have solution lies farther south, where nation- inauguration of Joseph R. Biden. With visitors encouraged to stay away, local businesses are bearing the brunt of the impact. vanished. building in Latin America will try to keep “During more normal times, inau- people from leaving home in the fi rst place. gurations present a tremendous oppor- Those plans will be coupled with the most tunity for businesses, especially those generous amnesty in U.S. history. Illegal im- Even with allies in Congress, Biden in hospitality — restaurants, hotels, migrants who arrived in the U.S. before Jan. catering companies and many others,” 1 will get a chance at citizenship if they meet Jack McDougle, president and CEO of other requirements, Mr. Mayorkas said. lacks mandate for sweeping changes the Greater Washington Board of Trade, “I would be privileged to work with Con- said Tuesday in an email. “Unfortunately, gress to pass immigration reform legisla- BY SETH MCLAUGHLIN these companies are already amongst tion that provides that path and provides a THE WASHINGTON TIMES those struggling the most due to COVID- 19, and heightened security measures this » see ICE | A11 Joseph R. Biden will be sworn in week aren’t helping.” Wednesday as the 46th U.S. presi- Inaugurations typically are multiple- dent, realizing a lifelong White House day tourist attractions that raise hotel dream and taking complete control occupancy rates four to six times more FOREIGN POLICY of Washington political power for his than other major events, according to a Democratic Party. recent study published in Sage Journals. But his ability to enact sweeping The short-term home rental platform changes is constrained by the limited Pompeo blasts reach of executive action and the nar- » see CAPITOL | A12 row majorities in Congress that will ‘genocide’ of force him to appease the various wings of his party and work with Republicans INSIDE reeling from the ugly ending of Presi- Uighurs as part dent Trump’s four-year term. ‘TO HEAL, WE MUST REMEMBER’ President-elect Joseph R. Biden, with wife Mr. Biden, 78, inherits a nation fac- Jill, spoke at a vigil at the Lincoln Memorial refl ecting pool Wednesday evening to Status quo of fi nal moves ing an array of crises — many stem- honor the 400,000 Americans who have died from COVID-19. Story, A7. Trump policies likely to remain ming from the coronavirus — that in Biden administration. BY BILL GERTZ further polarized the nation and ex- A4
THE WASHINGTON TIMES posed deep divisions along economic, ground with Republicans on at least and getting stuff done becomes much political and racial lines. a handful of issues — most immedi- more diffi cult,” said Democratic Party Editorial The U.S. government on Tuesday declared “The hope is that the Biden folks ately the COVID aid package — before Good luck, President Biden. B2 China’s communist government guilty of are going to be able to fi nd common the next campaign cycle takes over » see BIDEN | A12 carrying out a policy of genocide and crimes against humanity for its mass repression cam- paign against Uighur minorities in western China. ENERGY The announcement by Secretary of State Mike Pompeo was part of a string of moves by the Trump administration in its fi nal days Tribal chief hopes to save Keystone XL from Biden in power. The department also announced penalties on international shippers accused BY VALERIE RICHARDSON from the Project,” Mr. Francis said in a of helping Venezuela’s socialist government THE WASHINGTON TIMES Indigenous Canadians rely on project statement. avoid U.S. oil sanctions, and the Treasury Mr. Francis, president of Natural Department targeted a Russian construction Canadian tribes invested in the Key- Reports that Mr. Biden will rip Indigenous peoples. Law Energy, entered into a historic fi rm helping lay the Nord Stream 2 oil pipeline stone XL are pushing back against up the U.S. cross-border permit on “If news of President-elect Biden agreement in September between TC to Germany. President-elect Joseph R. Biden’s re- Day One of his presidency met with potentially pulling Keystone XL’s presi- Energy, the pipeline’s developer, for the The China declaration is likely to have the ported plans to cancel the enormous a staunch rebuke Tuesday from Alvin dential permit is true, I want to fully fi ve-tribe company to become an equity biggest foreign policy impact. pipeline project in what could present Francis, chief of the Nekaneet First express how devastating this would be partner with a $1 billion investment in a delicate political balancing act for the Nation in Saskatchewan, who said to my community and others across » see CHINA | A11 incoming administration. such a move would be devastating to Canada and the U.S. who are benefi ting » see PIPELINE | A9
POLITICS NATION WORLD METRO VOLUME 39, NUMBER 14 Trump tells Americans Wall Street kicks off Expert panel faults About 18% of eligible his movement ‘only strong, recovers most WHO, China for virus residents have received just beginning.’ A4 of last week’s drop. A8 response, failures. A10 COVID-19 vaccine. A14 7702803 87040 INDEX American Scene A9 | Commentary B1 | Comics B6 | Dear Abby A13 | Editorials B2 | Horoscope A13 | Inside the Beltway A2 | Metro A12 | Nation A8 | Politics A4 | Sports B10 | Television A13 | World A10
People with HIV can’t afford
another health crisis. See our ad on page A3 to find out what’s happening. A2 | POLITICS ☆ R WEDNESDAY, JANUARY 20, 2021
HEY, DEMOCRATS: WELCOME TO THE HOT SEAT you, and God bless the United States of America,” Mrs. Trump INSIDE THE concluded. The Democratic Party’s dream has come true. It now controls the White House, the House and the Senate. In reality, this status ANNIVERSARY: EXACTLY 40 YEARS AGO also means the Democrats are now on the hottest hot seat of all BELTWAY — shouldering the burden of campaign promises plus all those BY JENNIFER HARPER “On January 20, 1981, Ronald Wilson Reagan was sworn in as vows to right every wrong, fi x everything and unite everybody. America’s 40th president. It was a historic day in so many ways Even a friendly news media can’t mask the fact that the Demo- — one that seemed to usher in a more hopeful era for America crats now essentially own the nation’s domestic challenges, po- and the American people,” notes the Ronald Reagan Presidential litical problems, security threats, global turmoil, pandemic panics Foundation in a public advisory. and fi nancial concerns. Several news organizations have already “President Reagan showed this nation and the world, over and predicted that incoming President Joseph R. Biden will only get over, that with strong leadership, God’s grace, and the heart and a brief honeymoon — and maybe no honeymoon at all — when will of the American people, great things were still to come,” the he assumes offi ce. organization said, citing Reagan’s inaugural speech that day. So how to how Americans feel about their chosen leadership? “With God’s help, we can and will resolve the problems which The following surveys were all conducted between Jan. 6-14. now confront us,” the new president promised. A CNN poll found that 49% of the respondents have a favorable “Truer words were never spoken,” the organization says. “We opinion of the Democratic Party while 45% have an unfavor- never stop celebrating President Reagan’s legacy as we work to able opinion. An Economist/YouGov poll revealed that only 24% preserve and promote his enduring principles. Celebrate with us, believe Mr. Biden can “bring the country together.” Meanwhile, and feel proud to be an American.” an NBC News poll found the Democratic Party with an approval rating that is 39% positive — and 42% negative. A STUNNING LITTLE REALITY CHECK And that’s not all. ASSOCIATED PRESS “When Joseph Robinette Biden Jr. takes the oath to become Several news organizations have already predicted that incoming “Joe Biden is only 1 percentage point more popular than Presi- the country’s 46th president on Wednesday, he will face an President Joseph R. Biden will only get a brief honeymoon period. dent Trump in the latest NBC News poll,” observes Glenn Reyn- increasingly polarized, pessimistic and pained nation, according olds, founder of InstaPundit. to numbers from the latest national NBC News poll,” wrote Mark He also fl ags a new analysis by The Federalist: Murray, senior political editor for NBC News. Carr wrote. “President Trump is leaving offi ce with a higher approval rating “More than 7 in 10 voters believe the country is on the wrong “It shouldn’t be ending this way, but I and 74 million other and the Republican Party on better footing than after President track, another 7 in 10 think the next four years will remain politi- Americans just want to thank you for all your eff orts on our be- George W. Bush exited the offi ce in 2009, when the younger Bush cally divided, and a majority say they are mainly worried and half over the past four years — actually since you came down the saw historically low ratings. According to RealClearPolitics’ ag- pessimistic about the nation’s future,” he said. escalator at Trump Tower back in the summer of 2015,” Mr. Carr gregate of polls, Trump is moving out of the White House with a said, also citing 40 ways Mr. Trump bettered the nation. nearly 40% approval rating overall. Bush enjoyed just under 30% A SIMPLE ROUND OF APPLAUSE of Americans on his side at this same point in his presidency,” the FAREWELL, MELANIA Federalist said in its review. Two columnists have penned candid tributes to President Trump as he leaves offi ce. Outgoing fi rst lady Melania Trump has off ered a farewell POLL DU JOUR “Despite a level of condemnation by the media that dwarfs video to the America people — closing it with a candid wish of anything to which Richard Nixon, Bill Clinton, Herbert Hoover her own. ⦁ 39% of U.S. adults think social media is “biased in favor of or Ulysses Grant were subjected, Donald Trump ranks as one “The promise of this nation belongs to all of us. Do not lose liberal views”; 72% of Republicans, 39% of independents and 13% of our great presidents,” wrote columnist Dick Morris for the sight of your integrity and values. Use every opportunity to show of Democrats agree. Western Journal. consideration for another person and build good habits into your ⦁ 22% say social media is “not politically biased either way”; 5% “Nixon once said that ‘history is written by liberals,’ so don’t daily lives,” the fi rst lady said. of Republicans, 19% of independents and 40% of Democrats agree. count on any objectivity. But we, Trump’s supporters, need to “Together, as one national family, we can continue to be the ⦁ 9% think social media is biased in favor of conservative views; keep the memory of his record in mind so we can unpack it for light of hope for future generations and carry on America’s 7% of Republicans, 7% of independents and 13% of Democrats agree. the next election,” Mr. Morris advised. legacy of raising our nation to greater heights through our spirit ⦁ 30% are unsure about the bias of social media; 15% of Republi- Howie Carr, a columnist for the Boston Herald, also had a say. of courage, goodness and faith,” she continued. cans, 34% of independents and 35% of Democrats agree.
“Thanks for everything, President Trump. Thanks for the bal- “No words can express the depth of my gratitude for the privi- SOURCE: AN ECONOMIST/YOUGOV POLL OF 1,500 U.S. ADULTS CONDUCTED JAN. 10-12. ance in my 401(k), tax cuts for the middle class and destroying lege of having served as your fi rst lady. To all the people of this ISIS. Thank you, Mr. President, for everything you’ve done,” Mr. country: You will be in my heart forever. Thank you. God bless ⦁ Kindly follow Jennifer Harper on Twitter @HarperBulletin.
ACCOUNTABILITY
POLITICSINSIDEINSIDE Virginia man faces conspiracy WHITE HOUSE charges for role ‘Crossfi re Hurricane’ papers declassifi ed President Trump on his last night in offi ce in Capitol riot ordered the declassifi cation of more documents related to the FBI’s investigation of his campaign BY JEFF MORDOCK in 2016, saying he wants to release the informa- THE WASHINGTON TIMES tion “to the maximum extent possible.” In a memorandum Tuesday, Mr. Trump de- Federal prosecutors on Tuesday fi led the fi rst scribed his personal struggle with FBI offi cials conspiracy charge to arise from the deadly insur- over the materials related to the FBI’s “Crossfi re ASSOCIATED PRESS PHOTOGRAPHS rection at the U.S. Capitol, accusing an apparent Hurricane” probe. He said he has accepted the Rep. Steve Cohen (inset) accused Rep. Lauren Boebert of leading a “large group” through the Capitol member of the far-right Oath Keepers movement FBI’s proposed redactions to certain information. just days before the deadly Jan. 6 riot. Ms. Boebert, Colorado Republican, denied the accusation. of plotting to disrupt the election. “This is my fi nal determination under the Thomas Edward Caldwell, 65, of Virginia, faces declassifi cation review and I have directed the U.S. CAPITOL RIOT conspiracy to commit an off ense, obstruction of Attorney General to implement the redactions Boebert rebukes Democrat for ‘categorically false’ claim about leading a ‘tour’ offi cial proceedings, entering a restricted building, proposed in the FBI’s January 17 submission and violent entry or disorderly conduct. and return to the White House an appropriately Newly elected Republican Rep. Lauren to the FBI or Capitol Police, his spokesperson The conspiracy count raises the stakes from redacted copy,” Mr. Trump said. Boebert blasted Democratic Rep. Steve Cohen’s told CNN. the relatively minor unlawful entry and disorderly He said his order does not extend to materials accusing her of leading a tour through the U.S. Ms. Boebert, Colorado Republican, sent conduct charges that prosecutors have lodged that must be protected according to court orders Capitol just days before the Jan. 6 riot. a letter to Mr. Cohen saying “let me be clear against accused Capitol rioters. or information protected by law. Mr. Cohen said on CNN that he and — All of your claims and implications are Prosecutors say Mr. Caldwell was involved in The probe into alleged ties between Trump Democratic Rep. John Yarmuth of Kentucky categorically false. “planning and coordinating” the breach of the campaign offi cials and Russia developed into spe- witnessed Ms. Boebert leading a “large group” “I have never given a tour of the U.S. Capitol Capitol by a pro-Trump mob, which resulted in at cial counsel Robert Mueller’s nearly three-year- through the Capitol complex days before to any outside group. As I previously stated, least fi ve deaths, including a police offi cer. long probe that ultimately found no such links. Trump supporters violently stormed it. I brought my family to the Capitol on Janu- As the government tells it, Mr. Caldwell orga- — Dave Boyer “We saw Congresswoman Boebert taking ary 2nd for a tour and on the 3rd for pictures nized a group of eight to 10 rioters with paramili- people for a tour sometime after the 3rd and to commemorate the day I was sworn in as a tary equipment who moved in “an organized and 2020 PRESIDENTIAL ELECTION before the 6th,” said Mr. Cohen, Tennessee Member of the U.S. Congress.” practiced fashion” during the riot. Postal Service handled mail-in vote well Democrat. In a separate statement she said that while Those individuals were seen on video wearing “She had a large group with her. Now, Congress has “a duty to elevate the discourse military gear and Oath Keeper paraphernalia. The U.S. Postal Service released a report whether these people were people that were and unify during times of crisis … Rep. Cohen According to the FBI affi davit fi led in federal Tuesday detailing its successes in delivering mail involved in the insurrection or not, I do not instead chose to go on CNN today to repeat court, Mr. Caldwell also boasted of his role in the ballots during the 2020 election and the Georgia know,” he said. irresponsible lies.” assault, posing a Facebook message on Jan. 6 say- Senate runoff s, saying the average time to get bal- Mr. Cohen has not reported that observation — Jessica Chasmar ing, “I’m such an instigator!” lots to voters was about two days, and even faster Investigators said in court documents that Mr. in getting fi lled-out ballots to election offi cials. Caldwell “appears to have a leadership role” with All told, at least 135 million ballots were identi- POLLS WHITE HOUSE the Oath Keepers, a far-right, loosely organized fi ed and delivered to or from voters for the Nov. 3 Trump leaves as lowest polling president Trump gives commendations to virus team militia. Oath Keepers believe the federal govern- election alone, the post offi ce said. ment has been overtaken by a shadow conspiracy. “Postal employees rose to the occasion, served President Trump leaves offi ce after establishing President Trump awarded presidential com- The FBI said they concluded Mr. Caldwell was the American people with pride and distinction a new low in presidential job approval average. mendations to about 50 members of his COVID an Oath Keeper based on his communications … consistent with the organization’s non-partisan Mr. Trump scored a 34% approval rating on team Tuesday, including Dr. Anthony Fauci, Dr. with “other known and unknown Oath Keepers public service mission,” the service said. his fi nal report card from voters, according to Deborah Birx and key members of the military. members.” In the months leading up to the election Gallup — leaving his four-year average at 41%. Mr. Trump considers the rapid approval of Those communications include a Facebook critics of the Trump administration said they That average “is four points lower than for vaccines from Pfi zer and Moderna to be a key message telling one alleged member, Army vet- feared the post offi ce was attempting to disrupt any of his predecessors in Gallup’s polling era,” part of his legacy as he leaves offi ce. eran Jessica Watkins of Ohio, that they secured mail-in voting even as states rushed to embrace the public opinion pollster said. “Trump’s ratings “They said it couldn’t be done, but we did it. hotels at a “good location” that “would allow us the option during the pandemic. The new report showed a record 81-percentage-point average gap They called it a medical miracle,” he said. to hunt at night if we wanted to,” court documents fl atly rejects those claims and points to the fi nal between Republicans and Democrats — 11 points Dr. Fauci and Dr. Birx were often at Mr. revealed. delivery times as proof. wider than the prior record.” Trump’s side in press conferences on the virus, The message continued with a reference to Oath That includes 99.89% of ballots the post offi ce Former Presidents John F. Kennedy, 70.1%, though he publicly broke with them at times. Keepers founder Stewart Rhodes, the FBI wrote identifi ed during election season that were deliv- Dwight Eisenhower, 65%, and George H.W. Bush, He also awarded commendations to Army in the affi davit. ered within seven days, and “the overwhelming 60.9%, had the highest average approval ratings. Gen. Gustave Perna, who is handling logistics for “I don’t know if Stewie has even gotten out majority of ballots were delivered in far less time Former Presidents Jimmy Carter, 45.5%, and “Operation Warp Speed,” and his science adviser, his call to arms, but it’s a little friggin late,” Mr. than that,” the post offi ce said in the new report. Harry Truman, 45.4% had the poorest averages. Moncef Slaoui. Caldwell allegedly wrote. “This is one we are doing — Stephen Dinan — Seth McLaughlin — Tom Howell Jr. on our own.”
Th e Washington Times (ISSN 0732-8494) is published Monday through Friday. MALLARD FILLMORE / Bruce Tinsley © 2021 by Th e Washington Times, LLC, 3600 New York Ave., N.E., Washington, D.C., 20002 GENERAL AND NEWS SUBSCRIPTION RATES from NewsBank, 800/762-8182. Individual 202/636-3000 Home Delivery: $260/year. articles are available online from Nexis ADVERTISING Digital edition: $99.95/year. (www.nexis.com), Advocacy and Political: 202/636-3062 Single copy: $1.50 Monday–Friday. 800/543-6862; Dialog (www.dialog.com), Classifi ed: 202/636-4728 National Weekly: $109.95 for 1 year/ 800/334-2564; and Dow Jones Factiva Digital: 202/636-2906 52 issues via mail to all 50 states and the (www.factiva.com), 800/223-2274. Legal Notices: 202/636-3102 District of Columbia. For more information about subscription Th e visually impaired may hear news National: 202/636-3062 articles read over the telephone through Retail: 202/636-3062 promotions and services, visit washingtontimes.com/subscribe. the National Federation for the Blind NEWS- CIRCULATION DEPARTMENT LINE service (www.nfb.org), 410/659-9314 Each edition of Th e Washington Times 202/636-3333 or 800/277-8500 ext. 2317. To receive a replacement paper call is available in electronic format through Subscriber Services at 202/636-3333 washingtontimes.com; in microform from Th e Washington Times Internet edition is by 9:30 a.m. Monday-Friday. Proquest, 800/521-0600; and on CD-ROM available at www.washingtontimes.com. WEDNESDAY, JANUARY 20, 2021 ☆ R NATION | A3
We already have one public health crisis. This new Trump rule will create another.
In the midst of a global pandemic, there’s another public health crisis looming for people like me: Drastic increases in out-of-pocket costs for HIV medicines. A new Trump administration rule could take the copay assistance I need to afford the medicine that keeps my HIV in check
Please, help me fight this rule. Call The White House and demand they leave copay assistance alone.
theaidsinstitute.org/action A4 | POLITICS ☆ R WEDNESDAY, JANUARY 20, 2021
“Th e mob was fed lies. Th ey were provoked by the president and other powerful people.” Politics — Senate Majority Leader Mitch McConnell, Kentucky Republican, on the Capitol riots
WHITE HOUSE Trump to Americans: Movement ‘only just beginning’ Farewell address denounces deadly violence at Capitol
BY DAVE BOYER red-carpet sendoff Wednesday
THE WASHINGTON TIMES morning at Joint Base Andrews in Maryland, where he will board President Trump told Ameri- Air Force One for the last time. cans in his farewell address on The ceremony will feature a mili- Tuesday that his political move- tary band and a crowd of well- ment “is only just beginning,” wishers, before Mr. Trump fl ies and he said the nation is pray- to his Mar-a-Lago club in Palm ing for the success of the Biden Beach, Florida. administration. Vice President Mike Pence Facing a second impeach- is not expected to attend the ment trial within days after he ceremony, opting instead to wit- leaves offi ce, Mr. Trump again de- ness Mr. Biden’s inauguration at nounced the violence by his sup- the Capitol. Mr. Trump will be porters at the Capitol on Jan. 6. the fi rst president since Andrew In a recorded video address, Johnson in 1869 not to attend his Mr. Trump said of his four years successor’s inauguration. in offi ce, “We did what we came His 20-minute address came here to do — and so much more. out the same day that the U.S. “Above all, we have reasserted reached a grim milestone, pass- the sacred idea that in America, ing 400,000 deaths from the the government answers to the COVID-19 pandemic. ASSOCIATED PRESS people,” Mr. Trump said. “We “We grieve for every life loss, President Trump recorded a 20-minute address biding Americans farewell on Tuesday. He will not appear at the president-elect’s inauguration. restored the idea that in America, and we pledge in their memory to no one is forgotten — because wipe out this horrible pandemic everyone matters and everyone once and for all,” Mr. Trump said. supporters stormed the Capitol. last week impeached Mr. Trump rigid orthodoxies and punitive that loses faith in its own values, has a voice. The public health crisis and They tried to hunt down lawmak- for the second time in a bipartisan speech codes. America is not a history, and heroes — for these “Now, as I prepare to hand related economic turmoil con- ers and Mr. Pence. vote that held him responsible for timid nation of tame souls who are the very sources of our unity power over to a new administra- tributed heavily to Mr. Trump’s The president addressed the inciting the attack. The Senate need to be sheltered and pro- and our vitality,” he said. tion ... I want you to know that the defeat at the polls. Still, the presi- deadly Jan. 6 insurrection at the is expected to put Mr. Trump on tected from those with whom we He said his administration movement we started is only just dent said his policies enabled the Capitol, which Senate Major- trial, possibly within days, al- disagree. That’s not who we are.” “built the greatest economy in beginning.” U.S. economy to recover quicker ity Leader Mitch McConnell on though he will have left offi ce by In his farewell, Mr. Trump the history of the world.” Mr. Trump’s presidency will than other nations. Tuesday blamed Mr. Trump for then. A conviction by two-thirds said he “took on the tough bat- “We revitalized our alliances end at noon Wednesday, when “The whole world suff ered, provoking. of senators would bar Mr. Trump tles, the hardest fi ghts, the most and rallied the nations of the President-elect Joseph R. Biden but America outperformed other “All Americans were horrifi ed from running for offi ce again. diffi cult choices — because that’s world to stand up to China like takes the oath of office. Mr. countries economically because by the assault on our Capitol,” Mr. Trump has been banned what you elected me to do.” He never before,” Mr. Trump said. Trump has discussed with ad- of our incredible economy and Mr. Trump said. “Political vio- by numerous social media plat- talked about securing the U.S. “As a result of our bold diplo- visers the possibility of running the economy that we built,” he lence is an attack on everything forms since the riot. In his video, borders from illegal immigra- macy and principled realism, again in 2024, although he has said. we cherish as Americans. It can he said America depends on “a tion and drug traffi cking, and we achieved a series of historic acknowledged that he would be Mr. Pence ran a coronavirus never be tolerated. Now more robust belief in free expression, of deploying his “America First” peace deals in the Middle East. It 78 years old — the same age that task force meeting at the White than ever, we must unify around free speech and open debate,” agenda on the world stage. is the dawn of a new Middle East Mr. Biden is now. House on Tuesday and was seen our shared values and rise above and warned of the consequences “We restored American and we are bringing our soldiers Despite his plans to boycott chatting outside with a group of the partisan rancor, and forge our of censorship. strength at home and American home. I am especially proud to Mr. Biden’s inauguration after White House Fellows, who ap- common destiny.” “Only if we forget who leadership abroad,” Mr. Trump be the fi rst president in decades the bitterly contested election, plauded him when he fi nished The mob attacked the Capitol we are, and how we got here, said. “The world respects us who has started no new wars.” Mr. Trump said, “This week, we speaking. after Mr. Trump exhorted a mas- could we ever allow political again. Please don’t lose that He predicted that his great- inaugurate a new administration The vice president and Mr. sive rally of his followers on the censorship and blacklisting to respect.” est legacy will be: “We put the and pray for its success in keep- Trump have had a strained re- National Mall to stop lawmak- take place in America,” he said. Mr. Trump said the biggest American people back in charge ing America safe and prosperous. lationship since the president ers from counting the election “Shutting down free and open danger facing America “is a loss of our country. We restored self- We extend our best wishes, and accused Mr. Pence of lacking results. The president has said debate violates our core values of confi dence in ourselves — a government. We restored the we also want them to have luck “courage” to stop Congress from his remarks at the rally were and most enduring traditions. loss of confi dence in our national idea that in America no one is — a very important word.” certifying the Electoral Col- “appropriate.” In America, we don’t insist on greatness.” forgotten, because everyone mat- Mr. Trump will receive a lege results as a mob of Trump But the House disagreed and absolute conformity or enforce “No nation can long thrive ters and everyone has a voice.”
WHITE HOUSE Some Trump policies likely to remain in Biden administration
BY DAVID SHERFINSKI “A Biden-Harris administration will build on these steps, Mr. Stoltenberg said that since 2016, Canada and European al-
THE WASHINGTON TIMES challenge other nations to keep pace, and work to leverage these lies have added $130 billion more to their defense budgets, a fi gure growing ties into progress toward a two-state solution and a more that is expected to increase to $400 billion by 2024. President-elect Joseph R. Biden wants to immediately reverse stable, peaceful region,” he said. Mr. Trump publicly urged countries to step up their spending, much of what President Trump has done over the last four years Antony Blinken, Mr. Biden’s pick for secretary of state, said a goal Mr. Biden won’t rush to roll back. — but that is often easier said than done, and he has begrudgingly Tuesday that the incoming administration wants to take a look Mr. Blinken said Tuesday that it’s certainly a good thing that applauded some of Mr. Trump’s legacy. at some of the commitments that might have been made in the NATO allies are investing more. Several of Mr. Trump’s policies, achievements and personnel context of the agreements. “For Biden coming in, it’s like OK, number one, to NATO and decisions are likely to stand, because politics, logistics or fi nances “But the work that was done to push forward on the normaliza- to the allies: burden-sharing is as important to us — either me as make it too painful for Mr. Biden to change course. Or because he tion with Israel I applaud. It makes Israel safer. It makes the region the leader or the Democrats — it’s just as important to us as it is agrees with the policy. safer,” Mr. Blinken told members of the Senate Foreign Relations to the Republicans and to Trump,” said Jim Townsend, a deputy Here are some of those policies: Committee at his confi rmation hearing. assistant secretary of defense for European and NATO policy during the Obama administration. Moving U.S. embassy in Israel to Jerusalem Rewrite of NAFTA The momentum got kick-started after Russia’s encroachment Mr. Trump enthralled pro-Israel advocates around the world Mr. Biden said he won’t immediately roll back some of Mr. into Crimea, but Mr. Trump put the squeeze on countries with his when he followed through on his pledge to move the U.S. Embassy Trump’s initiatives on trade. He even acknowledged that the public chastising, he said. in Israel from Tel Aviv to Jerusalem. president’s rewrite of the North American Free Trade Agreement “He used a hammer that has never been used,” Mr. Townsend Mr. Trump formally recognized Jerusalem as the country’s (NAFTA) is an improvement on the original version, which Mr. said. “It was a medicine that was very dangerous in the sense that capital in December 2017 and the U.S. Embassy moved in May 2018. Biden supported as a senator. that medicine harmed the patient.” “While previous presidents have made this a major campaign During the campaign, Mr. Biden begrudgingly conceded that promise, they failed to deliver,” Mr. Trump said in December 2017. the new U.S.-Mexico-Canada Agreement (USMCA) is a “better” Banning bump stocks “Today, I am delivering.” deal than NAFTA. Mr. Trump, who has been staunchly pro-gun since taking offi ce, Even as he criticized Mr. Trump’s policies in the Middle East, Mr. Mr. Biden sent a strong signal on how he wants to approach vexed gun-rights advocates in 2018 when he announced he was Biden indicated last year that he would not seek to reverse course. the USMCA with his announcement of Katherine Tai, a congres- directing then-Attorney General Jeff Sessions to fi nd a way to ban “Now that it’s done, I would not move the embassy back to Tel sional trade lawyer, as his choice to be U.S. trade representative. bump stocks, which attach to semiautomatic rifl es to produce a Aviv,” he said at a fundraiser in April. Ms. Tai helped the Democrat-led House secure additional protec- rate of fi re similar to machine guns. Mr. Biden also held out hope for engagement with the Palestin- tions for labor in the revised deal as it made its way through Congress. The new regulation further riled gun advocates because the ians and the prospect of an eventual two-state solution. Richard Trumka, president of the AFL-CIO labor federation, Bureau of Alcohol, Tobacco, Firearms, and Explosives (ATF) pre- Arab leaders strongly condemned Mr. Trump’s move. hailed Ms. Tai’s appointment and said Mr. Biden is thus far living viously concluded that it lacked authority to ban bump stocks, Jewish people long considered Jerusalem to be their true capital up to his word on moving ahead, in line with Mr. Trump’s new concluding that they weren’t technically fi rearms. city, but Palestinians want East Jerusalem to be their capital as part approach on trade. Still, the ban took eff ect in March 2019 despite legal challenges of a two-state solution. “For decades, administrations of both political parties have from pro-gun groups. Mr. Biden said he would reopen a U.S. consulate in East Jeru- enacted harmful trade policies that held down wages and didn’t Congressional Democrats praised the move but said Congress salem to engage the Palestinians. provide for better working conditions by creating incentives to ship needed to back it up with legislation. good-paying jobs overseas,” Mr. Trumka said. “With Tai as the U.S. “If Republicans actually cared about banning bump stocks, they trade representative, we will be strongly positioned to advance a would pass legislation making it crystal clear that the government Reaching historic Abraham Accords fair trade agenda that makes the world safer and workers stronger.” has the authority to ban these devices,” Sen. Chris Murphy, Con- Mr. Trump helped broker peace deals that resulted in the necticut Democrat, said after the Trump administration formally historic normalization of relations between Israel and a growing Demanding bigger NATO payments from allies announced the ban. number of Middle Eastern countries, including the United Arab Even critics of Mr. Trump’s foreign policy endeavors admit Mr. Biden also is weighing how much of his agenda he can Emirates and Bahrain. his public haranguing helped force NATO member countries to pursue via executive action instead of wrestling legislation through The “Abraham Accords,” announced in September, marked the increase their defense spending to hit 2024 target amounts. Congress. fi rst time an Arab country announced normalized relations with “Your leadership on defense spending is having a real impact,” It’s diffi cult to see Mr. Biden, who campaigned for stricter gun Israel since 1994. NATO Secretary General Jens Stoltenberg told Mr. Trump at a controls, acting administratively to loosen fi rearms-related restric- The initial agreement included the UAE and Bahrain. joint press conference in December 2019. “This is unprecedented. tions unless Congress were prepared to immediately step in and Other countries such as Sudan and Morocco have since signed This is making NATO stronger. And it shows that this alliance is replace the rule with a legislative ban. normalization agreements with Israel. Mr. Trump received multiple adapting, responding when the world is changing.” “We do not foresee that a Biden administration would roll back nominations for the Nobel Peace Prize for helping broker the deals. In 2014, NATO member countries said they would aim to boost the bump stock ban, so [we] will continue to challenge this ban Mr. Biden sent out a terse statement welcoming the initial an- their national defense spending to at least 2% of GDP by 2024 in in the courts,” said Erich Pratt, senior vice president of the group nouncements from the UAE and Bahrain. light of Russia’s incursions into Crimea. Gun Owners of America. WEDNESDAY, JANUARY 20, 2021 ☆ R POLITICS | A5
Advertisement
AN OPEN LETTER TO PRESIDENT JOSEPH BIDEN Here’s Why You Should Not Present Yourself for Holy Communion
Dear President Biden,
In the years 1987, 1988, 2000, 2008 and again as recently as 2018 members of our organization buried the shattered bodies of aborted babies. The ma- jority of them we retrieved with our own hands from dumpsters behind the very abortion centers where they had been put to death—human beings literally treated as so much trash. We saw these victims, held these victims—and thus came to know personally the atrocity of legalized abortion in those dark and awful nights. Abortion is not simply an issue or an idea over which we may have a disagreement. Abortion is 62 million dead people!
Mr. President, you claim to be a practicing Catholic and yet support, advocate and facilitate laws and policies that cause the deaths of the helpless, innocent unborn—in complete contradiction to the Faith you profess to believe. The 1974 Vatican Declaration on Procured Abortion is something you, as a politician, are called to take seriously:
It must in any case be clearly understood that whatever may be laid down by civil law in this matter, man can never obey a law which is in itself immoral, and such is the case of a law which would admit in principle the liceity of abortion. Nor can he take part in a propaganda campaign in favor of such a law, or vote for it. Moreover, he may not collaborate in its application (Art. 22).
Mr. President it is obvious that you treat the Catholic teaching on the sanctity of human life as mere private religious faith. You have a set of rules for your private life and a whole other set of rules for your public life. But the right-to-life of the unborn is NOT merely a religious doctrine. The right to life is rooted in natural law, rooted in what it means to be human. The right-to-life of the unborn is a civil right and a matter of social jus- tice transcending religious affi liation. Because your support for legalized abortion is gravely evil, you should not present yourself for Holy Commu- nion. If you believe as a Catholic that that abortion is unjust, yet advocate for laws that facilitate this injustice, you are morally incoherent.
Please refrain from the reception of Holy Communion for the following reasons: 1.) Doing so gives public scandal to your fellow believers and to those outside the Church as well. In receiving Communion you are providing bad example to others. Your reception of the Eucharist misleads others to conclude that facilitation of the deaths of the unborn is compatible with the practice of the Catholic Faith, when it is not. You participate in a form of genocide and teach others that the weak and vulnerable are the expendable members of society.
2.) Your own soul is as stake. When you continue to receive the Eucharist while in support of laws that slaughter the unborn, you speak a spiritual lie. By doing so you manifest a lack of personal moral integrity for which you are responsible. St. John teaches: “The person who claims to be in the light, hating his brother all the while, is in darkness even now.” Abortion is a form of hate towards one’s fellow man.
3.) For you to receive the Body and Blood of Christ while facilitating the desecration of the sacred humanity of the unborn constitutes a sacrilege against what it means to be united to Christ in this Sacrament. Your support for abortion wounds Christ in His brothers and sisters, as Jesus teach- es: “Whatsoever you do to the least of my brethren, you do to me.”
Canon 915 of the Catholic Code of Canon Law is quite clear that those “obstinately persevering in manifest grave sin are not to be admitted to Holy Communion.”
(One cannot desecrate this body
and then receive this Body. To do so is a staggering incongruity.)
Please, Mr. President, be a person of integrity. As long as you cannot be in Communion with the Faith of the Church on such serious mat- ters—do not present yourself for Communion. We PRAY for you. We pray that if you truly believe, according to your Faith, and the evidence of Science, that the unborn are human and have a God-given right to exist—that you will do justice for them as fellow members of the human race.
Please say a prayer for us. Pray our commitment to advocate for justice will be strengthened and that we will persevere in building a Culture of Life.
Sincerely in Christ, the Lord of Life, Citizens for a Pro-Life Society www.prolifesociety.com
Ad Sponsored by Citizens for a Pro-Life Society Donations Gratefully Accepted to Defray Cost of this Ad www.prolifesociety.com A6 | POLITICS ☆ R WEDNESDAY, JANUARY 20, 2021
ECONOMY Yellen presses Congress to go ‘big’ on virus relief package Treasury nominee praises part of 2017 tax law for improving competitiveness
BY DAVID SHERFINSKI She said Mr. Biden does not want to
THE WASHINGTON TIMES repeal the entire 2017 tax law, which also included across-the-board tax rate cuts Janet Yellen on Tuesday praised for individuals. part of Republicans’ 2017 tax law that “The focus right now is on providing President-elect Joseph R. Biden wants relief and on helping families keep a roof to unwind as she pressed Congress to over their head and food on the table, go “big” on another COVID-19 relief and not on raising taxes,” Ms. Yellen said. package and worry about the debt later. Ms. Yellen said she and Mr. Biden The Senate confi rmation hearing for are concerned about the national debt Ms. Yellen, Mr. Biden’s pick for treasury in the long run, but that the current secretary, underscored the diffi culty economic conditions necessitate an Mr. Biden will have in convincing Re- immediate infusion of taxpayer money publicans to go along with a $1.9 trillion into the economy. economic rescue package — one of his “Right now, with interest rates at top domestic priorities in the early days historic lows, the smartest thing we can ASSOCIATED PRESS of his administration. do is act big,” she said. “Th e focus right now is on providing relief and on helping families keep a roof over their head and food on the table, and not on Ms. Yellen, the former chair of the Republicans signaled that even if raising taxes,” Janet Yellen, President-elect Joseph R. Biden’s treasury secretary pick, said during a Senate confi rmation hearing. Federal Reserve, said Mr. Biden isn’t they vote to confi rm Ms. Yellen, they’re planning to follow through right away not going to support certain parts of on his campaign pledge to raise taxes Mr. Biden’s $1.9 trillion relief package coronavirus-related eff orts like vaccine Biden administration plans to confront that the immediate danger is not to on the wealthy and large corporations. — notably an increase in the federal distribution and testing, and $350 billion China on global economic issues. go big enough on an economic relief “Although the corporate tax cuts, I minimum wage to $15 per hour. for cash-strapped states and localities — “China is clearly our most important package. think, did improve the competitiveness “Obviously, an arbitrary government- the last of which is another red line for strategic competitor,” she said, adding “My top economic priority is avoid- of American businesses and President- mandated minimum wage increase is many Republicans. that it will be important to work with ing the mistake Congress made in the elect Biden is not proposing to raise the going to cost jobs,” said Sen. Patrick J. Ms. Yellen also touched on other foreign allies on the matter. “We need last recession, which was taking a foot corporate tax to the level before that act, Toomey, Pennsylvania Republican. “If policy topics that would be part of her to take on China’s abusive, unfair and off the gas pedal before recovery took it’s very important that corporations and not, then of course we would just raise portfolio during the hearing. illegal practices.” hold,” he said. wealthy individuals pay their fair share,” the minimum wage to $20 or $30 or $50 She said the value of the U.S. dollar Sen. Ron Wyden, the Oregon Demo- Sen. Chuck Grassley of Iowa, the Ms. Yellen told members of the Senate an hour.” should be set by the market. crat who will soon become chairman of committee’s outgoing Republican chair- Finance Committee. Ms. Yellen said research on the topic “The United States does not seek a the Finance Committee, said he’s hoping man, said lawmakers aren’t simply going Mr. Biden has talked about increasing has shown that there would likely be weaker currency to gain competitive ad- for a fl oor vote on Ms. Yellen’s nomina- to sign off on what his party calls a the corporate tax rate from 21% to 28%. minimal job loss associated with an vantage, and we should oppose attempts tion Thursday. poorly-targeted economic package from It was 35% before the Republican-con- increase to the minimum wage. by other countries to do so,” she said. Democrats could take eff ective con- Mr. Biden. trolled Congress passed a tax overhaul Mr. Biden’s proposal includes Ms. Yellen also vowed to create a trol of the House, Senate and White “Now is not the time to enact a laun- in 2017 that President Trump signed about $1 trillion in direct aid for in- “hub” within the Treasury Department House as soon as Wednesday. dry list of liberal structural economic into law. dividuals, more than $400 billion for to focus on climate change and said the Mr. Wyden agreed with Ms. Yellen reforms,” Mr. Grassley said.
FOREIGN POLICY Blinken vows to restore U.S. standing in world Nominee emphasizes ‘core alliances’
BY LAUREN TOMS
THE WASHINGTON TIMES
President-elect Joseph R. Biden’s pick to lead the State Department, Antony Blinken, pledged Tuesday to restore Amer- ica’s standing in the world following a nontraditional foreign policy approach by outgoing President Trump. The longtime adviser and confi dant to Mr. Biden told a Senate Foreign Relations Committee confi rmation hearing that he ASSOCIATED PRESS generally agreed with the Trump admin- “Humility and confi dence should be the istration’s foreign policy on China and the fl ip sides of America’s leadership coin,” Middle East, but disagreed with how many Secretary of State nominee Antony ASSOCIATED PRESS of the policies were implemented. Blinken told a Senate committee. “Th e safety and security of our democracy demands competent civilian control of our armed forces, the subordination of military While outgoing Secretary of State Mike power to the civil,” said Secretary of Defense nominee Gen. Lloyd Austin (center). He has been out of the Army for fi ve years. Pompeo often spoke of restoring his de- partment’s “swagger,” Mr. Blinken struck principle was the right one.” PENTAGON a very diff erent note in describing his own On Iran, Mr. Blinken said that the Jan. approach. 2019 U.S. strike that killed top Iranian Gen. “Humility and confi dence should be Qassem Soleimani left the U.S. “less safe.” the fl ip sides of America’s leadership coin,” The attack prompted Iran to retaliate by Austin pledges civilian approach Mr. Blinken said. fi ring missiles at U.S. military bases in Iraq “Humility because we have a great and nearly led to war. deal of work to do at home to enhance our A former State Department offi cial to secretary of defense position standing abroad. And humility because under the Obama administration, Mr. most of the world’s problems are not Blinken told the panel that “the question is about us, even as they aff ect us. Not one not whether taking him out was the right Former general needs congressional waiver for confi rmation of the big challenges we face can be met thing to do, it was gaming out what might by one country acting alone — even one be the consequences.” BY MIKE GLENN armed forces. “If Iran were ever to get a nuclear as powerful as the U.S.” Facing what most expect to be a rela-
THE WASHINGTON TIMES Mr. Biden’s pick would also make his- capability, most every problem that we “Core alliances” he added, were the tively clear path to confi rmation, Mr. tory as the fi rst Black American ever to deal with in the region would be tougher,” most eff ective tool to “counter threats Blinken will inherit a host of policy chal- President-elect Joseph R. Biden’s serve as defense secretary. he said. posed by Russia, Iran and North Korea lenges on Iran from its rising nuclear choice to lead the Department of Defense Amid several questions from senators Stamping out sexual assault in the and to stand up for democracy and human power to military and diplomatic tensions. spent more than 40 years in uniform but of both parties, Gen. Austin insisted he armed forces is a priority because it ad- rights.” Mr. Biden has talked of quickly rejoining said he’s not coming to Washington to be could separate his more than 40 years of versely impacts on leadership and readi- He said the U.S. under Mr. Biden would the 2015 Iran nuclear deal that Mr. Trump the chairman of the Joint Chiefs of Staff . military service with his new job and role ness, Gen. Austin said, as evidenced by a not shy away from its traditional post- repudiated three years ago. Retired Army Gen. Lloyd Austin told as a political appointee. string of recent high-profi le cases. war responsibilities or break with its “We have an urgent responsibility to do senators on Tuesday that he understands “I understand and respect the reser- “I take the issue of sexual assault seri- traditional allies, even as it rolls back or whatever we can to prevent Iran from ac- the diff erent responsibilities of the most vations that some of you have expressed ously and personally,” he said. “We have softens many of Mr. Trump’s “America quiring or getting a weapon,” Mr. Blinken senior military offi cer and the top civilian about having another recently retired to get better and we will get better.” First” approach. told the panel. offi cial in the Pentagon. general at the head of the Department of But, when asked if sexual assault Mr. Blinken cited the Abraham Accords Mr. Blinken, 58, previously served on “If confi rmed, we’ll make sure those Defense,” he said. “The safety and security should be taken away from the military as a highlight of the Trump administra- President Clinton’s National Security roles and responsibilities are clearly out- of our democracy demands competent chain of command, Gen. Austin was wary, tion’s foreign policy. The series of deals Council and as the Democratic staff di- lined,” he said during a confi rmation civilian control of our armed forces, the saying any change to the Uniform Code normalized diplomatic relations between rector on the Senate panel when it was hearing before the Senate Armed Services subordination of military power to the of Military Justice should be done only Israel and at least four Arab states, mark- chaired by Mr. Biden. He said Tuesday he Committee. civil.” after careful deliberation. ing a signifi cant breakthrough in ending appreciated now how popular domestic The coronavirus pandemic, sexual Based on a 1947 law, the congressional “I would certainly want to take this Israel’s isolation and shoring up a united support was vital to foreign policy success. assault and harassment in the ranks and waiver has only been granted twice, fi rst on and look at it with the right experts,” front against Iran. “No foreign policy can be sustained an increasingly bellicose China are among to former Gen. George C. Marshall under he said. But the nominee said that although he without the informed consent of the Amer- the most pressing concerns facing the President Truman and most recently to Sen. Elizabeth Warren, Massachusetts would like to take a “hard look” at various ican people,” he said in his concluding re- Pentagon’s leadership. While each chal- Mr. Mattis. Democrat, pressed him about the “cozy commitments that were made in cutting marks. “We can only tackle the most urgent lenge will be taken seriously, COVID-19 Gen. Austin has been out of the Army relationship” between the Pentagon and those deals, such as opening the door to problems our country faces if we work is in a category of its own, he said. for fi ve years. the defense industry, Gen. Austin said he major arms sales to the region. together, and I am dedicated to doing that.” “If confi rmed, I will quickly review the The nominee faces a full slate of would recuse himself from any decision “The work that was done to push Mr. Blinken has received bipartisan [Department of Defense’s] contributions challenges should his confi rmation go aff ecting defense giant Raytheon, where forward on normalization with Israel I support from lawmakers and is expected to coronavirus relief eff orts, ensuring we through. he has been a board member since 2016 applaud,” he said. “It makes Israel safer, it to be confi rmed by the Senate in a vote are doing everything we can to help dis- A former head of U.S. Central Com- and would not seek any similar position makes the region safer.” next week. tribute vaccines across the country and to mand in the Middle East, Gen. Austin said afterwards. He took a similar tack on Mr. Trump’s Incoming chairman of the panel, Sen. vaccinate our troops and preserve readi- he would like to see America’s military op- The pledge “sends a powerful message approach to China, which features a hard Robert Menendez, New Jersey Democrat, ness,” he said during his opening remarks. erations in Afghanistan come to end with that you are working on behalf of the line on trade, East Asian security and told reporters Tuesday that Mr. Blinken Like former Marine Gen. James N. a negotiated settlement with the Taliban. American people and no one else,” Ms. human rights, as well as an escalating is “eminently qualifi ed to be Secretary of Mattis, President Trump’s fi rst defense “We’re going to make every eff ort Warren told him. quarrel over the handling of the corona- State and probably taking the reins — hope- secretary, Gen. Austin will need a waiver that we can to ensure that happens. This Separately, Defense News reported virus crisis. fully taking the reins at a time in which the from both houses of Congress to take confl ict needs to come to an end,” he said. Tuesday that a planned House Armed “I also believe that President Trump department needs to be rebuilt.” the Defense Department job, with even He described Iran as a destabilizing Services Committee hearing this week on was right in taking a tougher approach to “He knows the department and our some of Mr. Biden’s Democratic allies element in the Middle East that “doesn’t the waiver questions had been scrubbed. China,” Mr. Blinken said. “I disagree very standing in the world needs to be rebuilt,” expressing concern about the blurring work well with its neighbors.” Keeping it Committee members will instead hold a much with the way that he went about Mr. Menendez continued, “so I expect he’ll of the traditional civilian control of the from getting even stronger is a priority. closed-door meeting with the nominee. it in a number of varieties, but the basic get bipartisan support.” WEDNESDAY, JANUARY 20, 2021 ☆ R POLITICS | A7
PUBLIC HEALTH Biden, Harris remember Americans who died of virus Death toll surpasses 400,000 in U.S., 2 million across globe
BY TOM HOWELL JR. spring before the crisis shifted to
THE WASHINGTON TIMES the Sun Belt of the South and West over the summer. The Midwest President-elect Joseph R. Biden suff ered in the fall before the crisis and Vice President-elect Kamala blanketed the country in a winter D. Harris memorialized the nearly surge of infections and death. 400,000 Americans who have died All told, more than 3,000 peo- from the coronavirus in a cer- ple are dying from the virus per emony on Tuesday, saying the day in the U.S. nation must remember the family The memorial offered a members and friends lost to the mournful contrast to President disease. Trump’s frequent insistence the Four hundred lights, each rep- U.S. was “turning the corner” or resenting 1,000 victims, lined the lifting other nations in the battle Refl ecting Pool on the National against the disease. Mall as gospel singer Yolanda Mr. Trump tended to focus Adams sang Leonard Cohen’s on the positive throughout 2020, “Hallelujah” and other cities held saying he served as a “cheerleader similar vigils. for the country.” He told reporter “To heal, we must remember. Bob Woodward that he wanted It’s hard sometimes to remem- to play down the virus threat and ber. But that’s how we heal. It’s later told campaign crowds the important to do that as a nation,” U.S. was rounding the turn, despite Mr. Biden, who will be sworn at signs the pandemic was getting the 46th president on Wednesday, far worse. said a few steps from the Lincoln But he also ushered in medical Memorial. advancements to fi ght the pan- Cardinal Wilton Gregory, the demic, from building a surplus “For many months, we have grieved by ourselves. Tonight we grieve and begin healing together,” Vice President-elect Kamala D. Harris said. archbishop of Washington, said supply of ventilators that help America should use its shared people who cannot breathe on deaths are a reminder that Ameri- frequent sequencing of the virus, pain as a way to come together — a their own to shepherding a port- cans need more relief. though it’s not always clear which through-line of the ceremony as folio of vaccines and antibody “As we mourn this devastating might be more contagious. the Biden administration tries to therapeutics. milestone, we must come together Scientists believe that existing follow through on its mantra of “They said it couldn’t be done, to move past the failed Trump vaccines will work against the national unity. but we did it. They called it a response to crush the virus and variants. “For many months, we have medical miracle, and that’s what deliver robust, real relief now,” In other positive signs, hospital- grieved by ourselves. Tonight, we they’re calling it right now,” Mr. Mrs. Pelosi said. izations are down to 123,000 from a grieve and begin healing together,” Trump said in his farewell address The U.S. death toll far exceeds peak of 131,000 one week ago, and Ms. Harris said. on Tuesday. that of any other nation, with Bra- the seven-day rolling average cases The Empire State Building “We grieve for every life lost, zil in second at about 210,000. is about 207,000 per day compared in New York and Space Needle and we pledge in their memory to However, populations diff er and to nearly 250,000 a week ago. in Seattle were illuminated and wipe out this horrible pandemic,” it is unclear if other nations are as Mr. Trump, who will fl y to other major cities joined the trib- the president said, before pivoting diligent or transparent in record- his Florida home on Wednesday, ute, including Mr. Biden’s birth- back to economic successes. ing COVID-19 deaths. issued an order Monday lifting place of Scranton, Pennsylvania, His health secretary, Alex M. The global COVID-19 death travel restrictions on Brazil and and hometown of Wilmington, Azar II, struck a somber tone in a toll recently surpassed 2 million wide swaths of Europe as of Jan. Delaware. Tuesday address to his department ASSOCIATED PRESS PHOTOGRAPHS as countries battle variants of the 26. He left bans on China and The U.S. surpassed 400,000 before he leaves on Wednesday. Nurse Lori Marie Key sings “Amazing Grace” during a COVID-19 virus discovered in the U.K. and Iran intact. deaths from COVID-19 around 3 “This is a national tragedy. We memorial ceremony on Tuesday in Washington. South Africa that appear to spread Airlines had been pushing for p.m. on Tuesday, according to the have lost members of our own faster than previously known the relaxation, arguing they can Johns Hopkins University tracker. HHS family, some of whom put versions. test passengers, but Mr. Biden’s New York has seen the most their lives on the line by providing our HHS family have lost loved his livestreamed speech. Scientists have detected team said it will reject the move deaths of all the states, with over frontline care in the Indian Health ones or friends,” said Mr. Azar, House Speaker Nancy Pelosi, mutated versions from Ohio to and, if anything, tighten travel 41,000. It was slammed in the Service. Many other members of who held a moment of silence in meanwhile, said the 400,000 Germany in recent days due to rules.
Prepare for power outages with a Generac home standby generator
REQUEST A FREE QUOTE! 866-221-4707 FREE 7-Year Extended Warranty* A $695 Value!
Off er valid December 15, 2020 - March 1, 2021 Special Financing Available Subject to Credit Approval *To qualify, consumers must request a quote, purchase, install and activate the generator with a participating dealer. Call for a full list of terms and conditions. A8 | NATION ☆ R WEDNESDAY, JANUARY 20, 2021
“If Cancel Culture is really going to have Donald J. Trump removed from the John Hughes movie ‘Home Alone,’ then in support of MY PRESIDENT, I’d like to have myself offi cially removed from the John Hughes’ fi lms, ‘Pretty In Pink’ and ‘Ferris Bueller’s Day Off .’ ” Nation — Actress Kristy Swanson, on Twitter
ENVIRONMENT BUSINESS Appeals court strikes down Stores drop MyPillow Trump environmental rule after CEO Judges hold EPA misread section of previous plan pushes vote BY VALERIE RICHARDSON decision. America, a federation of envi- conspiracies THE WASHINGTON TIMES EPA spokeswoman Molly ronmental advocacy groups. “As Block said the agency would re- the Trump administration leaves A federal appeals court view the decision and “explore offi ce, we hope this ruling will ASSOCIATED PRESS torched Tuesday the administra- all available litigation options,” be refl ective of a much brighter NEW YORK | The founder of tion’s bid to repeal and replace while New York Attorney Gen- future.” MyPillow, a vocal and in the past the Obama-era Clean Power Plan, eral Letitia James applauded the Ms. Block said that the EPA few weeks very visible supporter delivering a blow to President ruling against the so-called dirty was “disappointed that the panel of President Trump, says a back- Trump’s deregulatory and pro- power rule. majority rejected EPA’s well-sup- lash against the company has business agenda on his last full “This ruling affirms what ported repeal of the Clean Power begun after a mob stormed the day of offi ce. we’ve said all along — the ‘Af- Plan,” which has been tied up in U.S. Capitol this month. A three-judge panel of the fordable Clean Energy’ rule did court since shortly after it was Mike Lindell, the company CEO U.S. Court of Appeals for the D.C. nothing to promote clean energy, unveiled in 2015. and also the face of the brand, said Circuit struck down the Aff ord- and was not aff ordable for Ameri- While the ACE rule was seen major retailers like Bed Bath & able Clean Energy rule, a more can consumers,” Ms. James said in on the right as far preferable to ASSOCIATED PRESS Beyond and Kohl’s have dropped industry-friendly alternative to a statement. “Instead, this ‘Dirty the Clean Power Plan, there were A three-judge panel of the U.S. Court of Appeals for the D.C. Circuit his products recently. Both com- the ambitious but never-imple- Power’ rule served to support few tears shed by free-market struck down the Aff ordable Clean Energy rule Tuesday. Th e rule was an panies confi rmed the decision to mented Clean Power Plan, the dirty and expensive coal power advocates over the decision to alternative to the Obama-era Clean Power Plan. cease carrying the brand Tuesday, Obama administration’s signature plants, undercut clean and sus- toss the Trump alternative. but cited fl agging sales rather than policy on slashing power-plant tainable electricity, and left New “Oddly enough, this is a win. Mr. Lindell’s actions or his support emissions. Yorkers and all other Americans Here’s why,” said JunkScience fans face a far larger challenge assumptions that carbon dioxide for Mr. Trump. The judges — two Obama ap- to foot the bill.” founder Steve Milloy, a former with Mr. Biden, who has pledged from coal-fi red power plants has “There has been decreased pointees and a Trump appointee The decision came as a pre- member of the Trump EPA tran- to achieve net-zero emissions by overwhelming negative eff ects on customer — held that the Environmental inauguration gift for President- sition team. “The Obama Clean 2050, presumably requiring the the environment and humanity, demand for Protection Agency “miscon- elect Joseph R. Biden by strik- Power Plan (CPP) was stayed by phasing-out of both coal and gas- when just the opposite is the case,” MyPillow,” strued” the relevant section of the ing down the ACE rule, which the Supreme Court. The greens do fi red power plants. Mr. Wrightstone said. “Modest Kohl’s said Clean Air Act, ruling in favor of his administration likely would not want it reinstated. The Trump “In any event, these rules have warming combined with increas- in an email. the 23 progressive attorneys gen- have sought to jettison as part ACE rule was actually undercut by no impact on the coal industry ing CO2 is leading to improving “We will sell eral and eight city governments of his ambitious climate-change its assumption that coal plant emis- since many, if not almost all utili- and thriving ecosystems and many our current that fi led the lawsuit in 2019. agenda. sions are harmful to the climate. So ties, have committed to phasing benefi ts for mankind.” inventory “Because promulgation of “The Dirty Power Plan was the Biden EPA will try to issue a out coal. The fi ght goes on,” Mr. Presiding over the case were and not buy the ACE Rule and its embedded clearly a disastrous and miscon- new rule. Regulatory-wise, we are Milloy said. Judge Patricia Millett and Judge additional/ repeal of the Clean Power Plan ceived regulation from the start, basically back in the pre-CPP days Greg Wrightstone, executive Cornelia Pillard, both Obama ap- Lindell future inven- rested critically on a mistaken and the court’s decision confi rms of June 2013.” director of the CO2 Coalition, pointees, and Trump-appointed tory in the reading of the Clean Air Act, we that assessment,” said Andrea The CPP was the cornerstone said the CPP and the ACE rule Judge Justin Walker, who con- brand.” vacate the ACE Rule and remand Gimsey, global warming solutions of the Obama administration’s so- were “faulty at their very root.” curred in part and dissented in Mr. Lindell has continued to to the Agency,” said the 185-page senior director of Environment called war on coal, but fossil-fuel “Both were created using fl awed part. push bogus claims of election fraud since Mr. Trump’s loss to President-elect Joseph R. Biden in the 2020 race for the White INAUGURATION SECURITY SPREAD FAR AND WIDE House. That has led to extensive pres- sure on social media for out- lets carrying MyPillow, based in Chaska, Minnesota, southwest of Minneapolis, to drop the brand. Other companies have been caught in the crossfi re as once- loyal customers are repulsed by the support of some executives for Mr. Trump. Many households purged their pantries of Goya products after the CEO of the company appeared next to Mr. Trump at the White House and praised him eff usively. Retailers during the Trump administration have wrestled with an extremely divisive po- litical environment, risking the loss of business from one side or the other. Among the fi rst brands to get a public pink slip was Ivanka Trump clothing, which Nord- strom stopped carrying in early 2017. The company, like those drop- ping MyPillow, cited steadily de- clining sales but it was boycotted nonetheless by Trump support- ers. Mr. Trump complained on ASSOCIATED PRESS Twitter that Nordstrom treated Independence Hall and other sites in Philadelphia are under extra security, and all members of the city’s police department are on notice to work through Th ursday and be on alert for his daughter “so unfairly.” the kind of violence that infi ltrated the U.S. Capitol on Jan. 6. Joseph R. Biden will be sworn in as president and Kamala Harris as vice president in a Capitol ceremony Wednesday. Other retailers dropped the brand, however, and it closed for business a year later. Speaking with Right Side WALL STREET sign of confi dence in the pros- could eventually add pressure on Broadcasting Network, which pects for future economic growth. stocks, underscoring more how is best known for its live stream The Russell 2000 index picked up expensive stocks have become coverage of Trump rallies on Wall Street’s momentum swings 27.94 points, or 1.3%, to 2,151.14. relative to the profi ts that com- its YouTube channel, Mr. Lin- U.S. markets were closed Mon- panies are producing. dell said this week that Bed day in observance of Martin Lu- But some areas of the stock Bath & Beyond and Kohl’s were ther King Jr. Day. market could benefit, includ- good companies but were feel- back as stocks, yields increase The case for more economic ing banks. Higher rates and a ing pressured by social media relief from the government has healthier economy would allow campaigns. BY STAN CHOE, DAMIAN J. TROISE coming economic recovery as for an accelerated rollout of been rising by the day. Dismal them to earn bigger profi ts from “I told them, you guys come AND ALEX VEIGA COVID-19 vaccines roll out and COVID-19 vaccines, a higher reports have piled up showing making loans. back any time you want,” he said ASSOCIATED PRESS Washington gets set to try for an- minimum wage for workers and how the worsening pandemic Bank of America slipped 0.7% in a video released on YouTube. other massive round of stimulus enhanced benefits for laid-off has more workers applying for after reporting a weaker profi t for “It’s not their fault that they’re Wall Street kicked off a holi- for the economy. workers. The hope is that such jobless benefits and shoppers the last three months of 2020 than scared.” day-shortened week with broad Janet Yellen, President-elect stimulus can carry the economy feeling less confi dent. a year earlier, though its results Mr. Lindell said MyPillow gains for stocks Tuesday, as the Joseph R. Biden’s nominee to be until later this year, when more Tuesday’s Senate Finance were still above analysts’ expecta- products also have been pulled market recovered most of its Treasury secretary, is calling on widespread vaccinations get life Committee hearing with Ms. tions. The bank also said expec- from online furniture store Way- losses from last week. Congress to do more to boost the returning to some semblance of Yellen is one of several that the tations for a healing economy fair and Texas supermarket chain The S&P 500 gained 0.8%, economy. normal. Senate will be holding as the mean it doesn’t need to hold onto HEB. pulling to within 1% of its record In testimony during her con- “If most of this is imple- incoming Biden administration as much in reserves to cover for Wayfair and HEB did not im- high set earlier this month. About fi rmation hearing on Tuesday, mented, it does suggest signifi - tries to get its top Cabinet offi - potentially bad loans. mediately respond to a request 60% of the companies in the Ms. Yellen said that with inter- cant pickup in economic growth cials in offi ce quickly. Mr. Biden Goldman Sachs, State Street for comment Tuesday from The benchmark index rose. est rates near their record lows, as we head through to the fourth is set to take the oath of offi ce on and Halliburton also reported Associated Press. Technology, communication “the smartest thing we can do is quarter of this year,” said David Wednesday, ending President stronger results for the end of Aside from the retail pressure, services and health care stocks act big” to avoid an even worse Kelly, chief global strategist at Trump’s four-year term. 2020 than analysts expected as Mr. Lindell also is facing potential accounted for much of the rally, downturn in the near term and JPMorgan Funds. Besides stocks, the optimism earnings reporting season picks litigation from Dominion Voting though energy sector companies scarring for the economy in the The S&P 500 rose 30.66 points about an eventual acceleration for up pace. Systems for his accusations that notched the biggest gain. Trea- long term. to 3,798.91. The Dow Jones Indus- the economy and another round Wall Street is expecting a rela- their voting machines played a sury yields rose. Mr. Biden last week released trial Average added 116.26 points, of stimulus have also helped tively weak showing across the role in election fraud. The Wash- The gains marked a reversal details of a $1.9 trillion relief plan or 0.4%, to 30,930.52. The Nasdaq push Treasury yields up sharply S&P 500 this time around, with ington Post reported that Do- from last week, when stocks ran to bolster the economy, which composite gained 198.68 points, recently. another sharp drop in earnings minion sent Mr. Lindell a letter out of steam after a strong start would include $1,400 cash pay- or 1.5%, to 13,197.18. The yield on the 10-year per share. But analysts expect earlier this month stating that to the year. Markets have been ments for most Americans. Traders continued to bid up Treasury climbed to 1.10% from growth to rebound powerfully they would pursue legal action rising on enthusiasm about a Democrats also are pushing shares in smaller companies, a 1.08% late Friday. Higher rates through 2021. against him. WEDNESDAY, JANUARY 20, 2021 ☆ R NATION | A9 American Scene
CALIFORNIA NEW YORK Sheriff ’s deputy, suspect ARIZONA Search for two children dead following shootout taken from foster home SACRAMENTO | A sheriff ’s Military nurses, tests coming to help hard-hit city GREECE | A pair of men in ski deputy was killed and another masks broke through a window deputy was wounded in a BY ANITA SNOW have gone to Tucson in southern Hispanic and thus dispropor- of a suburban Rochester home, shootout with a suspect who ASSOCIATED PRESS Arizona. tionately aff ected by the virus duct-taped a woman and two gunned down a K-9 dog before Forty Army Reserve nurses because of conditions like dia- of her foster children and then he was fatally shot, authorities PHOENIX | Exhausted nurses arrived this month to help at betes and obesity. fl ed with two other children: a said. in rural Yuma, Arizona, regu- the Yuma hospital for at least a Working with bilingual 5-year-old boy and his 3-year- The gunbattle erupted in larly send COVID-19 patients on month through a Department health advocates from the old sister, police said Tuesday. Sacramento near a racetrack at a long helicopter ride to Phoenix of Defense COVID-19 support Yuma area, the Equality Health Police issued an Amber the Cal Expo event venue after when they don’t have enough operation in hard-hit parts of Foundation administered tests Alert for Dimitri Cash Jr. and a vehicle pursuit late Monday, staff . the West and Midwest. through the project Friday to Shekeria Cash after they were said Sacramento County Sheriff The so-called winter lettuce They are among several hun- older people and those with abducted in suburban Greece at Scott Jones. capital of the U.S. also has lagged dred military medical personnel disabilities at their homes. about 8:40 p.m. Monday, police The deputy who died was a on coronavirus testing in heavily dispatched since November to “Yuma is a testing desert,” said. six-year veteran of the depart- Hispanic neighborhoods and work alongside civilian health said Tomas Leon, spokesman for — Associated Press ment. The injured deputy was just ran out of vaccines. ASSOCIATED PRESS care providers treating COVID- Equality Health, which brings in stable condition. But some support is com- Coronavirus tests in Yuma 19 patients on the Navajo Na- medical care to underserved OREGON The suspect was a man in ing from military nurses and County are 20% positive, tion and in six states including communities. “We are taking Car thief berates mom his 40s. a new wave of free tests for compared with about 14% for Arizona and New Mexico, ac- these tests in a community- Names of those involved farmworkers and older adults in Arizona. Forty Army Reserve cording to the U.S. Army North driven, culturally appropriate for leaving kid inside weren’t immediately released. Yuma County — the hardest-hit nurses arrived this month to at Fort Sam Houston in Texas. way to people where they are.” BEAVERTON | A car thief who The pursuit and shooting county in one of the hardest-hit help at the Yuma hospital. Yuma County’s residents in- Flavio F. Marsiglia, director found a toddler in the back seat followed an attempted traf- states. clude seasonal laborers from of ASU’s Global Center for Ap- of a stolen vehicle drove back fi c stop, and the driver ended Almost everyone in Yuma California’s Salinas Valley and plied Health Research, said he and chastised the mother for up crashing on the Cal Expo County, near the borders of Arizona Department of Health Mexican migrant workers with and others involved in the test- leaving the child unattended grounds. Mexico and California, seems Services reported Sunday that U.S. agricultural visas. ing project are now exploring before taking off again, police — Associated Press to know somebody who has 633 people had died in the The hot, dry region features the possibility of returning to said. tested positive for COVID-19, county with a population of vast agricultural fi elds of leafy Yuma County with the vaccine The woman went into a EDUCATIONAL ASSESSMENT with around 33,000 cases re- about 215,000 people. greens, alfalfa and cotton in the later this year. grocery store about 15 feet from SAT ending optional ported since last spring — a Of the 124 COVID-19 patients middle of the desert, fed by the “We are trying to get to these the car Saturday, leaving her rate of about 14,000 per 100,000 hospitalized as of Friday, 28 Colorado River that meanders hard-to-reach parts of society 4-year-old child inside with the essay, subject tests people. Maricopa County, the were in intensive care, accord- near Yuma’s historic downtown. that are always left behind,” Mr. engine running and the vehicle NEW YORK | The College largest in Arizona and home ing to local health statistics. Top nonfarm employers in- Marsiglia said. unlocked, said Beaverton po- Board said Tuesday it will elimi- to Phoenix, has a rate of about Offi cials at Yuma Regional clude the medical center, the The Yuma County Public lice spokesman Offi cer Matt nate the optional essay from the 9,000 cases per 100,000 people. Medical Center say it’s been a Marine Corps Air Station Yuma Health District reported in the Henderson. SAT and do away with subject Yuma County’s soaring num- struggle to maintain staffi ng of and the U.S. Border Patrol. The middle of last week that its early A store employee told au- tests amid a changing college bers come as Arizona’s COVID- 900 to 1,000 nurses while com- county is also home to some supply of the vaccine had run thorities the woman was in the admissions landscape. 19 diagnosis rate ranked the peting for medical workers in 85,000 part-time retirees and out. Arizona offi cials say that market for a few minutes before “The pandemic has high- worst in the U.S. over the past an overwhelmed national health thousands of inmates at the some 6,200 doses have been someone began driving away lighted the importance of being week, at 1 in every 120 people. care system. Yuma State Prison Complex. administered in Yuma County. with the SUV. innovative and adaptive to what “It’s had a signifi cant impact To ensure each nurse has no At the U.S.-Mexico border, “Vaccines are really what we Once the thief realized the lies ahead,” according to a state- on the community,” said Dr. more than fi ve or six patients at farmworkers headed to the need right now,” said Dr. Tren- toddler was in the back seat, he ment from the not-for-profi t Col- Robert Trenschel, president and a time, the 406-bed Yuma hos- fi elds Thursday were getting schel, the medical center’s CEO. drove back, berated the woman lege Board, which said it wants to CEO of Yuma Regional Medical pital has transferred COVID-19 hundreds of free saliva tests Much of the hospital’s staff has for leaving her child unat- make the SAT more fl exible and Center, the area’s only acute care patients to other facilities, some- engineered by the Arizona State received the fi rst of two recom- tended, told the woman to take reduce demands on students. hospital. “We’re still likely to see times up to 10 a day, said Deb University’s Biodesign Institute mended doses. the child and drove away in the The three-hour, multiple another peak from New Year’s Anders, chief nursing offi cer. through a $4.7 million grant The vaccine rollout in Yuma stolen vehicle. choice SAT measures math celebrations.” Transfers are usually by heli- from the National Institutes of has been slow, with the county The vehicle was found a and English language arts Tests in Yuma County are copter to Phoenix, which is 180 Health. The initiative aims to saying over the weekend it was few hours later in Portland, profi ciency. The optional essay 20% positive, compared with miles away and has the closest improve testing in places like getting get just 6,900 more doses and police are searching for adds about another hour and about 14% for Arizona. The major hospitals, although a few Yuma County, which is 60% Tuesday. the thief. is scored separately, as were The thief was said to be in the lesser required subject his 20s or 30s with dark brown tests given in specifi c areas like immediately end for U.S. stu- The optional essay will be Nearly 2.2 million 2020 high schools, according to the Col- or black braided hair and a chemistry or foreign languages. dents and will be phased out for discontinued after June testing school graduates took the SAT lege Board. multicolored face mask. The subject tests will international students by June. sessions. before the pandemic shut down — Associated Press — Associated Press
shoddy and superfi cial analysis, XL corridor both in Canada and PIPELINE the federal government not only the United States.” From page A1 didn’t do its job, it did not follow Mr. Francis said the partner- the law.” ship would provide “genuine Keystone XL. The Biden camp may be re- reconciliation, one that for the “We, like many Indigenous thinking its purported plan to fi rst time allows us to work hand- communities across North kick off the administration by in-hand with industry to develop America, have been inspired by targeting Kestone XL after an environmentally responsible en- President-elect Biden’s position outcry Monday from Canadian ergy infrastructure.” to support minority communi- offi cials. “At the same time, Keystone ties and build an economy where Biden spokesman Andrew XL will provide intergenerational everyone enjoys an equal chance Bates said the briefi ng document wealth to our communities, al- read. to get ahead,” Mr. Francis said. cited by the CBC that included lowing us to directly tackle seri- “A decision against Keystone the fi rst-day directive “Rescind ous issues such as poverty and XL is the exact opposite of that Keystone XL pipeline permit” COVID-19 recovery,” he said. pledge.” was a weeks-old draft slide, ac- The pipeline segment now Indeed, Mr. Biden stressed cording to The Associated Press. under construction is expected listen. during his campaign his com- A source speaking on the con- to ship up to 830,000 barrels mitment to “working to empower dition of anonymity told the AP per day from Alberta to Steele tribal nations.” He then followed that everything on the slide “may City, Nebraska, linking to the up by announcing that he would not happen on Day One.” existing Keystone XL pipeline name Rep. Deb Haaland, New network sending crude to the share. Mexico Democrat, to head the In- ‘An integral building block’ Gulf Coast. terior Department, which would The day before the CBC re- The other Canadian tribes make her the fi rst American In- port, TC Energy announced that involved in the Natural Law En- dian Cabinet secretary in U.S. KXL would achieve net-zero ergy agreement with TC Energy history. emissions across the project after are the Montana First Nation, the On the other hand, Mr. Biden fl ipping into service in 2023, and Louis Bull Tribe, the Ermineskin also has placed climate change that the pipeline would be the Cree Nation and the Little Pine at the forefront of his agenda, fi rst to be “fully powered by re- First Nation. vowing to “transition from the oil newable energy sources no later “To lose Keystone is to lose industry” to wind and solar with than 2030.” an integral building block toward the goal of achieving U.S. net-zero “We are confi dent that Key- economic parity for Indigenous emissions by 2050, which would stone XL is not only the safest nations,” said Mr. Francis. “No appear to put him fi rmly in the and most reliable method to other company or government anti-pipeline camp. transport oil to markets, but has off ered us this level of com- Working in his favor are U.S. the initiatives announced today mitment. It is more than words; it tribes that have come out in op- also ensures it will have the is reconciliation in action.” position to the latest phase of the lowest environmental impact Pushing for Mr. Biden to stand pipeline, a 1,179-mile segment that of an oil pipeline in terms of tough on Keystone is Chase Iron would run crude oil from Alberta greenhouse gas emissions,” Eyes, lead counsel of the Lakota through Montana, South Dakota Keystone XL President Richard People’s Law Project, who was and Nebraska on its way to the Prior said Sunday in a state- active in the 2016 Dakota Access terminal in Patoka, Illinois. ment. “Canada and the United pipeline protests near the Stand- The Rosebud Sioux Tribe and States are among the most envi- ing Rock Sioux reservation in Fort Belknap Indian Commu- ronmentally responsible coun- North Dakota. subscribe. nity fi led a lawsuit this month tries in the world with some of “We in Lakota Country relate challenging the Trump Interior the strictest standards for fossil to the shutting down of KXL as Department’s 2017 approval of fuel production.” a fi rst step: next should come the cross-border permit, argu- TC Energy also sweetened the Dakota Access pipeline, a ing that the department failed to the pot for U.S. tribes by say- tortured and dangerous piece of consult adequately with the tribes ing it expected to invest $1.7 infrastructure that the Standing through whose land the pipeline billion in “communities along Rock Sioux Tribe continues to would cross. the Keystone XL footprint creat- fi ght in court,” Mr. Iron Eyes said “Before we allow a foreign ing approximately 1.6 gigawatts Monday in a statement. company to build another pipe- of renewable electric capacity, He criticized the Trump line to haul dirty tar sands across and thousands of construction administration for approving any American soil, we should be jobs in rural and indigenous the fi nal Dakota Access permit taking a hard look at the possible communities.” shortly after taking offi ce in 2017. impact on American land, water, After signing the Natural Law “The National Environmental health, and safety,” said Matthew Energy agreement, TC Energy Policy Act must be respected Campbell, attorney for the Native said it would “apply this owner- now that President-elect Biden American Rights Fund, which ship model to create opportuni- is arriving in Washington,” said washingtontimes.com represents the tribes. “In issuing ties for additional Indigenous Mr. Iron Eyes. “We will keep the the Keystone XL permit with communities along the Keystone pressure on.” A10 | WORLD ☆ R WEDNESDAY, JANUARY 20, 2021
“We are talking about a fact of noncompliance with the Russian law by a citizen of Russia. Th is is an absolutely internal matter and we will not allow anyone to interfere in it and do not intend to listen to such statements.” — Dmitry Peskov, spokesman for Russian President Vladimir Putin, rejecting Western calls for the release of opposition leader Alexei Navalny, who was World placed in pretrial detention upon his return to Moscow from Germany on Sunday aft er a poisoning widely said to have been ordered by the Kremlin
PANDEMIC BRIEFLY Panel faults China, WHO for virus failures THE WORLD
BY MARIA CHENG AND JAMEY KEATEN early handling of the COVID-19 the agency, a move the incoming characterize the emerging pan- slammed the U.N. health agency IRAQ ASSOCIATED PRESS crisis. Biden administration is expected demic as an international emer- for “colluding” with China to Cabinet delays elections China’s Foreign Ministry to quickly reverse. gency until a week later. cover up the extent of the ini- GENEVA | A panel of experts spokesperson Hua Chunying dis- “The bottom line is WHO has WHO offi cials also did not tial outbreak before halting for four months commissioned by the World puted whether China had reacted no powers to enforce anything,” describe the COVID-19 outbreak U.S. funding for WHO and BAGHDAD | Iraq’s Cabinet voted Health Organization has criti- too slowly. she said. “All it can do is ask to as a “pandemic” until March 11, pulling the country out of the Tuesday to postpone early elec- cized China and other countries “As the fi rst country to sound be invited in.” weeks after the virus had begun organization. tions for four months based on a for not moving to stem the initial the global alarm against the Last week, an international causing explosive outbreaks in An Associated Press investiga- recommendation by the country’s outbreak of the coronavirus ear- epidemic, China made immedi- team of WHO-led scientists ar- numerous continents, meeting tion in June found WHO repeat- electoral commission, which lier and questioned whether the ate and decisive decisions,” she rived in Wuhan to research the WHO’s own defi nition for a fl u edly lauded China in public while cited technical reasons. U.N. health agency should have said, pointing out that Wuhan animal origins of the pandemic pandemic. officials privately complained Elections will now be held in labeled it a pandemic sooner. — where the fi rst human cases after months of political wran- As the coronavirus began that Chinese offi cials stalled on October. They had been slated In a report issued to the media were identifi ed — was locked gling and delay to secure China’s spreading across the globe, sharing critical epidemic infor- for June, about a year ahead of this week, the panel led by former down within three weeks of the approval for the probe. WHO’s top experts disputed how mation with them. schedule. Liberian President Ellen Johnson outbreak starting. The panel also cited evidence infectious the virus was, saying Although the panel concluded Prime Minister Mustafa Sirleaf and former New Zealand “All countries, not only China, of cases in other countries in late it was not as contagious as fl u that “many countries took mini- al-Kadhimi announced in July Prime Minister Helen Clark said but also the U.S., the U.K., Japan January, saying public health con- and that people without symp- mal action to prevent the spread that early polls would be held to there were “lost opportunities” or any other countries, should all tainment measures should have toms only rarely spread the virus. (of COVID-19) internally and in- meet the demands of anti-gov- to set up basic public health mea- try to do better,” Ms. Hua said. been put in place immediately in Scientists have since concluded ternationally,” it did not name ernment protesters. Demonstra- sures as early as possible. At a press briefi ng on Tuesday, any country with a likely case, that COVID-19 transmits even specific countries. It also de- tors took to the streets in the “What is clear to the panel Ms. Johnson Sirleaf said it was up adding: “They were not.” quicker than the fl u and that a clined to call out WHO for its tens of thousands last year to is that public health measures to countries whether they wanted The experts also wondered signifi cant proportion of spread failure to more sharply criticize demand political change, and could have been applied more to overhaul WHO to accord it why WHO did not declare a is from people who don’t appear countries for their missteps in- an end to rampant corruption forcefully by local and national more authority to stamp out out- global public health emergency to be sick. stead of lauding countries for and poor services. More than health authorities in China in breaks, saying the organization — its highest warning for out- Over the past year, WHO their response eff orts. 500 people were killed in mass January,” it said. was also constrained by its lack of breaks — sooner. The U.N. health has come under heavy criticism To date, the pandemic has demonstrations as security Beijing has been particularly funding. The Trump administra- agency convened its emergency for its handling of the response killed more than 2 million people forces used live rounds and tear sensitive over criticisms of its tion last year took the U.S. out of committee on Jan. 22, but did not to COVID-19. President Trump worldwide. gas to disperse crowds. — Associated Press
IRAN ITALY Sanctions imposed on Trump, other U.S. offi cials TEHRAN | Iran on Tuesday Conte squeaks through on imposed sanctions on President Trump and a number of members of his outgoing administration vital Senate confi dence vote over what it called their role in support of “terrorism,” according BY FRANCES D’EMILIO has stubbornly refused to cede Mr. Conte’s tweet indicated he to its Foreign Ministry website. AND COLLEEN BARRY power since then, and many law- wanted to try to forge on, no matter Ministry spokesman Saeed ASSOCIATED PRESS makers have backed him in appar- how hobbled his coalition was left Khatibzadeh said sanctions were ent fear they would lose out if new by the defection of lawmakers loyal imposed on Mr. Trump, Secretary ROME | Italian Premier Gi- elections were called. to former Premier Matteo Renzi. ASSOCIATED PRESS of State Mike Pompeo, Treasury useppe Conte squeaked through An absolute majority in the Sen- Mr. Conte was widely ex- Italian Prime Minister Giuseppe Conte passed a confi dence vote in the Secretary Steven T. Mnuchin, a crucial Senate confi dence vote ate is 161, so to pass critical legisla- pected to pay a call on Mr. Mat- Senate on Tuesday. Th ere were 16 abstentions in the 156-140 vote. CIA chief Gina Haspel and six Tuesday night on his government tion, including aid to help Italy’s tarella, possibly on Wednesday, other ranking U.S. offi cials. with enough backing to keep his battered economy, Mr. Conte faces to brief the Italian head of state The spokesman said the wobbly coalition afl oat for now the unpleasant prospect on likely on whether he feels he can still Deputies, where the 16-month- “In view of the pandemic, sanctions were the result of the but without the reliable majority resorting often on support from effi ciently govern. old government holds a more there’s a need for a stronger gov- Trump administration’s role in he’ll need to eff ectively govern outside his coalition. In pitching for the Senate’s comfortable margin, Mr. Conte ernment,” Mr. Renzi argued. killing top Iranian Gen. Qas- the country with its pandemic- Noting his win in the Senate, backing, Mr. Conte acknowl- won a fi rst confi dence vote on Among those voting in Mr. sem Soleimani last year and its pummeled economy. Mr. Conte tweeted that “now edged his government’s survival Monday. Conte’s favor were the tiny ranks support for Israel in its confl ict The vote went 156 to 140 in his the aim is to make this majority was in its hands. “If we don’t have The political crisis was trig- of senators-for-life, who only oc- with the Palestinians. He also favor, there were 16 abstentions, more solid. Italy doesn’t have a the numbers, this government gered when the center-left Mr. casionally come to Parliament to cited a reported U.S. role in thanks to a small but key coalition minute to lose. Right to work to goes home,” he said. Renzi yanked his two ministers cast votes. the killing of Iranian nuclear ally that bolted the center-left overcome the health emergency Italy is rolling out its COVID- from his small, centrist Italia Viva Among them was Liliana Segre, scientist Mohsen Fakhrizadeh coalition last week, jeopardiz- and the economic crisis.” 19 vaccination program. It must (Italy Alive) party, in a spat over a 90-year-old Holocaust survivor in December and its role in the ing Mr. Conte’s survival at the If he had lost the confi dence also tell the European Union how how much control Mr. Conte who traveled from Milan to vote “criminal war” in Yemen. nation’s helm. Among the yes vote in Parliament’s upper cham- it plans to spend more than $240 would hold in deciding how the for the premier despite not yet re- — Associated Press votes were two defectors from the ber, Mr. Conte would have been million in funds earmarked by EU largesse gets spent. ceiving a coronavirus vaccination. center-right opposition party led required to resign. But without Brussels to help Italy’s health Mr. Renzi, in replying to Mr. The government crisis height- VENEZUELA by ex-Premier Silvio Berlusconi. absolute command of a major- system, sorely tested by the pan- Conte in the Senate on Tuesday, ened demands by the opposition U.S. sanctions levied Waiting in the wings were ity there, he could still opt to demic, and revive an economy, hammered away at what he con- for an election two years early. strong right-wing, anti-immigrant hand in his resignation to Italian which was stagnant for years be- tended was the government’s less- But Mr. Mattarella is considered for breaking embargo parties who bolted from the gov- President Sergio Mattarella, in fore pandemic lockdowns caused than-bold response to fi ghting the unlikely at this point to choose CARACAS | The Trump admin- ernment coalition in September a bid to be tapped anew to try many businesses to struggle to pandemic, including how funds that option, given the diffi culty of istration issued a parting shot to 2019 in hopes of taking power when to cobble together a revamped, survive. will be spent to revive Italy’s bat- organizing a campaign and vote socialist Venezuelan President the government fell. But Mr. Conte more dependable coalition. In the lower Chamber of tered economy. during a pandemic. Nicolas Maduro on Tuesday by announcing a sweeping round of stiff fi nancial sanctions that target a network accused of moving oil GUATEMALA groups, mostly family units, and on behalf of the president’s al- try to cross to Mexico almost leged frontman. immediately. The Treasury Department Show of force stops Some go to the bridge to re- hit three individuals, 14 busi- quest asylum, while others at- ness entities and six ships with tempt to cross the river. fi nancial measures. They are ac- caravan in Guatemala Where hundreds of migrants cused of assisting the Venezu- massed last January before cross- elan oil fi rm PDVSA, under Mr. Group of migrants shrinking rapidly ing into Mexico, this time Gua- Maduro’s control, of outma- temala’s highway roadblocks neuvering earlier U.S. sanctions BY OLIVER DE ROS hometowns. appear to have stopped most. designed to stop the president
ASSOCIATED PRESS Some 25 miles into Guatemala Most of those who have made it from profi ting from crude sales. where hundreds of migrants had through carry the required proof The fresh sanctions target EL FLORIDO, GUATEMALA | A been stalled at a roadblock in of a negative COVID-19 test and people and businesses linked to once large caravan of Honduran Vado Hondo for several days, passports, Rev. Cuevas said. Alex Saab, a Colombian business- migrants that pushed its way into traffi c fl owed smoothly Tuesday Rev. Cuevas said both sides of man who U.S. offi cials say is a Guatemala last week was shrink- and few migrants remained. Gua- ASSOCIATED PRESS PHOTOGRAPHS the river are militarized. In Tecun close associate of Mr. Maduro. ing rapidly by Tuesday in the face temala’s immigration authorities Honduran migrants walk to the border crossing aft er being transported Uman, Guatemala deployed large — Associated Press of Guatemalan security forces. reported that through Monday in an army truck to El Florido, Guatemala, a border point. A caravan of numbers of National Police who Small groups pressed on toward more than 2,300 migrants had Honduran migrants that pushed its way into Guatemala last week had made a local community cen- BRITAIN the Mexican border, while others been returned to Honduras. dissipated by Tuesday in the face of Guatemalan security forces. ter their barracks and patrol the Duchess seeks to avoid accepted rides from authorities If Guatemala’s government streets for migrants. Two buses back to Honduras. had indeed dissolved the year’s U.S. State Department’s Bureau from the Mexican government trial over letter Many of the migrants were fi rst caravan, it would be a relief of Western Hemisphere Aff airs, sit in the central plaza in front LONDON | Attorneys for the driven by an increasingly des- to the new U.S. administration. commended Guatemala via Twit- of his church waiting to drive Duchess of Sussex asked a British perate situation in Honduras, Mr. Biden has promised immigra- ter for “carrying out its respon- migrants back to the Honduras judge Tuesday to settle her law- where the economic ravages of tion reform, but for now plans to sibilities by responding appro- border, he said. suit against a newspaper before the COVID-19 pandemic and two leave Trump-era border policies priately & lawfully to the recent “We are seeing a situation a it goes to trial by ruling that its major hurricanes in November in place fearing a surge of mi- migrant caravan.” little diff erent from other years publication of a “deeply personal” have piled atop chronic poverty grants right as he takes offi ce. Central American migrants when the migrants had access letter to her estranged father was and gang violence. That com- Guatemala’s government had began turning increasingly to and free transit,” Rev. Cuevas said. “a plain and a serious breach of bined with a hope that the incom- made clear it would stop the cara- caravans as a low-cost alterna- His church had prepared for the her rights of privacy.” ing Biden administration would van for immigration and health tive to hiring a smuggler in 2018. In the past year, Guatemala arrival of migrants like a year ear- The former Meghan Markle, be more welcoming gave birth to reasons before it had even formed Migrants gain a degree of safety has become a critical bulwark lier, but now he expects few will 39, is suing Associated Newspa- the year’s fi rst caravan. in San Pedro Sula, Honduras, last in numbers and initially pushed against the caravans, spurred in make it. “We don’t expect them pers for invasion of privacy and But Tuesday, buses carrying week. President Alejandro Giam- successfully through Guatemala part by the more aggressive im- in great numbers nor organized. copyright infringement over dozens of migrants and police mattei said 2,000 police and sol- and Mexico. However, the U.S. migration policies of the Trump We don’t expect more than 100 at fi ve February 2019 articles in patrol vehicles carrying hand- diers would be sent to the border. government has led an eff ort to administration. Guatemalan one time will be here.” the Mail on Sunday and on the fuls arrived sporadically through Those forces did not stop the coordinate a more aggressive forces eff ectively blocked mul- Mexico had sent thousands MailOnline website that pub- the morning at the Guatemala- caravan at the border, but a series response from countries along tiple migrant caravans last year. of National Guard members lished portions of a handwrit- Honduras border crossing of of strategically placed roadblocks the way to try to keep them from In Tecun Uman, across the and immigration agents to that ten letter to her father, Thomas El Florido. They were passed where forces deployed tear gas advancing far. Suchiate River from Mexico, border last week in preparation. Markle, after her marriage to from Guatemalan border agents and batons eff ectively stymied Caravans still represent only the Rev. Fernando Cuevas said President Andres Manuel Lopez Britain’s Prince Harry in 2018. to their Honduran counterparts the mass of people. a fraction of the overall immi- Tuesday there aren’t more than Obrador has promised to respect Associated Newspapers is con- and then boarded buses that On Tuesday, Michael Kozak, gration fl ow that moves largely 70 migrants in the border town. human rights, but also to enforce testing the claim. would take them back to their acting assistant secretary for the undetected. Those that arrive do so in small an orderly, legal migration. — Associated Press WEDNESDAY, JANUARY 20, 2021 ☆ R FROM PAGE ONE | A11
just the latest for human rights viola- CHINA tions in western China. In July, three From page A1 senior Chinese Communist Party offi - cials, including Politburo member Chen “Beijing’s atrocities in Xinjiang repre- Quanguo, the party secretary of Xinjiang; sent an extreme aff ront to the Uighurs, Zhu Hailun, Xinjiang party secretary for the people of China, and civilized people the political and legal committee; and everywhere …,” Mr. Pompeo said in a Wang Mingshan, party secretary for the statement. “If the Chinese Communist Xinjiang public security bureau, were Party is allowed to commit genocide targeted for sanctions. and crimes against humanity against Additional restrictions have been its own people, imagine what it will be imposed on imports of Chinese cotton emboldened to do to the free world, in from western China that may have been the not-so-distant future.” produced with Uighur prison labor. Beijing gave no immediate response State Department officials who to the actions, but the Chinese Foreign briefed reporters on the action said Ministry said this week that it was pre- genocide was designated after a lengthy paring sanctions and travel restrictions review of evidence. The offi cials de- on the U.S. — Mr. Pompeo in particular clined to say how many Uighurs have — for past actions that displayed “mali- died under the repression because esti- cious intent” regarding Beijing’s policies mates of the toll were vague. on Hong Kong and Taiwan. On the types of forced sterilization, China has repeatedly denied the re- one offi cial said the activities involved pression in Xinjiang and asserted that its government sterilization, forced abortion actions there are part of an anti-terrorism and forced implantation of birth control reeducation program. devices. Uighur women have been forced Some rights groups praised the geno- to marry non-Uighur men, and Uighur cide designation and pressed the incom- children have been taken from parents. ing Biden administration to maintain ASSOCIATED PRESS “These are things we have all docu- pressure on Beijing. Uighur children in China’s western Xinjiang region have few playmates. Th e communist government has poured hundreds of mented,” the offi cial said. “Ninety per- “As refl ected in numerous reports by millions of dollars into birth control and has forced abortions and sterilizations on Uighurs. Secretary of State Mike Pompeo is cent of what we relied on is open-source journalists and scholars, the evidence of credited for shining “an essential light on China’s horrifi c actions … and correctly calls this persecution what it is: genocide.” information.” genocide is signifi cant and substantial,” The genocide in Xinjiang was traced said Refugees International President to March 2017 after Chinese leaders is- Eric Schwartz. “The secretary’s state- liberty of more than 1 million civilians, U.S. officials said the decades of Human rights groups have identifi ed sued policy statements and declarations ment underscores the importance of forced sterilization, torture of a large repression of the Uighurs rapidly ex- more than a dozen concentration camps on the Uighurs around that time. appropriate international investigations number of those arbitrarily detained, panded after March 2017 under Mr. Xi where Uighurs have been held and say A crackdown also followed riots by and prosecutions of offi cials for the forced labor, and the imposition of and included ethnic Kazakh and Kyrgyz the Chinese government has launched Uighurs in 2009 in Urumqi, a city in crime of genocide in Xinjiang.” draconian restrictions on freedom of residents. The State Department state- global disinformation campaigns and Xinjiang. China’s military was forced The U.S. Commission on Interna- religion or belief, freedom of expression, ment said the policies were “designed denied human rights observers access to call out internal security troops and tional Religious Freedom said Mr. and freedom of movement,” he added. systematically to discriminate against to the region. tanks to put down the riots. Pompeo’s decision “shines an essential “I believe this genocide is ongoing, and surveil ethnic Uighurs as a unique The declaration of genocide is part “On or around March 2017 [the CCP] light on China’s horrifi c actions … and and that we are witnessing the system- demographic and ethnic group, restrict of the outgoing Trump administration’s launched a new ‘strike hard’ campaign,” correctly calls this persecution what atic attempt to destroy Uighurs by the their freedom to travel, emigrate, and campaign to portray China’s communist the offi cial said. it is: genocide and crimes against Chinese party-state,” he said. attend schools, and deny other basic leadership as heading a “Marxist-Lenin- A second offi cial argued that the humanity.” More than 1 million Uighurs have human rights of assembly, speech and ist regime that exerts power over the repression directly followed from the Calling for an international fact-fi nd- been placed in concentration camps in worship.” long-suff ering Chinese people through nature of the Chinese regime. ing mission to investigate the situation in China’s western Xinjiang region, accord- “PRC authorities have conducted brainwashing and brute force,” Mr. Pom- “When you’re talking about 36 mil- Xinjiang, the religious freedom commis- ing to the U.S. government. forced sterilizations and abortions on peo said. lion deaths under Mao, the huge number sion said, “The incoming Biden admin- Uighur women, coerced them to marry “While the CCP has always exhibited of people who have suff ered and died istration has the unique opportunity to Crackdown under Xi non-Uighurs, and separated Uighur a profound hostility to all people of faith, under the communist regime in China, continue the hard work of confronting The Uighurs are a Turkic ethnic group children from their families,” said the we have watched with growing alarm the this is what communist regimes do.” China’s atrocities.” originally from Central and East Asia statement, noting that China has called party’s increasingly repressive treatment “To use the language of communist Mr. Pompeo said the designation of with a total population of 13.5 million, in- the Uighurs “malignant tumors” and of the Uighurs and other ethnic and reli- doctrine, you have a new communist crimes against humanity in Xinjiang cluding about 12 million in China. Some compared their Muslim faith to a “com- gious minority groups,” he said. bourgeoisie who then crushes the pro- followed a close examination of open- Uighurs have sought to reestablish an municable plague.” The statement also said interna- letariat,” the third offi cial said. “These source and intelligence fi ndings regard- independent state called East Turkistan, The statement called on China to tional judicial authorities should join the sorts of camps like the Uighurs are in ing the Chinese communist govern- prompting a fi erce crackdown by Beijing. immediately release all those detained United States in seeking accountability and these sorts of mass atrocities are ment’s treatment of the predominantly The Trump administration said the in Xinjiang and abolish the system of for those behind the genocide and that sickeningly common in these sorts of Muslim Uighurs and other ethnic and campaign against Uighurs was launched internment. U.S. offi cials are gathering and sharing regimes.” religious minorities. under President Xi Jinping, who has The mass detentions and repression the information they have. The designation is expected to trigger “These crimes are ongoing and in- sought to enforce communist ideologi- activities have been assisted by mass sanctions on certain Chinese offi cials clude: the arbitrary imprisonment or cal conformity among China’s 1.4 billion electronic identifi cation and surveillance Continuing pressure that would bar them from entering the other severe deprivation of physical people since taking power in 2012. of Uighurs, U.S. offi cials said. The moves announced Tuesday were United States.
endorsed Mr. Mayorkas’ nomination. ICE “I can tell you, Mayorkas understands From page A1 the importance of not opening up the fl oodgates,” said Brandon Judd, presi- permanent solution to what is clearly dent of the NBPC. “I’m looking at what a broken system,” he told the Home- Mayorkas did during the Obama admin- land Security and Governmental Aff airs istration, and he did give us resources Committee. to try to hold people pending proper The panel is controlled by Republi- proceedings.” cans for now, but leadership will transfer He said he doesn’t expect Mr. Mayor- to Democrats when Georgia’s two newly kas to maintain all of the Trump policies elected senators take the oath of offi ce. that were eff ective in stemming the 2018 That should pave Mr. Mayorkas’ path and 2019 border surges, but he added that to confi rmation, despite a withering 2015 others under consideration for the post inspector general’s report that accused were less palatable. him of political favoritism during his Also backing Mr. Mayorkas are im- time as director of U.S. Citizenship and migrant rights activist groups on the left, Immigration Services in the Obama even though his time in the Obama ad- administration. ministration included detaining and de- That report, released after Mr. May- porting families and erecting the chain- orkas was elevated to deputy secretary link fence enclosures at border stations at the Department of Homeland Secu- used to hold children, and which critics rity, said he intervened in cases involv- dubbed “cages” in the Trump years. ing major Democrats: Senate Majority Under questioning from Sen. Ron Leader Harry Reid, Democratic National Johnson, Wisconsin Republican, Mr. Committee Chairman Terry McAuliff e Mayorkas acknowledged that those and Pennsylvania Gov. Edward G. Ren- chain-link pens were built on his watch. dell. Mr. Mayorkas had his agency ap- Still, he vehemently rejected the accusa- prove visa applications from wealthy tion that families were separated during foreign investors tied to projects of those his time in offi ce. three men. What the Obama administration did He violated his own ethics rules, too, ASSOCIATED PRESS PHOTOGRAPHS do was vastly expand the detention the audit found. Homeland Security Secretary nominee Alejandro Mayorkas has years of experience at the department but said at least 15 times network to hold families so they could The inspector general’s report also during his confi rmation hearing Tuesday that he would need to study an issue before explaining how he would approach it. be deported. said Mr. Mayorkas was strident and Left-leaning activist groups have sig- prickly in his dealings with underlings to the panel. naled that they are willing to overlook at USCIS. Such charges in the past have Despite his experience, Mr. Mayorkas that history for the chance to get a derailed high-level nominations. said at least 15 times during the hearing homeland security secretary who can be Mr. Mayorkas vehemently rejected that he would have to study an issue confi rmed by an evenly divided Senate the inspector general’s fi ndings at the before he could give an answer about and can erase Trump policies. time. He said Tuesday that he found a how he would approach a certain matter. They also hope that this administra- broken agency that was getting cases That included questions such as how the tion will be able to legalize most illegal wrong and, as director, he felt he had department has performed during the immigrants. to step in and force the right decisions. pandemic and whether ICE needs more President George W. Bush and Presi- “It is my job to become involved, funding or personnel. dent Obama tried but failed to get legisla- to learn the problems that an agency “I will have to study the condition tion through Congress. confronts, to become involved in those of Immigration Customs Enforcement, The proposal to offer citizenship problems, and to fi x them. That’s what I how effi ciently and eff ectively it is using rights to as many as 11 million illegal im- did in this case,” he said. its resources, and how it is best serving migrants will be presented to Congress Mr. Mayorkas spent more than four the American public. That requires my on Wednesday, Mr. Mayorkas said. years at the helm of USCIS, then three study,” he said. According to news reports, it will years as deputy secretary at the full Mr. Mayorkas also said he needs to not include any new border security or Homeland Security Department, where study the newly enacted spending law interior enforcement provisions. Past he served under Secretary Jeh Johnson. to fi gure out whether the $1.375 billion Senate proposals included hundreds of Democrats said that time in offi ce was included for border infrastructure can miles of border wall, thousands more his chief selling point because it meant be siphoned away from wall-building. immigration agents and new rules to he won’t need to get acquainted with the He did say, however, that President-elect try to block businesses from turning to issues facing Homeland Security while Joseph R. Biden has made clear that he illegal labor. the sprawling department is dealing would prefer not to build another foot Sen. Marco Rubio, a Florida Repub- with the COVID-19 pandemic, cyberse- of wall. lican who worked on the last major im- curity breaches, a potential border surge The nominee also demurred when Sen. Ron Johnson, Wisconsin Republican, asked Mr. Mayorkas about chain-link pens migration push in 2013, called Mr. Biden’s and growing threats from right-wing asked whether any of the more than to hold immigrant children caught at the border. Th e nominee acknowledged the pens plan a “nonstarter” for Republicans. extremists. 450 miles of wall built under Mr. Trump were built on his watch but rejected the accusation that families were separated. “There are many issues I think we can “I believe Ali is uniquely qualifi ed to should be pulled down. work cooperatively with President-elect face the challenges before DHS,” said “I haven’t looked at that specifi c ques- Biden, but a blanket amnesty for people Sen. Dianne Feinstein, the California tion,” he said. support from a striking range of parties. the union for Border Patrol agents that who are here unlawfully isn’t going to Democrat who introduced Mr. Mayorkas Mr. Mayorkas’ nomination has The National Border Patrol Council, strongly backed President Trump, has be one of them,” he said in a statement. A12 | FROM PAGE ONE ☆ R WEDNESDAY, JANUARY 20, 2021
“In years past, the city and federal CAPITOL government spent money on inaugu- From page A1 ration security; in return, they usually received additional sales tax revenues Airbnb, which reported its “biggest night from all the events associated with the ever” for bookings in the District dur- inauguration,” Leah Brooks, associ- ing the 2017 inauguration of President ate professor of economics at George Trump, canceled and blocked all reser- Washington University, said in an email vations this week because of security Tuesday. “This year, the area is surely concerns. spending much more on security, and Maggie Daniels, a professor of tour- there is very little spending by the inau- ism and events management at George guration going into the local economy. Mason University, said Tuesday that In other words, a much worse return “with safety and security being the para- on investment.” mount considerations, all tourism sec- Congress approved the District’s initial tors are impacted.” request last year for $34.9 million to cover “The loss of income will be felt most inauguration-related expenses. The law- severely by hourly employees and gig makers, however, have not greenlighted workers who would generally accrue an additional $10 million sought in recent signifi cant overtime wages as pertaining months for “the heightened number of to the many events surrounding the in- First Amendment demonstrations we’ve auguration,” Ms. Daniels said in an email. seen,” D.C. Homeland Security Director Only 1,000 tickets have been distrib- Christopher Rodriguez said last week. uted to members of Congress to attend Mr. Rodriguez noted that Mr. Trump the ceremony, compared with the usual on Jan. 11 authorized a pre-emergency 200,000. Soon-to-be President Joseph R. declaration for the city. The authoriza- Biden’s primary audience as he takes the tion means the federal government will oath of offi ce will be a “Field of Flags” foot the bill for any emergency protective representing Americans who cannot measures linked to federal assistance attend because of the pandemic and through Jan. 24. unprecedented security precautions. While the loss of revenue from the The National Park Service on Tues- inauguration will be substantial, it is day reversed course and said no dem- “tiny compared to the lockdown” overall, onstrations will be permitted at park Anthony Yezer, a professor of economics grounds on Inauguration Day. ASSOCIATED PRESS at George Washington University, said Most of the traditional activities, such National Guard troops have reinforced the security zone on Constitution Avenue. Gone is the usual celebratory atmosphere of Tuesday. as the inaugural parade, balls and con- Inauguration Day, with masses of people descending on the National Mall to witness a presidential swearing-in ceremony. “Asking the economic eff ect of having certs, have been canceled or restricted no crowds for the inauguration on D.C. is by capacity limits or are being conducted like asking about the eff ect of a splinter in virtually. the city’s roughly 4.6-mile-square se- In addition, the FBI’s warning of inauguration has prompted offi cials to the hand of a person who has been shot Road and bridge closures, coupled curity perimeter, are making it diffi cult the potential threat of armed demon- encourage visitors to stay away from with a gun,” Mr. Yezer said in an email. with public transportation service cuts for anyone — residents, employees and strators posing as some of the 25,000 Washington, all while the region’s busi- “Yes, the splinter is annoying but the and various security checkpoints along visitors alike — to enter the city. National Guard troops activated for the nesses bear the brunt of the impact. patient is going to die from the gunshot.”
BIDEN’S BIG DAY BIDEN Joseph R. Biden will be sworn in Wednesday as the 46th president of the United From page A1 States. A slate of virtual and live events will try to project normalcy on an Inauguration Day that is anything but normal, thanks to COVID-19 precautions and a strategist Jim Manley, who served as militarized zone erected against the threat of pro-Trump violence. a top aide to Harry Reid when he was Swearing-in at noon Senate majority leader. Mr. Reid, who retired in 2017 after ◾ Mr. Biden is sworn in as president at the U.S. Capitol representing Nevada for 30 years, has by Chief Justice John G. Roberts Jr. argued that Mr. Biden should give Re- ◾ Mr. Biden will put his hand on his family Bible, which will be held by his wife, Jill. publicans three weeks to work with ◾ His inaugural address, “America United,” will aim to heal the him before moving to scrap the Senate nation during a time of division and a historic pandemic. fi libuster, allowing passage of bills with a simple majority. Wreath-laying at Arlington National Cemetery Mr. Manley said he expects Mr. Biden, ◾ Aft er the swearing-in, Mr. Biden and newly sworn-in Vice President who spent four decades in the Senate, to Kamala D. Harris will lay a wreath at Arlington National Cemetery. be more patient. Plus, he is not convinced ◾ Th e Clintons, Bushes and Obamas are expected to attend. that Senate Democrats are eager to kill the legislative filibuster. He pointed “Parade Across America” at 3:15 p.m. out that Sen. Joe Manchin III of West ◾ During the traditional inaugural parade, Mr. Biden and Ms. Harris will be Virginia has publicly opposed the idea. escorted by the military and marching band drum lines from the University “The question for me is how long of Delaware and Howard University, their alma maters, respectively. President-elect Biden is going to give ◾ Th e “Parade Across America,” celebrating all 56 states and territories, Republicans to try and negotiate com- will travel down Pennsylvania Avenue just a few blocks, from 15th promises before he focuses more on Street to the White House, instead of the usual route from the Capitol. executive actions,” he said. “The problem Most of the traditional parade events will be livestreamed. is after seeing 147 House Republicans “Celebrating America” broadcast at 8:30 p.m. vote hours after the riots in the Capitol ◾ to steal the election one last time, it is A prime-time television broadcast hosted by Tom Hanks will feature performances from singers, actors and other Hollywood celebrities. very diffi cult to imagine things changing anytime soon.” ◾ Performances are expected by “Hamilton’s” Lin-Manuel Miranda, Jon Mr. Biden plans to hit the ground run- Bon Jovi, John Legend, Bruce Springsteen and Justin Timberlake. ning with a series of executive directives ◾ Actresses Eva Longoria and Kerry Washington will introduce and legislative proposals that in some various segments during the 2½-hour broadcast. cases seek to unwind parts of President THE WASHINGTON TIMES Trump’s agenda and that will go a long way in defi ning the early innings of his presidency. Senate, a closely divided House and a Manley said. Mr. Biden plans to rescind Mr. ASSOCIATED PRESS presidential candidate who said he’d Mr. Biden and Ms. Harris traveled to Trump’s travel bans on many predomi- Joseph R. Biden has 36 years of experience in the Senate and eight years in the White represent everyone,” he said. “So our Washington on Tuesday to participate in nantly Muslim countries, rejoin the Paris House as vice president, giving him the institutional knowledge he will likely need to marching orders from the American a national COVID-19 memorial service climate accord, and extend limits on navigate the corridors of power in Washington and cut through partisan gridlock. people are clear. We are to have robust at the Lincoln Memorial ahead of their evictions and foreclosures for people discussions and seek common ground. swearing-in on Wednesday. struggling to pay their rent or mortgages. We are to pursue bipartisan agreement The inauguration is set to be a scaled- On the legislative front, Mr. Biden has strategist, said Mr. Biden will have some in Washington “it is Joe Biden.” everywhere we can.” down — and mostly virtual — event a $1.9 trillion emergency relief plan that room to get Americans vaccinated and “The problem is unfortunately these Sen. Richard Blumenthal, Connecti- given the violent assault on the Capitol includes billions of dollars for a national get caught up in traditional legislative are truly unprecedented times of hyper- cut Democrat, said he hopes the parties by a pro-Trump mob and concerns about vaccination program and reopening battles on other fronts. partisanship and some of these members can see eye to eye in a time of crisis “un- COVID-19, which has killed more than schools, $1,400 stimulus checks and a “I think broadly on vaccinations and of Congress, both in the House and like anything we’ve seen in our lifetime,” 400,000 Americans. $15 federal minimum wage. on a secondary matter on coronavirus, he Senate, are very extreme and have made but he said he is skeptical of Republicans’ Ms. Harris will be sworn in by Su- He is pledging to deliver 100 million will have a lot of support,” Mr. Jennings it quite clear they have no inclination willingness to work with Mr. Biden. preme Court Justice Sonia Sotomayor, COVID-19 vaccinations in 100 days and said. “I think the way Republicans may to work with the new president,” Mr. “I think they are going to take it one and Mr. Biden will be sworn in by Chief planning to push a rewrite of immigra- be interpreting this is, ‘We will work Cooper said. day at a time. One issue at a time,” he Justice John G. Roberts Jr. tion laws that calls for a path to citizen- with you, but we will not roll over for “Because of these, I believe he is said of a Biden White House. “Obviously, Mr. Biden and Ms. Harris will then ship for illegal immigrants. the far-left agenda’” now that Kamala going to be moving aggressively — not there’s a lot of suspicion and doubt on visit Arlington National Cemetery to lay Adding to the frenzy, the Senate will Harris, as vice president, will hold the just the fi rst 100 days, even the fi rst day our side given the history of McCon- a wreath at the Tomb of the Unknown take up an article of impeachment from tie-breaking vote in the Senate. in offi ce — to do what he can through nell in the minority under the Obama Soldier. the House that charges Mr. Trump with Mr. Jennings said a big challenge for executive action because it is not going administration.” They will be joined by former Presi- the “incitement of insurrection” after Mr. Biden will be getting the left fl ank of to be easy to put together a bipartisan Mr. Manley said the next president dents Barack Obama, George W. Bush a pro-Trump mob stormed the Capitol his party to understand that he won’t be coalition — particularly in the Senate, also faces challenges in the lower cham- and Bill Clinton, and former fi rst ladies two weeks ago. able to pass their liberal priorities with where a simple majority is not enough ber, where House Speaker Nancy Pelosi Michelle Obama, Laura Bush and Hill- It all will test Mr. Biden’s insistence a snap of his fi ngers. to pass legislation,” he said. doesn’t have much wiggle room when it ary Clinton. that the 36 years he spent in the Senate “His challenge is to get his people to Speaking on the Senate fl oor Wednes- comes to shepherding Mr. Biden’s agenda From there, Mr. Biden and Ms. Har- and eight years as vice president have understand that some portion of a loaf is day, Republican leader Mitch McConnell through a divided Democratic caucus. ris will receive a military escort to the given him the institutional knowledge better than no loaf at all,” he said. of Kentucky forecast his approach. He “She is going to have to spend a lot White House, kicking off a virtual “Pa- needed to navigate the corridors of Jon Cooper, a longtime Biden sup- said the November elections “did not more time and energy touching all the rade Across America” livestream event power in Washington and cut through porter, past donor and informal adviser to hand any side a mandate for sweeping corners of the caucus getting people featuring communities across the nation. partisan gridlock. his presidential campaign, said if anyone ideological change.” on board, and it is going to slow things ⦁ Alex Swoyer and David Sherfi nski Scott Jennings, a Republican Party can cut through the political partisanship “Americans elected a closely divided down and time is of the essence,” Mr. contributed to this report.
DEATH NOTICE
Bamber zerne, NY on July 5, 1980, and the couple Michael, Emersyn Joy; and Joseph 2211 Lakeview Dr. Johnson City, TN. lived most of their married life in Waldorf, Daniel (Jessica Saltzman) of Edwards Air The family wishes to thank Amedisys Michael Francis MD, where they raised their children. Force Base, CA who are expecting their Hospice and Sentinel Home Care, espe- Age 68 They moved to Gray, TN in 2011. fi rst child this summer. cially Peyton and Taylor, for the compas- Michael retired from the United States The family of Michael Bamber will re- sionate care given to Michael and Jane Michael Francis Bamber, 68, of Gray, Secret Service, after a 20-year career, ceive friends from 11:00 AM to 12:00 over the last several weeks. TN, passed away peacefully on Thursday, in 1996. Michael was a veteran of the pm at St. Mary’s Catholic Church on Memories and condolences may be January 14, 2021 at home with his loving United States Army, serving as an artillery Wednesday, January 20, 2020. A funeral shared with the family via www.morris- family at his side. surveyor for the 18th Airborne Corps out mass, offi ciated by Fr. Dustin Collins, will baker.com Born on July 15, 1952, in Washington, of Fort Bragg, NC. follow at 12:00 PM. A committal service Morris-Baker Funeral Home and Cre- DC, he is the son of the late Richard C. Michael leaves behind his wife, Jane, will be held at 2:00 PM at the Mountain mation Services, 2001 E. Oakland Ave., Bamber and Ruth Heaton Bamber. Mi- and two sons of whom he is most proud: Home National Cemetery Annex, 215 He- Johnson City, is serving the Bamber fam- chael graduated from Archbishop Carrol Richard Michael (Kimberly Parody) of roes Drive, Johnson City TN, 37601. ily (423) 282-1521. High School, Washington, DC, in 1972. Staff ord, VA who gave him 3 beautiful In lieu of fl owers, donations may be Please sign the Guestbook at He married Jane Washburn of Lake Lu- grandchildren; Hadley Grace, Camden made to St. Mary’s Catholic Church, www.legacy.com/washingtontimes WEDNESDAY, JANUARY 20, 2021 ☆ R LIFE | A13
TODAY’S BIRTHDAY (Jan. 20). You’ll enjoy the perks ENTERTAINMENT and rewards coming to you in 2021. And while you’re given many opportunities, the ones you like best are self-initiated. You’ll get creative and put diligent eff ort Hollywood, music world serving up fresh releases into making something that matters to you. You’ll scale ASSOCIATED PRESS it up with an elegant system to make your vision go live. Identity” fi lmmaker and “Black Skinhead” and is that refl ect on current events in Virgo and Sagittarius adore you. Your lucky numbers Here’s a collection curated by written by Steven Knight the group’s fi rst song to America. are: 4, 44, 48, 18 and 39. The Associated Press’ entertain- (“Dirty Pretty Things,” chart on the Billboard ARIES (March 21-April 19). People pass every day; ment journalists of what’s arriv- “Eastern Promises”), the Hot 100 chart. Another Television transactions occur — pleasantries and less. But a meet- ing on TV, streaming services and fi lm debuts Thursday on track, “Slow Down,” bor- ⦁ A real-life killer who terrorized ing of the minds such as the one you’ll have today is not music platforms this week. HBO Max. rows from the Smashing Californians in the mid-1980s is the a thing to take lightly. ⦁ Another acclaimed Pumpkins’ mid-90s hit subject of Netfl ix’s limited, four-part TAURUS (April 20-May 20). Movies film from the virtual “1979,” while Skrillex, documentary series, “Night Stalker: HOLIDAY Devotion comes at a cost. When- ⦁ Regina King’s directorial debut festival circuit, Sam Timbaland and Travis The Hunt for a Serial Killer,” debuting MATHIS ever you say yes to one thing, you “One Night in Miami” brings Mu- Pollard’s “MLK/FBI,” King Barker contribute to the Wednesday. The brutal crime wave are saying no to other things. It hammad Ali (Eli Goree), Malcolm debuts on demand and album’s production. began in the Los Angeles area during HOROSCOPE cannot be any other way. If you X (Kingsley Ben-Adir), Jim Brown in theaters Friday. Mr. ⦁ A year after their a long, hot summer in 1985, with men, are not conscious of what you are (Aldis Hodge) and Sam Cooke (Les- Pollard, a frequent editor for Spike last live gig, Jimmy Eat World will women and children among the vic- saying yes and no to, it becomes lie Odom Jr.) together into a Miami Lee, examines J. Edgar Hoover perform their entire 10th studio tims of after-dark killings and assaults. clear now. hotel in February 1964, celebrating and the FBI’s surveillance and album, 2019’s “Surviving,” on Fri- First-person interviews, archival foot- GEMINI (May 21-June 21). How often a thing happens Ali’s knockout of Sonny Liston. The harassment of Martin Luther King day. It’s one of three performances age and original photography help is a signifi cant and defi ning characteristic of its nature. setup, from the play by Kemp Pow- Jr. — widely considered one the from the band’s Phoenix Sessions. recount the crimes and the hunt for Establishing a rhythm matters; otherwise, no one can ers (co-director of Pixar’s “Soul”), is darkest chapters in FBI history. It’s On Jan. 29 they will perform their the man responsible. dance to the song. fi ctional, but the dialogue — about a murky story dealing with King’s fi fth eff ort, 2004’s “Futures,” and on ⦁ Even an Emmy-winning dra- CANCER (June 22-July 22). It’s clicking for you. power, freedom and Black identity extramarital aff airs but, more im- Feb. 12, they will perform “Clarity,” matic actor like Kyra Sedgwick When you throw the dice in front of a movie crew and — rings bracingly true. The fi lm, portant, about the federal govern- their third album, released in 1999. (“The Closer”) can’t resist comedy. your character needs to win, the numbers are irrelevant. which played at the top festivals in ment’s racist attempts to control Tickets start at $14.99. Miss Sedgwick, who has had a re- You’re a winner if you act like one. Take it. the fall, premieres Friday on Ama- and thwart the civil rights leader. ⦁ Bob Dylan’s grandson is curring role as police Deputy Chief LEO (July 23-Aug. 22). Confl ict is healthy. People are zon Prime. releasing an EP created during Madeline Wuntch on “Brooklyn animals. Animals need to establish territory. Feel good ⦁ Shot during the early days Music the early days of the pandemic Nine Nine,” stars in the new ABC that people around you express themselves. Listen and of the pandemic, Doug Liman’s ⦁ Three years after releasing while the world was on lockdown. sitcom “Call Your Mother” as a communicate your way to peace. “Locked Down” is one of the most their full-length debut album, boy Pablo Dylan, the son of fi lm di- parent who fl ees her empty nest VIRGO (Aug. 23-Sept. 22). Fate has spoken, and quite notable projects to emerge from band Why Don’t We are back with rector Jesse Dylan who has col- to get back into her children’s lives favorably. So don’t question and wonder whether you’re quarantine yet. Starring Anne Hath- their sophomore release “The laborated with Erykah Badu and — whether they like it or not. The working hard enough. Accept the bounty of a perfect away and Chiwetel Ejiofor, “Locked Good Times and the Bad Ones.” A$AP Rocky, is putting out the cast of “Call Your Mother,” debut- plan coming together, even if it wasn’t yours. Down” centers on a couple put into The 10-track album includes fi ve-song set called “Solitude” on ing 9:30 p.m. Wednesday, includes LIBRA (Sept. 23-Oct. 23). Who do you think you lockdown just as they are deciding the single “Fallin’ (Adrenaline),” Friday. The acoustic-fl avored EP Rachel Sennott, Joey Bragg and are? It’s an impertinent question from a stranger and a to separate. Directed by the “Bourne which samples Kanye West’s is the fi rst in a series of three EPs Emma Caymares. relevant and enlightening question from you to you. The answer is not one thing. You are becoming. SCORPIO (Oct. 24-Nov. 21). What keeps you from following your own advice? Likely, it’s a confl ict between what the head and body want. To communicate your Son may be hasty in plan to sign up for fatherhood wishes to the body, you must translate them into the body’s language. DEAR ABBY: My 25-year-old dating? — TOO MUCH, TOO SOON grandmother (who raised her) to grandmother that she will never SAGITTARIUS (Nov. 22-Dec. 21). There’s a dynamic son has been dating a girl for two DEAR TOO MUCH, TOO SOON: Al- post anything on Facebook where speak to me again. Was what I playing out. Give it time. Try not to judge anything or or three months. She seems very though it can be diffi cult to convince I can see what she is doing. did so bad, and what should I do make decisions while you’re in the thick of it. Let things nice. She has two children and someone in the throes of new love, you My granddaughter came to live now? — OTHER GRANDMOTHER IN settle, and then see where you’re at. is pregnant with her third child. and your son’s friends should urge him with me last summer because NORTH CAROLINA CAPRICORN (Dec. 22-Jan. 19). You want to measure She’s due in three months. Th e to discuss this with a lawyer before she worked a summer job here. DEAR OTHER: What you said your progress, though today, it’s unclear what the most child is not my son’s. signing ANYTHING. He needs input I asked her if she was gay, not wasn’t “bad,” but it was misinformed relevant metric would be. How do you measure a feel- I was told by some friends of from someone who is not emotionally because I think she is but as a and heavy-handed. While same-sex ing? Maybe in what you’re willing to do to experience my son that involved and can explain the legal prelude to a conversation about relationships do happen in high school or avoid it. ABIGAIL he’s planning ramifi cations of what he’s considering. not allowing other girls to recruit and college, young people don’t usu- AQUARIUS (Jan. 20-Feb. 18). Document what hap- VAN BUREN to sign the Not all romances have storybook her into a same-sex relationship ally indulge unless they are already at pens today, because later, you will fi nd the evidence birth certifi- endings, but if this relationship leads as I saw in college and while least bi-curious. Even then, straight reassuring and probably entertaining. Furthermore, DEAR ABBY cate as the to marriage in the future, he can al- teaching public school. Although I people don’t suddenly “turn gay.” you might be able to take something about this to father. He un- ways adopt or provide fi nancially for tried to explain, things have grown Your granddaughter may still the bank. derstands the the child if he wishes. I sincerely hope progressively worse. be trying to fi gure out her sexual PISCES (Feb. 19-March 20). As a rule, most things implications. How do I convince you and the others who care about him My son and her mother mar- orientation, which could be why you chase are going to run from you. Seduction works him that, although he feels like he can get through to your son. ried when she was 7 and divorced she has reacted so strongly. If you best in a variety of instances. For instance, it’s the ones and this girl will be together for the DEAR ABBY: My college-aged when she was 13. Over the years, are wise, you will allow her the time who don’t seek validation who tend to get it, a principle long haul, this is a poor decision to granddaughter is no longer I worked hard to develop and she needs to sort it out, rather than that also works in reverse. make, especially because of the speaking to me, answering my maintain a relationship with push or panic. CREATORS.COM short length of time they have been phone calls or allowing her other her. Now, she has told the other ANDREWS MCMEEL SYNDICATION
▶ ▶ ▶ ▶ ▶ ▶ ▶ ▶ ▶ ▶ ▶ ▶ LOCAL 6:30 PM 7:00 7:30 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 NBC 4 ’ NBC Nightly ’ 4 NBC News ’ 4 News ’ Inauguration- ’ Celebrating America Tom Hanks hosts a cele- ’ Chicago P.D. Atwater goes ’ 4 News ’ 4 Tonight Show-J. Fallon NBC 11 News - Holt 11 Inside 11 Hollywood Biden bration. (N) (L) under cover. (N) 11 News 11 Tonight Show-J. Fallon Wednesday FOX 5 ’ 5 Fox 5 News ’ 5 Fox 5 ’ 5 TMZ ’ The Masked Dancer Three ’ 9:02 Name That Tune Players ’ 5 Fox 5 News at 10 (N) ’ 5 News ’ 5 The Final 5 ’ 5 Extra (N) TV FOX 45 45 FamFeud 45 Jeopardy 45 Wheel dancers advance. (N) test their knowledge of songs. 45 FOX 45 News at 10 (N) 45 News 45 Seinfeld 45 Seinfeld ABC 7 ’ ABC World ’ 7 Wheel ’ 7 Jeopardy ’ Inauguration- ’ Celebrating America Tom Hanks hosts a cele- ’ The Conners ’ Call Your ’ 7 News ’ 11:35 Jimmy Kimmel Live! ABC 2 News 2 News 2 Funny You Biden bration. (N) (L) (N) Mother (N) 2 News CBS 9 ’ CBS Evening ’ 9 The Q&A ’ Entertainment ’ To Be An- ’ Celebrating America Tom Hanks hosts a cele- ’ Magnum P.I. The search for a ’ 9 9 News ’ 11:35 The Late Show With CBS 13 News 13 News Tonight (N) nounced bration. (N) (L) missing person. 13 News Stephen Colbert (N) (L) MNTV 20 ’ Family Feud ’ Family Feud ’ Family Feud ’ Fox 5 News ’ Family Feud ’ Fox 5 News ’ Schitt’s Creek ’ Big Bang ’ Big Bang ’ Dateline ’ Dateline CW 50 ’ Funny You ’ black-ish ’ black-ish ’ Riverdale ’ Nancy Drew ’ Seinfeld ’ Seinfeld ’ Two/Half Men ’ Two/Half Men ’ Goldbergs IND 4.2 ’ Little House ’ The Munsters ’ The Munsters ’ Frasier ’ Frasier ’ Roseanne ’ Roseanne ’ Roseanne ’ Roseanne ’ The Nanny ’ The Nanny ’ The Nanny ION 66 ’ Blue Bloods ’ Blue Bloods ’ Blue Bloods ’ Blue Bloods “Identity” ’ Blue Bloods ’ Blue Bloods “The Real Deal” ’ Blue Bloods PBS 22 ’ NewsHour ’ Queens ’ MotorWeek ’ Nature (N) (Part 2 of 2) ’ NOVA “Decoding da Vinci” ’ When Disaster Strikes ’ Amanpour and Company (N) ’ Nature PBS 26.4 ’ NHK Newsline ’ Young People ’ POV Boys face challenges growing up. ’ Frontline “President Biden” ’ PBS NewsHour (N) ’ The Day ’ World News ’ Young People MOVIES ▶7:00 PM ▶8:00 ▶9:00 ▶10:00 ▶11:00 ▶12:00 AMC ’ 5:00 Forrest Gump ★★★★ (1994) ’ Twister ★★★ (1996, Act.) Helen Hunt, Bill Paxton, Cary Elwes. ’ The Intern ★★ (2015) Robert De Niro, Anne Hathaway. Flix ’ 6:15 Legally Blonde 2: Red, White & Blonde ’ Tyler Perry’s Daddy’s Little Girls ★★ (2007) ’ 9:45 John Grisham’s The Rainmaker ★★★ (1997, Dra.) Matt Damon. ’ Tammy T-Rex FXM ’ Maze Runner: Scorch Trials ’ 7:35 Maze Runner: The Death Cure ★★ (2018) Dylan O’Brien, Thomas Brodie-Sangster. ’ 10:25 Maze Runner: The Death Cure ★★ (2018) HBO ’ High Note ’ 7:15 30 Coins “Memories” (Subtitled-English) ’ 8:20 Wrath of the Titans ★ (2012, Fan.) ’ C.B. Strike ’ 11:05 The Fast and the Furious ★★ (2001) HBO2 ’ Tiger Tiger Woods’ unparalleled rise to fame. ’ Tiger Tiger Woods’ double life. (Part 2 of 2) ’ 9:45 New Year’s Eve ★ (2011) Halle Berry, Jessica Biel. ’ 11:45 The Change-Up ★★ IFC ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men ’ Two/Half Men LMN ’ 6:00 A Daughter’s Deception (2019, Dra.) ’ Deadly Daughter Switch (2020, Susp.) Lindsay Hartley. ’ A Daughter’s Plan to Kill (2019) Claire Coffee, Matt Dallas. ’ Deadly Switch Max ’ 5:47 John Wick: Chapter 3 -- Parabellum ’ Human Capital (2019, Dra.) Liev Schreiber. ’ 9:40 Munich ★★★ (2005, Susp.) Eric Bana, Daniel Craig, Geoffrey Rush. MoreMax ’ 5:49 Bangkok Dangerous ★ ’ The Texas Chainsaw Massacre ’ Fear ★★ (1996, Susp.) Mark Wahlberg. ’ 10:37 Requiem for a Dream ★★★ (2000) Ellen Burstyn. TheMovieCh ’ 6:00 Hustlers ★★★ (2019) Constance Wu. ’ On the Basis of Sex ★★ (2018, Bio.) Felicity Jones. ’ Woman Walks Ahead ★★ (2017, Wes.) ’ 11:45 Desert Hearts ★★ Showtime ’ Rambo Part II ’ 7:15 Rambo III ★★ (1988, Act.) Sylvester Stallone. ’ Boxing ShoBox: The New Generation. (N) (L) ’ Gone Baby Gone ★★★ Showtime2 ’ 5:30 The Truth (2019, Dra.) ’ 7:20 Source Code ★★★ (2011, Susp.) ’ Alex Cross ★ (2012, Act.) Tyler Perry. ’ 10:45 Full Metal Jacket ★★★ (1987, War) Matthew Modine. Starz ’ 6:38 Public Enemies ★★★ (2009) Johnny Depp, Christian Bale. ’ 9:01 Dawn of the Dead ★★★ (2004, Hor.) ’ 10:45 Charlie’s Angels (2019) Kristen Stewart, Naomi Scott. STZENC ’ In Line of Fire ’ 6:54 Glory ★★★★ (1989, War) Matthew Broderick. ’ Godzilla ★★ (1998, Sci-fi.) Matthew Broderick, Jean Reno. ’ 11:22 Brightburn ★★ (2019) Kennedy McMann stars in “Nancy Drew” Wednesday on Th e CW. Sundance ’ Criminal ’ Criminal Minds ’ Criminal Minds “No. 6” ’ Criminal Minds ’ Criminal Minds ’ Criminal Minds ’ Criminal TurnerCM ’ 6:15 Mighty Joe Young ★★★ (1949, Fan.) ’ Murder, She Said ★★★ (1961, Com.) ’ 9:45 Murder at the Gallop ★★★ (1963) ’ 11:15 Murder Most Foul ★★★ (1964) BEST BETS SPORTS NEWS & SPORTS ▶7:00 ▶8:00 ▶9:00 ▶10:00 ▶11:00 ▶12:00 CNBC ’ Mad Money ’ Shepard Smith ’ Shark Tank ’ Shark Tank ’ Shark Tank ’ Shark Tank ’ S. Smith The Inauguration of Joe Biden Premier League Soccer / 3:10pm CNN ’ 5:00 The Inauguration of Joe Biden (N) (L) ’ Inaugural Concert Tom Hanks, Justin Timberlake and more. (N) (L) ’ Inauguration / 12:00pm (CNN) The inauguration of (NBCSP) Manchester City vs Aston Villa. (N) ESPN ’ SportsCenter ’ NBA Basketball Boston Celtics at Philadelphia 76ers. Wells Fargo Center. (N) ’ NBA Basketball Phoenix Suns at Houston Rockets. Toyota Center. (N) (L) ’ SportsCenter Joseph R. Biden Jr. as the 46th president NBA Basketball / 6:55pm (SportsNET) ESPN2 ’ Daily Wager ’ College Basketball Teams TBA. (N) (L) ’ College Basketball Cincinnati at Temple. Liacouras Center. ’ Basketball ’ UFC 257 ’ NFL Live of the United States promises to be an Washington Wizards at Charlotte Hornets. (N) FoxNews ’ Bret Baier ’ The Story With Martha ’ Tucker Carlson Tonight (N) ’ Hannity (N) (L) ’ The Ingraham Angle (N) (L) ’ Fox News at Night ’ Tucker event unlike any previous such occasion, NBA Basketball / 7:00pm (ESPN) Bos- MASN ’ ESPNEWS (N) ’ College Basketball Clemson at Georgia Tech. (N) (L) ’ Fight Sports WCK (N) ’ Fight Sports ’ McGee’s Pro Football Plus ’ Orioles Classics with some familiar traditions eschewed ton Celtics at Philadelphia 76ers. (N) NBCSP ’ 6:00 NHL Live ’ NHL Hockey Edmonton Oilers at Toronto Maple Leafs. Scotiabank Arena. (N) ’ NHL Hockey Minnesota Wild at Anaheim Ducks. Honda Center. (N) (L) ’ NHL Overtime SportsNET ’ Wizards Pre ’ 6:55 NBA Basketball Washington Wizards at Charlotte Hornets. (N) (L) ’ Wizards Postgame Live (N) ’ Football ’ Premier League Soccer Fulham vs Chelsea. in light of health concerns vis-a-vis the College Basketball / 7:00pm (ESPN2) ▶ ▶ ▶ ▶ ▶ ▶ COVID-19 pandemic. In fact, Biden’s Teams TBA. (N) VARIETY CABLE 7:00 8:00 9:00 10:00 11:00 12:00 A&E ’ Court Cam ’ Court Cam ’ Court Cam ’ Court Cam ’ Court Cam ’ Court Cam (N) ’ Court Cam (N) ’ Wild ’ Wild ’ Court Cam ’ Court Cam ’ Court Cam transition team has been actively urging College Basketball / 7:00pm (MASN) Animal Plnt ’ North Woods ’ North Woods Law ’ North Woods Law: Uncuffed “Riders Gone Rogue” (N) ’ North Woods Law ’ North Woods Law ’ North Woods the American public to stay home and Clemson at Georgia Tech. (N) ’ ’ ’ ’ ’ ’ ’ share in the ceremonies either via the BBC Planet Earth Planet Earth: Life Planet Earth: Life Planet Earth: Life Planet Earth: Life “Primates” Planet Earth: Life “Fish” Planet Earth NHL Hockey / 7:00pm (NBCSP) Edmon- BET ’ 6:03 Tyler Perry’s the Family That Preys ★★ (2008, Dra.) Kathy Bates. ’ 9:05 Tyler Perry’s Madea’s Big Happy Family ★★ (2011, Com-Dra.) Tyler Perry. ’ Martin massive coverage from the broadcast ton Oilers at Toronto Maple Leafs. (N) Bravo ’ Housewives ’ Housewives/OC ’ Housewives/OC ’ Housewives/OC ’ Real Housewives ’ Watch What ’ Housewives/OC networks and major cable news outlets or College Basketball / 9:00pm (ESPN2) Cartoon Net ’ Teen Titans ’ Wrld, Gumball ’ Wrld, Gumball ’ Bob’s Burgers ’ Bob’s Burgers ’ American Dad ’ American Dad ’ Rick, Morty ’ Rick, Morty ’ Family Guy ’ Family Guy ’ Chicken several streaming options. Public safety, Cincinnati at Temple. (N) Comedy Ch ’ South Park ’ South Park ’ 7:45 South Park ’ South Park ’ South Park ’ South Park ’ South Park ’ South Park ’ Daily Show ’ South Park ’ South Park not pomp, is the prime consideration for NBA Basketball / 9:30pm (ESPN) Phoe- Discovery ’ Undercover ’ Undercover Billionaire ’ Undercover Billionaire Grant tries to regain his footing. (N) ’ 10:10 Moonshiners ’ 11:10 Moonshiners ’ Undercover these ceremonies. nix Suns at Houston Rockets. From the Toyota Disney ’ Jessie ’ Raven ’ Raven ’ Liv-Mad. ’ Liv-Mad. ’ Raven ’ Raven ’ Big City ’ Bunk’d ’ Bunk’d ’ Sydney-Max ’ Jessie Celebrating America / 8:30pm Center in Houston. (N) Disney XD ’ Amphibia ’ Owl Hse. ’ Owl Hse. ’ Owl Hse. ’ Parker Plays ’ Phineas, Ferb ’ Phineas, Ferb ’ Amphibia ’ Amphibia ’ Player Select ’ Player Select ’ Owl Hse. (4,7,13, MSNBC) Tom Hanks hosts this NHL Hockey / 9:30pm (NBCSP) Minne- DIY ’ Old House ’ Old House ’ Old House ’ Holmes Inspection ’ Holmes Inspection ’ Holmes Inspection ’ Holmes Inspection ’ Holmes new 90-minute special, which also airs on sota Wild at Anaheim Ducks. (N) E! ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Mod Fam ’ Nightly Pop ’ Sex-City ABC, CBS, CNN and MSNBC. The program, Food Net ’ Guy’s Games ’ Guy’s Grocery Games ’ Guy’s Grocery Games ’ Guy’s Grocery Games (N) ’ Kitchen Crash (N) ’ Guy’s Grocery Games ’ Guy’s Games which will spotlight and honor American NEWS & TALK Freeform ’ Bride Wars ★ (2009, Com.) Kate Hudson, Anne Hathaway. ’ 27 Dresses ★★ (2008, Rom.-Comedy) Katherine Heigl, James Marsden. ’ The 700 Club ’ The Simpsons heroes, airs in conjunction with today’s fX ’ Skyscraper ’ Jurassic World: Fallen Kingdom ★★ (2018, Adv.) Chris Pratt, Bryce Dallas Howard. ’ Jurassic World: Fallen Kingdom ★★ (2018, Adv.) Chris Pratt. ’ ’ ’ ’ ’ ’ ’ ’ ’ ’ ’ ’ inauguration of President Joe Biden and Today / 7:00am (4) Inauguration cover- FYI Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars Storage Wars age. GAC ’ Flippin’ RVs ’ Flippin’ RVs ’ Going RV ’ Going RV ’ Going RV ’ Going RV ’ Going RV ’ Going RV ’ Going RV ’ Going RV ’ Going RV Vice President Kamala Harris. Demi Lovato, Galavision ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Vecinos ’ Sin miedo a la verdad (N) ’ Vecinos / Justin Timberlake, Jon Bon Jovi and Ant Live with Kelly and Ryan 9:00am Hallmark ’ 6:00 My One & Only (2019) Pascale Hutton. ’ A Country Wedding (2015) Jesse Metcalfe, Autumn Reeser. ’ Golden Girls ’ Golden Girls ’ Golden Girls ’ Golden Girls ’ Golden Girls Clemons are scheduled to perform, along (7) Kate Mara (A Teacher); Jonathan Scott; ’ ’ ’ ’ ’ ’ ’ ’ ’ ’ ’ winterizing a home. HGTV 100 Day 100 Day Dream Home House-Hurry House-Hurry One Week To One Week To Hunters Hunters Int’l Hunters Hunters Int’l One Week To with several other entertainers to be an- History Ch ’ Forged in Fire ’ Forged in Fire ’ Forged in Fire (Part 1 of 2) ’ Forged in Fire (Part 2 of 2) ’ 10:03 Forged in Fire ’ 11:03 Forged in Fire ’ Forged in Fire nounced later. The Wendy Williams Show / 9:00am Lifetime ’ 6:00 Married at First Sight ’ Married-Sight ’ Married at First Sight Groom surprised by prospective bride. ’ 10:03 Marrying Millions (N) ’ 11:03 Married at First Sight ’ Married-Sight (20) Michael Ealy (Fatale); beauty gadgets. Nancy Drew / 9:00pm (50) This MTV ’ Ridiculous. ’ Ridiculous. ’ Ridiculous. ’ The Challenge “Double Agents” (N) ’ Ridiculous. ’ Ridiculous. ’ Ridiculous. ’ Ridiculous. ’ Ridiculous. ’ Ridiculous. Rachael Ray / 10:00am (7) Fried Nat’l Geo ’ A Smuggler ’ To Catch a Smuggler ’ To Catch a Smuggler ’ To Catch a Smuggler (N) ’ Narco Wars (N) ’ To Catch a Smuggler ’ Narco Wars audacious new reboot of the vintage chicken; teens who are super heroes in their Carolyn Keene literary mysteries served Nickelodeon ’ 6:00 Rio ★★★ (2011) Jesse Eisenberg ’ Side Hustle ’ Danger Force ’ Sheldon ’ Sheldon ’ Friends ’ Friends ’ Friends ’ Friends ’ Friends community; chicken with pears and ginger. Noggin ’ PAW Patrol ’ Blaze ’ Blaze ’ Santiago ’ Blue’s Clues ’ Peppa Pig ’ Peppa Pig ’ Peppa Pig ’ Peppa Pig ’ Bubble ’ Blue’s Clues ’ Peppa Pig ample notice in Season 1 that this is not The Drew Barrymore Show / 3:00pm your grandmother’s “Nancy Drew,” as OWN ’ Dateline ’ Dateline on OWN (Part 2 of 2) ’ 20/20 on OWN ’ 20/20 on OWN (Part 1 of 2) ’ 20/20 on OWN (Part 2 of 2) ’ 20/20 on OWN ’ 20/20, OWN (7) Hailee Steinfeld (Dickinson); Karamo ★★★ 9:15 ★★ ’ Kennedy McMann’s resourceful female PARMT ’ Two/Half Men ’ The Italian Job (2003, Crime Drama) Mark Wahlberg. ’ Mr. & Mrs. Smith (2005, Act.) Brad Pitt, Angelina Jolie, Vince Vaughn. Day After Brown (Queer Eye); Drew shares the latest Science ’ Earth ’ BattleBots “Sin City Slasher” ’ BattleBots “Sin City Slasher” ’ BattleBots: Mega Fights ’ Engineering Catastrophes ’ BattleBots sleuth is played as a very modern young news. ’ 6:45 ★ ’ ★★ ’ ★★★ woman with a mind — and occasion- Syfy Law Abiding Citizen (2009, Susp.) Jamie Foxx, Gerard Butler. Jumanji (1995, Children’s) Robin Williams, Bonnie Hunt. Beetlejuice (1988) Michael Keaton. Maury / 4:00pm (50) Maury checks in TBS ’ Family Guy ’ Big Bang ’ Big Bang ’ Big Bang ’ Big Bang ’ Big Bang ’ Big Bang ’ Big Bang ’ Full Frontal ’ Conan (N) ’ Full Frontal ’ Seinfeld ally a libido — of her own. As the series with some of his memorable past guests and TLC ’ 6:00 My 600-Lb. Life “Carrie’s Story” ’ My 600-Lb. Life “Cindy’s Story” (N) ’ 1000-Lb. Sisters ’ My Feet Are Killing Me ’ My 600-Lb opens Season 2, watch for those super- gives updates on their stories. TNT ’ 6:00 Tag ★★ (2018) Ed Helms, Jon Hamm. ’ All Elite Wrestling: Dynamite (N) (L) ’ The Replacements ★★ (2000, Com.) Keanu Reeves, Gene Hackman. natural elements like sea spirits and Conan / 11:00pm (TBS) Guest Max TruTV ’ Inside Jokes ’ Inside Jokes ’ Inside Jokes ’ Inside Jokes ’ Inside Jokes ’ Imp. Jokers ’ Imp. Jokers ’ Imp. Jokers ’ Imp. Jokers ’ Imp. Jokers ’ Imp. Jokers ’ Imp. Jokers curses to become even more prominent. Greenfield. TVLand ’ Andy Griffith ’ Andy Griffith ’ Andy Griffith ’ Raymond ’ Everybody Loves Raymond ’ Raymond ’ Raymond ’ Raymond ’ King ’ King ’ King Scott Wolf, Maddison Jaizani and Alex The Tonight Show Starring Jimmy TVOne ’ FamilyMatters ’ FamilyMatters ’ FamilyMatters ’ Unsung “Cheryl Pepsii Riley” ’ Unsung “Chante Moore” ’ Unsung “Michel’le” ’ Bernie Mac ’ Bernie Mac ’ Bernie Mac Saxon are among the returning series Fallon / 11:35pm (4) Martin Scorsese; Univision ’ Noticiero Uni. ’ La Rosa de Guadalupe ’ Te doy la vida ’ Amor eterno (N) ’ Como tú no hay dos ’ Noticiero Uni. ’ Noticiero Uni ’ Deportivo veterans. Fran Lebowitz; Hunter Schafer. USA ’ 6:00 NCIS ’ NCIS “Twenty Klicks” ’ WWE NXT (N) (L) ’ 10:08 Hancock ★★ (2008) Will Smith, Charlize Theron. ’ Straight Up VH1 ’ Martin ’ White Chicks ★★ (2004, Com.) Shawn Wayans, Marlon Wayans. ’ All About the Benjamins ★★ (2002) Ice Cube, Mike Epps. ’ White Chicks ★★ (2004) LEGEND: (L)=Live (N)=New (ITV)=Interactive Television (PA)=Parental Advisory ■ (Shaded)=Movies ’ ’ ’ ’ ’ ’ ’ ’ TMS MOVIE RATINGS: ★★★★ Excellent ★★★ Good ★★ Fair ★ Poor No stars: not rated WGN-A Last-Standing Last-Standing Last-Standing NewsNation (N) (L) NewsNation (N) (L) NewsNation (N) (L) NewsNation NewsNation A14 | METRO ☆ R WEDNESDAY, JANUARY 20, 2021
“In the midst of the starkest polarization since the Civil War, may we use MLK Day yesterday and @JoeBiden’s inauguration tomorrow to heal our needless divisions.” Metro — D.C. Delegate Eleanor Holmes Norton, on Twitter
REGION BRIEFLY About 18% of eligible residents have received shot THE METRO AREA
U.S. Postal Service, public transit practitioners to administer vac- REGION District leads region in coronavirus vaccine effort and grocery stores. cines at its borders. Last week, Gov. Larry Hogan In Virginia, Gov. Ralph Amtrak cancels trains BY SHEN WU TAN A total of 304,562 people in correctional officers and non- announced the state would make Northam last week said he is look- ahead of inauguration THE WASHINGTON TIMES Virginia have received at least one health care staff supporting vac- 50,000 doses available to health ing to have the entire state move to dose, and 36,826 have received cination clinics are allowed to facilities focused on the elderly as Phase 1B by the end of the month. Amtrak announced all About 18% of the nearly 3.6 both doses of the two-shot vac- get vaccinated. The second tier the state expanded eligibility for The phase, which includes front- Northeast Regional trains south million people eligible for coro- cines produced by drugmakers of Phase 1B includes law enforce- all residents 65 and older. line essential workers, people liv- of Washington, D.C., which navirus vaccinations in Maryland, Pfi zer or Moderna. ment and public safety staff , K-12 “The biggest bottleneck in ing in group settings and those 75 includes all stations in Virginia, Virginia and the District have All three jurisdictions are car- school staff , child care facility the allocation and distribution of years old or older, has expanded to will be canceled Tuesday and received at least one coronavirus rying out Phase 1B of their vac- employees and grocery workers. COVID-19 vaccines is not enough cover people 65 and older or those Wednesday amid heightened vaccine dose, data from regional cination plans, allowing more The District fi rst began vac- is coming into the state from the aged 16 to 64 with an underlying security concerns following health departments show. groups of people to be vaccinated. cinating long-term care residents, federal government. Right now, medical condition or disability. the deadly attack on the U.S. As of Tuesday, health offi cials The D.C. Health Department health care workers, and fi re and the federal government is only Since there is not a “suffi cient Capitol. had administered shots to 648,098 opened up vaccinations for all EMS staff last month. giving us 10,000 doses a day for supply” to vaccinate everyone in Amtrak auto train services residents in the three jurisdic- health care workers and residents Starting this week, Maryland- the 1.5 million people who are Phase 1B at the same time, the Vir- will be unaff ected, but The tions, which have a total com- aged 65 and older on Monday, ers aged 75 and older, those living currently eligible,” said Charles ginia Department of Health said Carolinian, a daily train that bined population of about 15.27 and the 1,436 appointments that in group facilities, education staff Gischlar, spokesman for Mary- health districts are prioritizing runs between Charlotte, North million people. opened were all booked. and child care providers and gov- land Department of Health. frontline workers in the following Carolina, to New York City, will The District is leading in the On Saturday, the District an- ernment workers became eligible Bob Atlas, president of the order: 1. Police, fi re and hazmat; 2. operate only between Raleigh regional vaccination eff ort, hav- nounced that 4,309 vaccination to get shots as the state moved to Maryland Hospital Association, Corrections and homeless shelter and Charlotte, the company said ing administered 41,053 doses appointments were open to eli- its next phase. said its clinics are completely workers; 3. Child care/preK-12 in a news release. (66%) of the 62,200 shots it has gible residents in Wards 1, 4, 5, 7 Beginning Monday, the state booked for vaccinations. teachers/staff ; 4. Food and agri- “After last week’s violent received from the federal govern- and 8 — the fi ve wards with the will move into Phase 1C, which Maryland officials also are culture, including veterinarians; attack on the U.S. Capitol, ment. Maryland has distributed fewest number of residents with covers adults aged 65-74, health launching a pilot program with 5. Manufacturing; 6. Grocery store we are taking extra steps to 265,657 doses (48%) of the 551,700 appointments as of last week. and safety workers not covered Walmart and Giant stores on Jan. workers; 7. Public transit workers; continue ensuring the safety of it has received, and Virginia has Under Phase 1B, residents and in Phase 1A and essential workers 25 to distribute vaccines at their 8. USPS and private mail carriers; our employees and customers administered 341,388 doses (36%) staff of facilities such as group in lab services, food/agriculture pharmacies and have issued a new 9. Offi cials essential for continuity in Washington DC and across of the 943,400 it has received. homes and homeless shelters, production, manufacturing, the allowance for out-of-state health of government such as judges. our network as we prepare for the Inauguration,” the statement said. Additionally, Interstate 66 VIRGINIA and Interstate 395 bridges con- necting Virginia to Washing- ton will be closed from 6 a.m. Tuesday to 6 a.m. Thursday, the ‘Better with age’: Virginia Department of Trans- portation said. The Arlington Memorial Essays of seniors Bridge also will be closed. — Associated Press pursuing passions DISTRICT Hogan visits state National Writers bridge past with present Guard soldiers at Capitol
BY KATHLEEN SHAW Martha Woodroof is a re- Maryland Gov. Larry Hogan DAILY NEWS-RECORD tired author and radio host for traveled to Washington to WMRA and NPR whose per- visit soldiers from the state’s HARRISONBURG, VA. | In child- sonal essay is titled “Dancing National Guard and received a hood, parents and schools pave With Cancer.” security briefi ng ahead of the the way of exploration into hob- For several decades, Ms. presidential inauguration, his bies and interests, and college Woodroof has championed the offi ce said. off ers a gateway into new worlds idea of embracing one’s age and Mr. Hogan was joined Mon- of obscure sports and pastimes. fi nding beauty in all stages of ASSOCIATED PRESS PHOTOGRAPHS day by Maryland’s Brig. Gen. Once people enter adulthood, life. With stage four cancer in National Guard troops hold inside the Capitol to reinforce security. Th e scene is reminiscent of the Civil Janeen L. Birckhead, who has there’s little time for activities her lungs and salivary glands, War. Dr. Bowman Bigelow Breed was a member of the 8th Massachusetts Volunteer Militia, which been chosen to command Na- between a nine-to-fi ve, but is Ms. Woodroof continues looking was bivouacked in the U.S. Capitol Rotunda in the early days of the war. tional Guard troops at the U.S. that the end of self-discovery and at life as a grand adventure and Capitol, the Supreme Court and creative pursuits? her diagnosis as a companion DISTRICT the Library of Congress build- “Better With Age: Creativ- until death. ings in support of U.S. Capitol ity, Discovery & Surprises” is Dancing is an innate passion Police. a collection of personal essays of Ms. Woodroof, and she said — Associated Press submitted from writers ages 65 to moving and grooving along to National Guard troops sleeping 95 who rediscover or reinvest in old-time rock ’n’ roll brings her VIRGINIA their interests. Sharing empow- a joy that no diagnosis could ever in Capitol echoes Civil War erment through physical pursuits take away. FREDERICKSBURG and arts or refl ecting on aging, “I may be dying, but I want to BY ALLEN G. BREED communication was cut off and that you were Police: Man fi res gun the glue between each story is keep living until I’m dead. I don’t ASSOCIATED PRESS torn hour after hour by the terrible suspense of how the writers draw upon their want a dying person to be my last hope deferred,” he apologized to Hannah, who during road rage incident pasts and ages to embrace their career,” she said. To most Americans, the sight of armed Na- was left alone to care for their infant son, Isaiah. Police say that a man fi red present selves. Several contributing authors tional Guard troops sleeping in the Capitol Ro- “Don’t despond my darling. God will preserve us multiple shots at a car after Co-editor Bob Bersson has are far from professional writers, tunda this past week was shocking and disturbing. all and in time of war you must have faith in the apparently becoming upset always been active in the literary, but co-editor Jack Greer, who has To me, it was an echo of the far-distant past. handy old proverb that no news is good news.” because the other driver cut visual and performing arts. dedicated his life to literature, “Don’t despond,” Maj. Bowman Bigelow Breed While the enlisted men slept in the Rotunda, him off . At 70, he refused to succumb said the submissions surpassed wrote to his anxious wife back home in Massachu- the 10 offi cers shared a small room just off the The Free Lance-Star to the imminent fear of his abili- his expectations, and the fi nal setts as his comrades lounged around him on the main hall. reported that the incident oc- ties fading and decided to take publication culminated into an polished marble fl oors in the grand hall that was “A little room opening from that serves for curred Monday afternoon in a leap. elegant arrangement of essays. now their bivouac. “You must know by this time my hospital, very small and very inconvenient,” Spotsylvania County. When he saw the Dayton Tav- “It’s not really a happy talk that we are here in safety. We may have to fi ght Bowman wrote. “I have not been able to open my Spotsylvania Sheriff ’s Maj. ern was preparing to open in book, feel-good self-help book. but my own opinion is that the overwhelming medical stores yet and can use only what I can Troy Skebo said the other driver 2017, he contacted owner Diane It’s deeper than that, and I think force concentrated here will prevent an attack.” carry about in my bag. I have been on the run Ever was grazed on the leg by one of Roll about off ering music night Martha’s story is an example of Insurrection was in the air, and these citizen since I came here, trying to arrange matters, but the shots. But no one was seri- so he could pick up his lost love that, which she takes on with soldiers had been called up to secure the seat of red tape rules here and I have been referred from ously injured. of playing guitar. careful exuberance,” Mr. Greer government. one to another till I am tired out.” Charles Krieter, 32, faces “I really wanted to do some- said. “Age can take many things The date was April 27, 1861. The writer was sur- The Capitol was undergoing a massive expan- charges of shooting into an thing where I could keep growing away from you and your muscle geon of the 8th Massachusetts Volunteer Militia. sion. The regimental chaplain held services in the occupied vehicle and using a because the stereotype and to a mass, your short-term memory, My great-grandfather. old Senate chamber. fi rearm in the commission of degree the actuality of getting those kinds of things, but it Having transcribed my great-grandparents’ “The men all stood in a circle with the offi cers a felony. He was placed in the into your 60s, 70s, 80s and 90s doesn’t have to be viewed as a Civil War correspondence, I knew that Bowman’s on one side and the chaplain in the centre,” he Rappahannock Regional Jail. and some of your powers are time of decline.” unit had spent the fi rst days of the war bivouacked wrote. “He made a very appropriate prayer and — Associated Press in decline,” Mr. Bersson said. When Ms. Roll ordered a copy in what he called “the Hall of the Dome.” Harper’s then we all sang, ‘Praise God from whom all “That idea of decline is pretty from Amazon, Mr. Bersson di- Weekly published an illustration of the 8th’s men, blessings fl ow.”’ HAYMARKET powerful.” rected her to read a blurb that their weapons leaned against the marble walls or The day after their arrival, Bowman and his Boy dead aft er being His fi rst night returning to recounted the days leading up stacked, bayonets intertwined, like fodder shocks comrades were treated to a visit from Secretary a stage and performing for an to his fi rst return on stage and in a farmer’s fi eld. of State William H. Seward and the president hit by cars on highway audience was nerve-wracking. the sweet memories of fi lling the “I wish you could look in on us this morning himself. Authorities are investigating Gradually, he became familiar restaurant with warm jazz. and see how comfortably we are settled here,” “We were all introduced and had quite a chat the death of a 13-year-old boy and comfortable with the scene Ms. Roll said reading the expe- he wrote in that fi rst missive, scribbled on let- with them,” he wrote. “They were both in good who was struck by two vehicles. and played there every Tuesday rience through Mr. Bersson’s eyes terhead for the “Thirty Sixth Congress House of spirits. Lincoln said that if the city had been as Prince William County Po- evening for the next four years, brought her to tears and renewed representatives.” unprotected then as it was a week before it would lice said offi cers were called to until the pandemic brought live her spirits, working and operating The regiment called itself “the Minutemen,” have been taken.” the area of James Madison High- music to a halt. a business during the pandemic. after those New England patriots who grabbed The regiment was drawn up, Bowman said, way and Dominion Valley Drive Curious what other feats of “I’ll tell you what broke my their muskets and rushed to face the Redcoats at “and the Pres made them a little speach.” It was in Haymarket shortly after 11:15 courage and rediscovery his heart, what a sweet gesture, and Lexington and Concord in April 1775. My great- early in the Republican’s fi rst term, and most did p.m. Sunday. friends and colleagues had ven- I never would in a million years grandmother, Hannah Pope Breed, was descended not yet know what to make of this “dirty Hoo- Investigators said a motor- tured and overcome during their would have guessed they were from one of those men. sier,” as Hannah referred to the Kentucky-born, ist was traveling southbound later halves of life, Mr. Bersson nervous,” she said. “You can see And, so, when President Abraham Lincoln Indiana-bred Lincoln. on James Madison Highway sent an email prompt to which beauty in things that some people called for 75,000 volunteers to put down the “All that has Ever been said of Lincolns awk- approaching Dominion Valley he received nearly 30 responses. can take for granted, and when insurrection of the Southern states, there was no wardness is mild compared with the reality,” Drive when his vehicle struck a Twenty-nine of those voices you read a book like that it can question but that Bowman — privileged son of a Bowman wrote. “Some of his gestures would make person in the road. are shared in “Better With Age.” make someone stop and appreci- wealthy industrialist — would go. the fortune of a circus clown.” A second vehicle in the same His own story is printed in ate there is a little clarinet in your The 8th headed south just four days after rebels Nonetheless, the new president inspired con- travel lane also may have struck the essay “Playing Through My restaurant.” opened fi re on Fort Sumter. Passing through hos- fi dence in the citizen soldiers. the person, who was still in the Fears” and is in company of sev- “Better With Age” was pub- tile territory in slaveholding Maryland, Bowman “The men gave three cheers for Lincoln, three roadway, a short time later. eral local contributors such as lished in August and is available was unable to fulfi ll his promise to write every day. for Seward and three rouses for the Union,” Bow- Both drivers stopped nearby Chris Bolgiano, Ruth Stoltzfus for purchase on Amazon or at “How I have suff ered when I knew that all man wrote. and contacted police. Jost and Harvey Yoder. OASIS Fine Art & Craft. — Associated Press ▶ Editorial: Good luck, President Biden / B2 LEGAL ADS INSIDE B5 OOMMENTARYMMENTARY WEDNESDAY, JANUARYC 20, 2021 ☆ R SECTION B Of course soon-to-be Tehran’s al Qaeda connection ex-President Trump One of the reasons Biden should not enrich Iran’s rulers wants 21-gun farewell salute By Cliff ord D. May fter the attacks of Sept. 11, 2001, By Joseph Curl President George W. Bush drew a line in the sand. “Every nation, in onald J. Trump sure is a piece of work, isn’t he? Aevery region, now has a decision to The guy loses the presidential election, not make,” he said. “Either you are with us, or you by a little, by a lot, then claims he was robbed via are with the terrorists.” Dvote fraud, a charge more than 60 courts dis- Since then, some nations have fought with missed for lack of evidence, then stokes an insurrection by us, putting lives on the line. Some have of- his brainwashed followers, who run amok for hours in the fered moral support. But a few have aided and U.S. Capitol in a violent riot that left one police offi cer dead. abetted the terrorists. The House promptly impeached him for the second time, a We distinguished among them. Until we fi rst in U.S. history. didn’t. After all that, Mr. Trump wants a massive military parade For 37 years, under Republican and to bid him farewell, replete with a 21-gun salute. Democratic administrations alike, the Islamic Forget the irony that the 21-gun salute is fi red at noon Republic of Iran has been designated as a of the day of the funeral of a president, ex-president, or state sponsor of terrorism. president-elect (of course, Mr. Trump isn’t dead … just his Tehran sponsors Hezbollah in Lebanon, political career and Syria and his entire legacy). other POLITICALPOLITICAALL But to have deceived coun- Americans for tries, Shia THEATER months about the militias in Iraq, Houthi rebels in Yemen, and BY JOSEPH CURL outcome of the 2020 Hamas and Palestinian Islamic Jihad in Gaza. presidential election, What about al Qaeda? In the early 1990s, along with refusing to Hezbollah trained al Qaeda operatives in the concede — for the record, no defeated presidential candi- Bekaa Valley of Lebanon. date has ever refused to concede — and THEN ask for the In 1998, an indictment issued by a U.S. honor … well, talk about chutzpah. district court stated that al Qaeda had “forged Not only is Mr. Trump a sore loser, something parents alliances” with the “government of Iran and teach their children to outgrow by the time they’re 10, he its associated terrorist group Hezbollah for won’t be attending the inauguration of his successor, Joseph the purpose of working together against their R. Biden. Instead, he’s going to fl ee Washington, D.C., early perceived common enemies in the West, Wednesday morning. Why? particularly the United States.” According to CNN, so he can leave town as president In 2011, a federal judge in New York ruled aboard the presidential plane — which will still use the call that the Tehran regime had provided support sign “Air Force One.” for the attacks of Sept. 11, 2001. See, any plane the From 2011 to 2016, the Obama administra- president is on is called tion repeated in formal terrorist designations Air Force One. But if Mr. and other offi cial statements that the Iranian Trump left after having regime had a “secret deal” with al Qaeda become an ex-president, that allows the group to “to funnel funds and his plane would just be operatives through” Iranian territory. a plane — and he’d even Under President Obama, the Treasury and have to ask Mr. Biden for State Departments described this network permission to use it. inside Iran as al Qaeda’s “core facilitation “He also did not par- pipeline,” identifi ed its leader as Yasin al-Suri, ticularly like the thought who had been allowed by “Iranian authori- ILLUSTRATION BY LINAS GARSYS of requesting the use of ties” to operate inside Iran since 2005. This the plane from Biden,” month, the State Department revealed that he “to fundraise, to freely communicate with al These documents are key for understand- CNN reported, citing “a is still working inside Iran. Qaeda members around the world, and to per- ing how al Qaeda operates — in Iran and Trump person familiar with the A letter written by Osama bin Laden, form many other functions that were previ- many other countries. But, as noted, the fact matter.” found by the Navy SEALS who killed him in ously directed from Afghanistan or Pakistan.” that AQ had an “agreement” with the Iranian Then reports emerged 2011, included this: “Iran is our main artery He added: “As a result of this assistance, al regime had been revealed by the Obama ad- that Mr. Trump was reportedly planning an unprecedented for funds, personnel, and communication … Qaeda has centralized its leadership inside of ministration years earlier. Why NIAC would farewell event at Joint Base Andrews in Maryland, where There is no need to fi ght with Iran unless you Tehran.” not want additional information released I Air Force One is hangared. are forced to.” He named and announced sanctions on leave for you to consider. “Offi cials are considering an elaborate send-off event Another document seized during that two such AQ leaders, and designated three The Obama administration ended up reminiscent of the receptions he’s received during state vis- raid, but not released until 2017, states that al members of an al Qaeda-linked group that, he transferring billions of dollars to Iran’s rulers its abroad, complete with a red carpet, color guard, military Qaeda operatives in Iran were given “every- said, operates on the border between Iran and in exchange for their promise to slow-walk band and even a 21-gun salute, according to a person famil- thing they needed,” including “money, arms” Iraq. their nuclear program. The money was used iar with the planning who spoke on condition of anonymity and “training in Hezbollah camps in Lebanon, Most media covered Mr. Pompeo’s remarks to develop missiles that can carry nuclear ahead of a formal announcement,” The Associated Press in exchange for striking American interests in dismissively. The Associated Press told read- warheads, establish military bases in Syria, reported. Saudi Arabia and the Gulf.” ers that “many in the intelligence community” arm Houthi rebels, attack Saudi oil facilities, Remember, this guy lost the 2020 election. Then, two months ago, it was revealed found Mr. Pompeo’s charges regarding the and similar purposes. Wrote CNN: “Final plans for Trump’s departure were still that Abdullah Ahmed Abdullah, al Qaeda’s Tehran-AQ link “overblown given a history of And while Iran’s rulers remained in the being laid a week ahead of time, but Trump has expressed second-in-command, a planner of the 1998 animosity between the two.” Joint Comprehensive Plan of Action (JCPOA) interest to some in a military-style send-off and a crowd of bombings of two U.S. embassies in Africa, The New York Times accused Mr. Pompeo along with our European allies, they have supporters, according to a person with whom he has dis- had been living comfortably in Tehran, of “demonizing Iran,” in order to make “any repeatedly violated their obligations, for cussed the matter. Whether that occurs at the White House, permitted to maintain a false identity as a eff ort by Mr. Biden to resuscitate the Iran example announcing this past weekend that Joint Base Andrews or his fi nal destination — Palm Beach Lebanese history professor. He was about to nuclear deal more diffi cult.” they were preparing to produce uranium International Airport — wasn’t clear. Trump is expected go somewhere in his car when assassins — And, of course, those who sympathize metal, which they had agreed not to do for 15 to be ensconced in his Mar-a-Lago club or his nearby golf presumably dispatched by Israel — ended with Iran’s rulers were outraged. Jamal Abdi, years. course by noon on Inauguration Day, when his term of- his career. president of the National Iranian American France, Germany and Britain urged the fi cially ends.” Which raised a question: To what extent Council (NIAC), asserted that Mr. Pompeo theocrats to “return to compliance with their But Defense One, a military website, said the Pentagon are Iran’s rulers currently enabling al Qaeda? has “leaked materials to the advocacy group JCPOA commitments without further delay.” put the kibosh on all that. Last week, Secretary of State Mike Pompeo Foundation for Defense of Democracies A prediction: Iran’s rulers will promise to do “The Pentagon, in a break with recent tradition, will not provided an answer. aimed at supporting the claim of Iran and al that if the price is right. But they won’t keep host an Armed Forces Farewell tribute to President Donald For the past fi ve years, he told report- Qaeda ties.” their promise. Because they are not with us. Trump,” Executive Editor Kevin Baron wrote in a commen- ers at the National Press Club, Iran’s rulers That’s false. Beginning in 2011, colleagues They are with the terrorists — including tary piece. “have provided safe haven and logistical at FDD worked hard to persuade the U.S. those who attacked us on 9/11. “It’s a shame, but not a surprise. Trump will leave offi ce support — things like travel documents, government to declassify and release primary in disgrace, one week after the House voted a second time ID cards, passports — that enable al Qaeda source documents retrieved from Osama bin Cliff ord D. May is founder and president of the for his impeachment, two weeks after his supporters staged activity.” Laden’s villa in Pakistan. Mr. Pompeo, as CIA Foundation for Defense of Democracies (FDD) a deadly siege in the Capitol Building, six months after he AQ leaders in Iran also are allowed to director, did that in 2017. and a columnist for The Washington Times. dragged his Joint Chiefs chairman into a political fi restorm, and after four years of nonstop assaults on truth. One of those disgraces is how he is ghosting the U.S. troops that he commanded,” Mr. Baron wrote. The Pentagon on Sunday fully rejected the president’s Israeli strikes on Iranian targets in Syria request for other military honors other than those associ- ated with the Department of Defense’s traditional “Armed An important joint U.S.-Israeli effort Forces Farewell tribute,” which typically includes “members of the military getting to meet or see the president in person By Abraham Wagner The new strikes on eastern Syria targeted and usually their commander-in-chief exhibits his apprecia- Iranian arms depots, as well as components linked tion for their commitment and sacrifi ce,” The Daily Mail ost in the fl ood of reporting on the Trump to Iran’s nuclear program. An Israeli attack last reported. impeachment and COVID-19 are critical Tuesday targeted warehouses in Syria being used The president has “declined to participate” in these Israeli airstrikes on Iranian targets eastern in a pipeline to store and stage Iranian weapons events, the Mail wrote. LSyria, carried out with intelligence pro- and also served as a pipeline for components that Of course he has. vided by the United States. support Iran’s nuclear program. Mr. Trump had some enormous achievements in his four A series of such strikes over the past several Also noted is that these airstrikes were carried years as president, but his childish behavior at the end of months have signifi cantly slowed down Iran’s en- out with intelligence provided by the U.S. follow- his single term will forever defi ne him as a sore loser, and trenchment in Syria, which is important not only to ing a meeting between Secretary of State Mike someone who cares far more about himself than his country. Israeli and U.S. interests, but those of Syria as well. Pompeo and the Israeli Mossad head in Washing- That will forever be his legacy, whether he likes it or not. Israel has struck more than 500 Iranian targets ton at Cafe Milano — a rare incidence of publi- As my grandmother used to say, “Good riddance to bad in Syria recently in addition to multiple clandestine cized cooperation between the two countries over rubbish.” missions against those involved in terrorist opera- choosing targets in Syria. tions. Israeli Prime Minister Benjamin Netanyahu Here Israel’s strikes hit the areas of Deir al- Joseph Curl covered the White House and politics for a and Defense Minister Benny Gantz have repeatedly Zur and Abu Kamal close to Syria’s border with decade for The Washington Times. He can be reached at said Israel will not allow Iranian entrenchment in [email protected] and on Twitter @josephcurl. Syria, vowing to do everything to prevent it. ILLUSTRATION BY LINAS GARSYS » see WAGNER | B4 B2 | EDITORIAL ☆ R WEDNESDAY, JANUARY 20, 2021
COMMENT & ANALYSIS Good luck, President Biden We wish you fair winds as you embark upon your presidency
ast fall, this newspaper endorsed your disagree are healthy measures of arrogance. rival in the presidential contest because Retain a decent amount of humility about Lwe believed that he would be the best what you can do, what government can do, and leader for the nation. That contest is over; what can be done. As the psalmist noted: “He the voters have spoken through the same guides the humble in what is right.” election process that has endured throughout Resist the impulse to extremes. Appreciate our history. the value of incrementalism. Today, we wish you fair winds and follow- You’ll make mistakes; that’s all right. The ing seas as you embark upon your presidency. American people don’t expect perfection; Like most Americans, we hope that your they expect eff ort and honesty. Learn from term of offi ce will be characterized by wise and the mistakes. Have the courage to say when prudent decisions, by prosperity, and by peace. you don’t know something or when you’ve We encourage you to build on the suc- made a mistake. cesses of your predecessors. Your immediate Remember the forgotten men and women Future COVID-19 relief predecessor, for example, had a variety of of the nation. You, like many, are acquainted accomplishments that should remain as part with grief and sorrow and you have won and bills must prioritize of the American fabric. lost many times throughout your life. Use that President Trump reoriented American rich experience to help your fellow country- community gyms foreign policy toward the threat posed by men who struggle with burdens seen and communist China. He brought a new approach unseen every day. By Travis Hanson While this is helpful and is a good step to the Middle East, which has enabled Israel Make no mistake; we will disagree — prob- in aiding recovery eff orts, Congress t the start of a new year, mil- failed to provide industry-specifi c relief and the Arab States to draw closer and cre- ably often — in the coming days. When we lions of Americans make reso- that would have a meaningful and last- ate meaningful diplomatic and commercial think you are wrong, we will say it. When we lutions to prioritize their health ing impact on community gyms like ties. He encouraged all involved to reassess think you right, we will say that, too. Aand fi tness. But for many, that mine. the form and purpose of foreign policy ap- The way to the truth is not through silenc- will be more diffi cult as their neighbor- As a member of the Community hood gyms have struggled to stay in Gyms Coalition, I have joined thousands proaches that date from World War II. ing or ignoring those with whom with we business throughout the pandemic. of other small gym owners to urge Con- With respect to the economy, your pre- disagree. Truth is arrived at through conversa- As the COVID-19 pandemic continues gress to provide local gyms with direct decessor was successful in growing both tion, disagreement, dispute and contest. We to impact Americans across the coun- relief to off set the mandatory closures the economy and personal wealth because hope that our disagreements will be direct, try, our representatives in Washington and operating restrictions that we have must fi nd solutions that will help keep faced since the start of pandemic. Un- he understood that low tax rates and a light respectful and animated by the spirit of seek- the economy moving and assist small fortunately, the bill that was just passed regulatory hand help companies and people ing the best path. businesses that have been struggling for and signed into law did not include the prosper. The fates of all Americans now living and months, like community gyms. necessary, direct relief for our industry, When stay-at-home orders were fi rst and it did not address the current issues He also tried to change trade and immigra- those yet to be born, are tied, partially if not issued and government offi cials started with PPP and how those funds can be tion policies that place American workers at substantially, to your ability to lead the na- to shut down businesses, gyms were utilized. a disadvantage. We urge you to continue this tion. Fate or destiny or God has put you in among the fi rst to close in nearly every For example, community gyms must important work. this place at this time. state. What’s worse is that today, several be able to use PPP funding to pay for months later, many gyms in states like trainers who are independent contrac- You will, as you should, do things diff erently As you know, the oath of offi ce is a solemn Pennsylvania, Arizona and Washington tors. Additionally, the money should be and emphasize diff erent policies. You were and terrible charge; it is essentially the same remain closed despite existing measures able to be used to pay for rent, which is elected in part to turn the page, turn volume oath you have sworn to at least eight times to increase safe operations. one of the biggest expenses that local down a bit and return government to more already. The gravity of the responsibility These mandatory closures will have gyms have. These are just two simple a lasting impact. According to a report fi xes to the program that would be ben- regular order. weighs on most of those who take it almost from Yelp, gyms and fi tness facilities efi cial as gyms fi ght to stay open. Listen to all. Remember the admonition immediately. It falls to you to raise your hand face higher closure rates than other Our members of Congress must pri- from Proverbs: “For lack of guidance a na- and take the oath at one of the most conse- hard-hit industries like restaurants and oritize local gyms and fi tness facilities bars, and they have seen a signifi cant in the next round of stimulus proposals tion falls, but victory is won through many quential moments in our nation’s history. increase in permanent closures. because gyms provide essential services advisers.” In the wake of the signing of the Declara- A recent survey of independent gym to millions of people and help keep When something is a good idea, it survives. tion of Independence, Virginia statesman owners validates this information and Americans healthy. It has never been When it isn’t, it does not. Remember that noth- John Page asked Thomas Jeff erson: “Do you found that almost 40% of gym owners more important to maintain a strong im- do not believe that they will survive next mune system, and community gyms play ing is more fl eeting than political victories or not think an angel rides in the whirlwind and year without relief. That’s why Congress a critical role in ensuring just that. defeats. No one election cycle is dispositive directs this storm?” needs to step in and help before it is It is imperative that our leaders in in the course of the nation. We do. We also are confi dent that you will too late. One in four gyms already face Washington recognize the signifi cant When political competition becomes tan- uphold the oath, and will, with God’s help and bankruptcy, and every day that goes need for direct, industry-specifi c relief by without relief from the government for local gyms. The Community Gyms gled with self-worth and identity, when it be- to the best of your ability, preserve, protect only puts more gyms and small business Coalition will continue to push for this comes about who is good and bad rather than and defend the U.S. Constitution against all owners at risk. relief in 2021 as we fi ght to keep our what is the right or wrong course, the stage is enemies foreign and domestic. Recently, Congress passed a relief doors open, keep people employed, and bill that included additional funding to keep our communities safe and healthy. set for confl ict. Embedded in condemnations Good luck, Mr. President. We wish you the Paycheck Protection Program (PPP) of the ideas off ered by those with whom we nothing but the best. designed to assist small businesses that Travis Hanson is the owner of Mendota have been devastated by the pandemic. Fitness in Mendota Heights, Minnesota.
LETTERS TO THE EDITOR Church quiet on Biden abortion stance I am sure that “Catholic” Joseph R. Biden will sign an in 2019 and has been the driving force behind the deaths executive order on day one to force the American people of 62 million baby deaths since 1973. For those who really to fund Planned Parenthood. He will also support the (non-politically) believe that Black lives matter, note that exportation of abortion worldwide. For those who ac- some 20 million of these babies were Black. cepted massive voter fraud or voted for Joe, this is only All the while, the Catholic Church remains essen- the beginning of his destruction of America. Your living tially silent. costs will skyrocket and your basic freedoms will be lost. It is already beginning. AL DILASCIA Planned Parenthood killed more than 345,000 babies Chicopee, Mass.
Pro-Trump damage pales next to BLM’s Considering the billions of dollars in damage that re- hundreds of sculptures and neoclassical building sulted from the riots across the U.S. in 2020 (mainly by suff ered little damage overall. There was almost no Democratic Party supporters), the pro-Trump protesters vandalism. who broke into the Capitol this month did almost no Most of what damage there was, in fact, was limited damage. They were there to protest, not destroy. That to broken glass, broken doors and a little bit of graffi ti is something the media have not really mentioned. In per the offi ce of the Architect for the Capitol. Most was fact, from some mainstream news coverage one would repaired within a few days. Congress was back in ses- think the Capitol had been set ablaze. sion the same day. ILLUSTRATION BY LINAS GARSYS The Capitol’s works of art were indirectly subjected to tear gas and pepper spray during the intrusion of COMM. WAYNE L. JOHNSON right-wing trespassing marauders Jan. 6, and thus will Navy Judge Advocate General’s Corps (retired) need to be cleaned. But the priceless large paintings, Alexandria, Va.
Obama, Clinton pardoned far more at end Published by Th e Washington Times LLC One of the lead stories on CNN this week has been pressing for this have no basis for continuing to pursue LARRY T. BEASLEY, CEO THOMAS P. McDEVITT, Chairman about the president’s 100 last-days pardons (including the action when the subject is not holding the offi ce from CHRISTOPHER DOLAN, President & Executive Editor clemencies). Worth noting is that in January 2017, the which they want to remove him. outgoing president, Barack Obama, issued 1,927 pardons Yesterday on MSNBC’s “Morning Joe” talking heads NEWS EDITORIAL AND OPINION and commutations in his fi nal days. In his last week in were condemning the censorship by the social-media IAN BISHOP, Managing Editor CHARLES HURT, Opinion Editor offi ce Bill Clinton issued 456 pardons and clemencies. networks. Really? This coming from MSNBC? Wow, CATHY GAINOR, Managing Editor CAROL HERMAN, Deputy Editorial Page Editor But of course the radical, socialist press is taking a last maybe they realize how horribly biased they have been JOHN BOURANTAS, Assistant Managing Editor BUSINESS shot at President Trump, whom it has been working for STEPHEN DINAN, Assistant Managing Editor JOSEPH E. TEIPE, JR., Executive Vice President — DAVID R. SANDS, Assistant Managing Editor four years to evict from offi ce. these past four years or maybe they just are useless DAVID DADISMAN, General Manager MARIA STAINER, Assistant Managing Editor And by the way, the expressed purpose of impeach- talking heads stirring up controversy in an attempt to RAYNARD BOLDING, Chief Financial Offi cer JOSEPH SZADKOWSKI, Assistant Managing Editor ment according to our Constitution is solely to remove get more people to tune in and watch their advertisers’ DESHONDA MURRAY, Human Resources Manager the president from offi ce for certain criminal or treason- commercials. JORGE CARRASQUILLO, Information Technology Director ous acts. As such the Pelosi/Schumer/Schiff /Nadler cabal attempting to impeach the president after Mr. TOM O’HARA Submissions: Op-eds may only be submitted by e-mail Trump is out of offi ce is legally mute. The Capitol dogs Sharon, Conn. to [email protected] Letters to the Editor must be original, exclusive to The Washington Times and sent via email. We prefer letters that are fewer than 350 words. Please include your name, address and daytime telephone number. E-mail: [email protected] WEDNESDAY, JANUARY 20, 2021 ☆ R OPINION | B3 Impeachment: The complexities of interpretation A monumental task faces legislators who will participate in Trump impeachment trial By Michael Deel
“The President, Vice President and all civil Offi cers of the United States, shall be removed from Offi ce on Impeachment for, and Conviction of, Treason, Bribery, or other high Crimes and Misdemeanors.”
— Article II, Section 4: United States Constitution
resident Trump has been impeached by the House of Representatives for a second time, becoming the fi rst president in American history to hold this Ptitle. The question now is, will he be the fi rst to be removed? One must understand the House and the Senate’s role as the Founders intended them to function. Representatives in the House represent the people of the United States, while the Senate’s function is to protect the states’ interests. This bicameral system balances power between their sometimes-competing interests, creating a check on one another. Being required to reach a consensus on legislation promotes compromise and a more delibera- tive, more thoughtful process. Madison states that House members “will be taken from that class of citizens which will have least sympathy with the mass of the people and be most likely to aim at an ambi- ILLUSTRATION BY LINAS GARSYS tious sacrifi ce of the many to the aggrandizement of the few.” The House Sorting out the social media conundrum will have the power of the Facebook, Twitter and other platforms pass judgment purse, giving it enormous infl u- about what Americans can say in an act of virtue fl aunting ence on policy formulation. By R. Emmett Tyrrell Jr. asinorum: “What to do with the butterfl y collecting migrate to something. He rarely decides. Impeachment’s butterfl y collectors?” Once again more hospitable environments. Years ago, I wrote a weekly ability adds to t is a refl ection of the vulgar- social media is torn between Social media ought to deal with column for The Washington Post. its impact, as ity and even the criminality John Stuart Mill and Karl Marx. normal life as it is lived in these My editor, Meg Greenfi eld, was it crosses over now stalking our society that My guess is the collectors will be United States. It tries to do too a saintly woman who answered to the Execu- ILLUSTRATION BY LINAS GARSYS Isocial media, as it is called, banned. much. every complaint about me, tive and Federal cannot extricate itself from this Frankly, I believe that social Actually, I as an editor have especially from Ralph Nader, branches. The Framers were always concerned about an awful question of censorship. media would fi nd itself off the never had a problem policing who blew a fuse every time I all-powerful legislature and designed a Senate crafting a bi- Facebook, Twitter and all the hook from aroused legislators content and I cannot understand mentioned his name. I told her to cameral legislature having its own internal system of checks other social media platforms that and curious members of the why social media fi nds itself ignore the complaints or to fi re and balances. are passing judgment on what judiciary if they would only pare mired in confl ict. At The Ameri- me. She took a long time making Another important concept to note is the wording of Americans say today are in the back the kind of intercourse they can Spectator we are open to all a decision and it only prolonged the article of impeachment within the Constitution. What pickle that they are in because have opened their platforms to. comers so long as they do not our mutual suff ering. does high crimes and misdemeanors mean? How is this the First Amendment freedoms Yes, you can talk about your lat- oppose democratic values and So, my advice to the tyrants interpreted? It probably had an understood meaning at the are extended to pornographers, est recipe for peach cobbler or tolerance. Also, we oppose the at social media is to clean out period; notice it says treason, bribery or other high crimes common criminals, political discuss policing the streets or re- evangelizing of criminal behav- your eccentrics. You have over- and misdemeanors. psychopaths and run-of-the-mill search COVID-19. You can tweet ior though that has never been a reached with the people you So, you have the principle of ejusdem generis (“of the conservatives. Soon if the social about sports, vacationing, selling problem at the Spectator as we open your platforms to. There same kind”) at work. In other words, treason and bribery media tycoons have their way your portfolio, the racket your are a peaceful organization. is a movement in the country are types of high crime and misdemeanor, which further their censorship will extend to neighbor’s lawnmower makes, so Present all sides is my motto that is aroused because you are contextualizes the term. It is suspect that misdemeanor at ordinary liberals, butterfl y col- long as there is no hint of murder and let our readers decide where censoring conservatives. Close the time carried a diff erent connotation from its meaning lectors, and, who knows, maybe or mayhem. In other words, I they stand. In the recent ker- down the censorship of legiti- today of a relatively minor off ense. Further research in cor- even stamp collectors. suggest Facebook and Twitter fuffl e over Donald Trump, Jed mate people or you will be closed pus linguistics could yield interesting insights. You do not doubt, do you, open their platform to a slightly Babbin and I took one side and down by the government. They As we are witnessing yet another impeachment trial that some virtue fl aunters will narrower audience and for fewer Jeff Lord, Dave Catron and Dov have at their disposal antitrust looming for President Trump, let us not forget the complexi- someday devise a humanitarian eccentrics or sociopaths. Fischer took another side. No laws that are a threat to monopo- ties of interpretation and the ever-hard decision of what case for proscribing butterfl y col- The problem comes from the one thought of banishing anyone lies such as yours. Beware! constitutes the terms laid out in the Constitution. What lecting? Those peaceful people kind of society we live in. It is from our forum. And our readers seems like a simple and straightforward task on the outside who prowl our hills and dales vulgar. It is crude. It veers toward got to read both sides and make R. Emmett Tyrrell Jr. is founder is a monumental feat within the confi nes of the trial. armed with butterfl y nets could the criminal and the violent. up their minds. and editor in chief of The become very controversial. Pres- All of this ought to be removed There is another virtue in American Spectator. He is the Michael Deel lives in Fort Smith, Arkansas, and cur- sure will mount against them, from contemplation on the social running a truly open forum. The author most recently of “The rently attends Johns Hopkins University in the Master and the sages at social media media platforms. Let the por- editor is not importuned either Death of Liberalism,” pub- of Arts in Government program. He can be reached on will be presented with the pons nographers and the enemies of to publish or not to publish lished by Thomas Nelson Inc. Twitter @MDeel2022 or by email at [email protected]. Putting ‘unity’ ahead of concrete policy Biden begins his administration with a country divided and a Capitol surrounded by a 12-foot fence
By Tammy Bruce repeated message from Joe Biden and of idiot yahoos decided to breach weren’t the enemy. You see, White men team and the Democrats know that his campaign to the American people. the Capitol on Jan. 6. Lives were lost voted for Mr. Trump, and a majority of Americans want unity and by touting o much talk of “unity” through- He was the one who was going to and the nation is unanimous in the the Guard is White men, ergo … The that as their one campaign position, out the election season. That bring us together, ostensibly, because condemnation of the violence. Demo- FBI would vet them which one would they admit this. was one thing that came out of Mr. Trump and his supporters had crats, however, never want to let a believe involved determining whether Despite this, they chose revenge SPresident-elect Joe Biden when torn us apart. He would “save the soul” good crisis go to waste and decided they supported Mr. Trump or were, and punishment instead, promoting he was in his campaign basement. of our country, from which we are to they would use the actions of a few heaven forbid, a conservative. it by using what I term as “fear porn.” It was a mantra from a man who infer Mr. Trump and his supporters hundred to condemn not just Mr. Yes, smells like unity to me. We were told all 50 state capitals were refused to give any details on policy were destroying. Trump, but all of his supporters and Do they really think that 75 million under threat of siege this last weekend. positions, and walked away as report- Observers might be impressed with associates. people are evil simply for supporting It never happened. America remains ers attempted to ask questions. the gall of declaring you’re for unity Even liberal television host Bill a man who destroyed ISIS, created locked down due to COVID-19, the ”Unity” is a theme we can expect to while in the next sentence accusing Maher was skeptical of that agenda, the best economy in the world has Capitol is surrounded by that 12-foot dominate his inaugural speech, despite your opponents of being the devil in- warning his audience that it wasn’t ever seen, shrunk the wage gap, cre- high fence, tens of thousands of troops the clear Democratic agenda to con- carnate, but the end result is fomenting wise to confuse those who breached ated the lowest unemployment rates stand ready with orders allowing them demn and isolate 75 million Americans civil division for the sake of perceived the Capitol with 75 million Trump for Americans in every category, to shoot fellow Americans, all arranged who did not vote for Mr. Biden. political gain. supporters. creating a stock market surge and the by people who won by saying that they Despite his refusal to be specifi c One of the reasons Mr. Trump was As Mr. Biden no doubt talks about associated 401(k)s and IRAs to actu- were going to return us to our “norms about policy and answer questions, elected was because Americans were “unity,” on Jan. 20 he will be doing so ally look like they might be a genuine and values.” Joe Biden is a known entity after 50 tired of watching a political bureau- at a Capitol surrounded by a 12-foot retirement plan? It’s safe to say no one, with the years in elected offi ce, and as vice cracy think only of themselves, while fence and 20,000 National Guard To say nothing of securing a Middle exception of the political “elite” whose president in the Obama administra- destroying our lives economically troops. It is imagery reinforcing that East peace which every other en- contempt for the normals only grew tion, we know he wants the opposite and with never-ending wars. It was as the domestic terrorist threat is that trenched political bureaucrat insisted after the election of Mr. Trump, voted of what President Trump has deliv- though they … hated us, but needed large, that overwhelming. The Mall was impossible. No, they don’t believe for or want a totalitarian crackdown ered. Already, he has told Americans the hamsters in the wheel to keep their is closed and will be empty, as are all that, but they do believe it’s their best aimed at half the country. It’s time to he intends to bring back amnesty for party going. national monuments. gambit to keep conservatives on their work to genuinely bring Americans illegal aliens, rejoin the failed Paris There is no reason to not expect If that weren’t enough to reinforce heels and in retreat. together to condemn this shameful and Climate Accord, and likely the disas- Mr. Biden’s inaugural speech to be their commitment to declaring 75 This is classically totalitarian. It is craven eff ort at destroying people with trous Iran nuclear deal, which that very similar to this carnival game million Americans potential terrorists not just the opposite of unity, it invites whom you disagree. terrorist nation has already admit- approach. The Democrats have de- because they voted for the incumbent civil division. The premise itself is tedly violated multiple times. cided to reinforce their message that president, it was then announced obscene and directly contradicts the Tammy Bruce, president of Independent But it was unity and a return to “domestic terrorists” are an existen- that the National Guard troops would messaging of wanting unity. But what Women’s Voice, author and Fox News “our norms and values” that was the tial threat to the nation after a bunch have to be “vetted” to make sure they that does tell you is that Mr. Biden’s contributor, is a radio talk-show host. B4 | OPINION ☆ R WEDNESDAY, JANUARY 20, 2021 What the French Revolution can teach us about ‘woke’ culture Revolutions are draining and the assault on religion, landmarks and norms a short-term thing
By Gerard Leval to those seasons. Late September and October became “Vendemiaire,” the month for the grape ep. Emmanuel Cleaver’s addition of harvest, to be followed by “Brumaire,” the month “Awomen” after the somewhat more of fog and then Frimaire, the cold month, and so Rtraditional term “Amen” at the end of his on. invocation at the opening session of the Since the young revolutionaries considered 117th Congress brought to mind a story that was that they and their Revolution stood at the center told about a visitor to Paris in 1794. of the universe, the numbering of the years also Paris was then in the throes of the radical had to change. As a result, the day of the procla- phase of the French Revolution. The monarchy mation of the Republic: Sept. 22, 1792, was desig- had been overthrown, the monarchs beheaded nated as the beginning of time, with the following and a new order was being installed. In the midst 12 months being Year 1. of all of this change, a visitor from the provinces Even the private interactions of individuals unfamiliar with the streets of the city sought to had to change. The old titles of nobility were, fi nd the address of a business located on one of of course, abolished, but so were the traditional Paris’ oldest thoroughfares, Rue St. Denis. terms “Monsieur” and “Madame.” Instead, every- Without the aid of Google Maps or a GPS and one was now “Citizen.” They did not go so far as believing himself lost in the maze of streets, the to abolish gender terms, but likely only because visitor was forced to turn to a passerby for as- gender is far too strongly embedded in the sistance. When the visitor mentioned that he was French language. However, in exchanges between seeking a location on Rue St. Denis, the passerby “citizens,” the formalistic “vous” was replaced shook his head and indicated that no such street by the more informal “tu” to evidence the new existed. He suggested that the visitor was un- equality. doubtedly looking for Rue Nis instead. Confused Countless traditional components of French by this response, the visitor asked what had hap- daily life were cast aside in the process of trying pened to the famous and bustling Rue St. Denis. to create a new society. But then, within fewer The passerby indicated that nothing had hap- than a half dozen years, the chaos engendered pened to the street, but that its name had been by all of the changes created a kind of social and changed. He reminded the visitor that under the political vacuum and the Republic was uncer- new revolutionary regime, the Catholic religion emoniously discarded and replaced by a military was no longer recognized and that the concept of dictatorship under the fi rm hand of Napoleon “saints” had been abolished. Therefore, the term Bonaparte. “saint” had been stricken wherever it appeared. France and Europe were then plunged into He then added that all aristocratic privileges had an endless cycle of wars ostensibly intended to also been abolished and the prefi x “de” which spread (and impose) the new French system on denoted such a privilege could also no longer be France’s neighbors. Millions of men died during used. As a consequence, the passerby, proudly these wars, with all of the consequent heartache pointing to the street sign above his head, in- and loss. dicated that the visitor was precisely where he Physical and emotional exhaustion set in. The wanted to be: on Rue Nis. will to proselytize the revolutionary ideals waned If he had wanted to emphasize the ongoing and most of the French seemed to aspire to a changes, the Parisian could also have pointed return of the old customs in spite of many of their to the Cathedral of Notre Dame, by then recon- allegedly repressive qualities. secrated as a “Temple of Reason,” and he could And so, by 1815, a mere 21 years after our have noted that all of the statues on the facade provincial visitor’s encounter with Rue Nis, a were headless. The revolutionaries had wanted Bourbon king was back on the throne, street to purge the Parisian scene of any remnants of names had reverted to their prior formulations, royalty. the old calendar had been reinstated, Catholicism Never mind that the statues were of the kings had been restored to its role as the religion of of Judah without any relation to the overthrown ILLUSTRATION BY LINAS GARSYS the realm (with the statues on Notre Dame given Bourbon monarchy, historical purity required the new heads), and many of the old customs had decapitation of all kings — alive or of stone. For core revolutionaries of France in the second and destroyed. Absolute purity was the only means of been revived. good measure, the passerby could have invited very radical phase of the French revolution were insuring the success of the new regime. The Revolution had drained everyone. Even the visitor to go to one of several public places very thorough. These young men (virtually all The calendar itself had to be revamped. The some of those who had been strong supporters of where a guillotine was periodically erected for of them were in their 30s) fi lled with righteous seven-day week was cast aside for the “decadie,” the radical revolutionary changes breathed a sigh the convenient decapitation, without the benefi t energy and conviction had determined that in a new 10-day week. In an environmental spirit, of relief and undoubtedly quietly said “Amen.” of trial or defense, of those who objected to the order to safeguard the political benefi ts of the all of the months were renamed, disposing of the new order. reforms created by the Revolution, everything old Roman names, and instead ascribing names Gerard Leval is a partner in a Wash- Indeed, the changes wrought by the hard that echoed the old order had to be removed and refl ecting the seasons and activities in relation ington, D.C., law fi rm.
administration, the Israeli military is WAGNER reportedly developing three options Joe Biden must fi nd America’s lost soul From page B1 to undermine Iran’s nuclear eff orts or, if need be, counter Iranian aggres- Iraq including 18 sites of pro-Iranian sion. Defense Minister Gantz has been Rioters at the Capitol believe democracy has failed them militias. This is not new, as Israel has quoted as saying that “Israel needs to launched hundreds of strikes against have a military option on the table.” By Peter Morici White suburban guilt and is Iran-linked military targets in Syria Both Israel’s military and intelligence destructively false. over the years but rarely acknowledges services have long opposed any direct oe Biden’s biggest problems George Washington com- such operations. strike on Iran, which would pose are not China’s quest for manded the colonial troops in These strikes came amid rising enormous logistical and political dif- Jempire, an overtaxed infra- the French and Indian War to tensions and concerns that Iran might fi culties, and have elected to attack structure and health care open the West to the nation’s carry out attacks to avenge last year’s Iranian targets outside Iran, such as system or the wave of Central emerging industry and com- killing of one of its top command- those in Syria as well as Lebanon and Americans marching to our south- merce. When Great Britain ers, Gen. Qassem Soleimani. There is elsewhere. ern border. It’s America’s lost sought to smother those aspi- also the ongoing problem of Iranian As the incoming Biden administra- soul — the shared belief that there rations, American capitalists entrenchment on Israel’s northern tion tackles the complex Middle East is something decent and special wrapped themselves in En- frontier as a red line, where Iranian situation it needs to take a serious look about America that we off er to the lightenment ideals to justify a facilities and weapons convoys at these relationships and their impact. world. revolution. destined for Hezbollah have been U.S. intelligence support to Israeli op- In the 20th century, even the Hardly as noble as the high located. Prior strikes have served to at erations such as Secretary Pompeo de- oppressed — Blacks under Jim school textbooks recount, but least slow down Iran’s entrenchment scribed, remains essential and should Crow and European immigrants racism and slavery were impedi- in Syria which actually represent an not be disturbed. The attacks on crowded three families to a ments to accomplishing unity ongoing threat to Syria as well as Iranian support to regional terrorists cold-water fl at during the Great between North and South to Israel. and supplies to their nuclear weapons Depression — believed in an es- prosecute the American Revolu- During the Syrian civil war, which program through Syria are outside the sential American justice. tion, not the motivating factor. has been going on for the past decade, repudiated JCPOA and should not be Democracy and capitalism, These days the culture of the Syrian regime was rescued by permitted in any future agreement. laced with Teddy and Franklin minority communities — the ex- external support from Iran, as well as While the incoming Biden team has Roosevelt state activism, was a pectation that a government job Russia and Hezbollah who provided clearly signaled its intention to resume darn sight better than anything ILLUSTRATION BY LINAS GARSYS or government imposed quotas forces and equipment to combat over a negotiations with Iran, they are facing they could fi nd elsewhere or fash- in education and employment dozen rebel groups seeking to over- a geopolitical and military situation far ion here. And as poor and abused as working-class Americans who believe can ensure lasting success — and self- throw the Assad government. With diff erent from the one left at the end of they were, they fought to cleanse the their democracy has failed them. serving proselytizing about race by that war largely over, Bashar Assad the Obama administration. Apart from world of fascism and then stood guard Elites at universities, on Wall Street, in the executive class to the equal rights wants the Iranians and Hezbollah progress toward development of a during the long Cold War. C-Suites and among the mainstream movement are the major impediments gone. ISIS, which had set up their own nuclear weapon and a new generation By encouraging the mob to storm media have hijacked their prosper- to working and middle class minori- “state” within Syria has been van- of ballistic missiles, Iranian involve- the Capitol on Jan. 6, President Trump ity — destroying their jobs with free ties and women accomplishing their quished. For their part, Russia wants ment in Syria, Iraq and elsewhere has took an ax to the Ark of the Covenant. trade and illegal immigration. And goals. continued use of Syrian port facilities become an essential part of the overall He desecrated the U.S. Constitution, those elites enforce a devil’s morality Americans have become so cynical and an air base, which are acceptable equation. Here the nature and extent seriously damaged the nation’s global — abortion, gay marriage, transgender they now believe in Big Lies — just as to Syria and Israel alike. of continued support to Israeli eff orts standing as protector of democ- rights, no prayer in schools or even the Germans did such cynical myths Relations between Syria and Israel to counter Iran in this critical theater racy and compromised American creches in public places. in the 1930s and the Weimar Republic throughout this war were certainly will be a key consideration. exceptionalism. That narrative may have some failed. It’s immigrants, intellectuals, strained, to say the least, but Israel It is also too early to tell where the Americans — and their leaders legitimacy but to primarily attribute bankers and White folks when the did not become actively involved as a locus of decision-making with respect by good example — are supposed to the problems of White blue-collar truth is most individuals are responsi- combatant. Throughout the confl ict to Middle East policy will be in the accept that elections no matter how Americans to some grand conspiracy ble for their own successes or failures. Israel provided covert medical support Biden administration. Whether it will imperfect are better than the oligarchy — as Donald Trump, and before him The most important thing Mr. to Syrians injured in the Golan Heights be with Jake Sullivan and the new of single party rule as per China or au- Pat Buchanan, would prescribe — is Biden could do to save the republic is area with whom they had enjoyed good team at the NSC, or Tony Blinken and tocrats in places like Russia whatever a cynical falsehood. A good deal of to talk frankly to both sides — articu- relations for some four decades under his State Department remains to be their institutional trappings. middle America too easily falls prey to late the challenges we face and debunk the 1974 disengagement agreement. seen. If history is any guide it cannot Certainly, the Republican sena- nostalgia for manufacturing and offi ce false narratives — in quite explicit and The presence of the Iranians, He- be both. What is essential is that those tors and congressmen challenging jobs that the digital revolution and specifi c terms. zbollah and other rebel forces in this who are “in charge” engage with the the legitimacy of electoral ballots robotics are exterminating as surely as I am afraid he can’t do that. Mr. area brought limited hostilities in a Israeli leadership as soon as possible backed down, and Vice President Mike the factory system produced inexpen- Biden hijacked the platform and her- peaceful area and was of great concern so that this aspect of the transition Pence upheld his constitutional duties sive cloth, candles and metal goods esies of the left to become president, to Israel. With these hostile forces now leaves nothing to change, and the admirably throughout. However, an that killed Medieval guilds. applied its theology in selecting his mostly gone from the Golan, Israel clearest possible message is sent to inauguration behind fences, barbed On the left, failed capitalism is economic team and other high offi cials is seeking a return to the peaceful Iran as to what the red lines are going wire and 25,000 American troops — the villain. Big Tech is too big and and is now too invested in the lies of coexistence that prevailed since 1974. forward. enough to invade most moderate-sized big banks are too greedy. White folks the radical left. By most reports continued Israeli countries — is hardly a testimony to a conspire against people of color — and To fi nd America’s soul, Mr. Biden airstrikes against Iranian targets within Abraham Wagner has served in vibrant democracy. men against women — in a silent com- fi rst must redeem his own. Syria are designed to avoid actual several national security posi- Absent in Congress or the new ad- plicity. But that is to be expected ac- Syrian facilities and population. Little tions, including the NSC Staff under ministration is any serious discussion cording to the 1619 Project — after all Peter Morici, @pmorici1, is an wonder they are not denounced in the Presidents Nixon and Ford and is about what really motivated thousands the country was founded to perpetuate economist and emeritus business Syrian press. the author of the forthcoming book to riot on the Mall. racism, misogyny and slavery. professor at the University of Mary- Preparing for the incoming Biden “Israel and the Search for Peace.” The mob represented White All that creates minority rage and land, and a national columnist. Classified Advertising Classified 202-636-3109 www.washingtontimes.com/classified WEDNESDAY, JANUARY 20, 2021 | B5 Legal Advertising %$.%t7" Place your ad online now – we are open 24 hours, 7 days a week at washingtontimes.com Employment Employment Employment Business & Offi ce Opportunities Opportunities Opportunities Announcement Services 'LJLWDO(GLWRUV 6RIWZDUH 'HYHORSHUV 3ULQFLSDO $VVRFLDWH %(&20($ 3ODFHDEXVLQHVV :DVKLQJWRQ'& (GLW 6\VWHPV6RIWZDUHIRU 'DWD6FLHQFHt&DSLWDO 38%/,6+('$87+25 FDUGVL]HGDGLQWKH WUDFNJDWKHUFXUDWH &KDNUD&RQVXOWLQJ,QF 2QH 6HUYLFHV //& LQ :HHGLWSULQWDQG 5HJLRQDO6PDOO SURRIUHDGSURFHVV DW *DLWKHUVEXUJ 0' 1RUWKHUQ 9$ 0XOW LQFRPLQJFRQWHQWV 'XWLHV5HVHDUFK SRV DYDLO /HDG GLVWULEXWH\RXUZRUN 'LVSOD\$GYHUWLVLQJ :ULWHHGLW DQG DQDO\]H H[LVWLQJ DSSOLFDWLRQ LQWHUQDWLRQDOO\:H 1HWZRUN5HDFK Legal Notices SUHVHQWDWLRQV GDWD WUDQVIHU WRROV YDOLGDWLRQ RI VWDW GRWKHZRUNf
DNIXVD#DNGQRUJ 5(129$7,216($6< 3(5)250,1* www.washingtontimes.com FOLLOW 5HI QR / 21('$<XSGDWHV DGYHUWLVLQJDJHQF\ :HVSHFLDOL]HLQVDIH &DOO Find us on Twitter EDWKLQJ*UDEEDUV ZZZPGGF QRVOLSIORRULQJ DGVHUYLFHVFRP -DQXDU\WK @WashTimes VHDWHGVKRZHUV&DOO -DQXDU\WK IRUDIUHHLQKRPH FRQVXOWDWLRQ $' LIKE, SHARE COMMENT instagram ADVERTISE YOUR EVENT! @TheWashingtonTimes @washtimes www.washingtontimes.com B6 | CLASSIFIED ☆ R WEDNESDAY, JANUARY 20, 2021
Legal Notices Legal Notices
FAIRFAX COUNTY ARLINGTON COUNTY, VIRGINA BOARD OF ZONING APPEALS PUBLIC NOTICE FEBRUARY 3, 2021 7KHIROORZLQJLWHPVZLOOEHKHDUGE\WKH
%RDUGRI=RQLQJ$SSHDOV 127,&(,6+(5(%<*,9(1SXUVXDQWWR6HFWRIWKH=RQLQJ2UGLQDQFHWKDWDWDPHHWLQJ :('1(6'$<)HEUXDU\DWSP RIWKH)DLUID[&RXQW\%RDUGRI=RQLQJ$SSHDOV %=$ RIVDLG&RXQW\RQ::('1(6'$< )(%58$5<DW$0WKH%=$ZLOOKROGSXEOLFKHDULQJVRQWKHIROORZLQJDSSOLFDWLRQV 7KLVLVDYLUWXDOSXEOLFPHHWLQJWREHKHOGWKURXJKHOHFWURQLFFRPPXQLFDWLRQPHDQV DWWKHWLPHLQGLFDWHG7KLVPHHWLQJPD\EHKHOGHOHFWURQLFDOO\GXHWRWKH6WDWHRI(PHUJHQF\ FDXVHGE\WKH&29,'SDQGHPLF3OHDVHFRQWDFWWKH6SHFLDO3HUPLWDQG9DULDQFH%UDQFKRI WKH=RQLQJ(YDOXDWLRQ'LYLVLRQ'HSDUWPHQWRI3ODQQLQJDQG'HYHORSPHQWDW RU %=$&OHUN0DLO#)DLUID[&RXQW\JRYRUUHYLHZRQOLQHDW $%2877+,638%/,&+($5,1* KWWSVZZZIDLUID[FRXQW\JRYSODQQLQJGHYHORSPHQWERDUG]RQLQJDSSHDOVDWOHDVWRQH ZHHNSULRUWRWKHPHHWLQJIRUDGGLWLRQDOLQIRUPDWLRQRQWKHVWDWXVRIWKHPHHWLQJ7KHPHHWLQJ ZLOOEHDYDLODEOHWRYLHZOLYHRQ&KDQQHODQGVWUHDPOLYHRQOLQHDW 7KLVPHHWLQJLVRSHQWRSXEOLFYLHZLQJDQGSDUWLFLSDWLRQ7KH%RDUGRI=RQLQJ$SSHDOV %=$ ZLOO ZZZIDLUID[FRXQW\JRYFDEOHFRQVXPHUFKDQQHOOLYHYLGHRVWUHDP/LYHDXGLRRIWKH FRQVLGHUWKHOLVWHGDSSOLFDWLRQVIRU9DULDQFHVDQG8VH3HUPLWVWRPRGLI\SODFHPHQWRURWKHU PHHWLQJPD\EHDFFHVVHGYLDWHOHSKRQHDVQRWHGRQWKHZHEVLWH$OOSHUVRQVZLVKLQJWR UHTXLUHPHQWVRIWKH=RQLQJ2UGLQDQFHDVFRQWDLQHGLQWKH$SSHQGL[RIWKH$UOLQJWRQ&R&RGH SUHVHQWWKHLUYLHZVRQWKHVHVXEMHFWVPD\FDOOWKH&OHUNWRWKH%RDUGRI=RQLQJ$SSHDOVDW DQG$SSHDOVRI$GPLQLVWUDWLYHGHFLVLRQVRUGHWHUPLQDWLRQVPDGHSXUVXDQWWRWKH=RQLQJ RUUHJLVWHURQOLQHDW 2UGLQDQFH?6RPHRUDOOLWHPVPD\EHKHDUGDWWKHQH[WDYDLODEOH%=$SXEOLFKHDULQJGDWHLIWKH\ KWWSVZZZIDLUID[FRXQW\JRYSODQQLQJGHYHORSPHQWERDUG]RQLQJDSSHDOVWREHSODFHGRQ DUHXQDEOHWREHKHDUGRULIWKH\DUHGHIHUUHG$SSOLFDWLRQVDQGDJHQGDPD\EHYLHZHGRQOLQHDW WKH6SHDNHUV/LVWDQGPD\DSSHDUWREHKHDUGYLDWHOHSKRQHRUSUHUHFRUGHGYLGHR'HDGOLQHV KWWSVFRPPLVVLRQVDUOLQJWRQYDXVE]D,QSHUVRQYLHZLQJRIDSSOLFDWLRQVDW&RXQW\RIILFHVLV E\W\SHRIWHVWLPRQ\DUHRQWKHZHEVLWH,QDGGLWLRQZULWWHQWHVWLPRQ\DQGRWKHUVXEPLVVLRQV FXUUHQWO\VXVSHQGHG ZLOOEHUHFHLYHGDW*RYHUQPHQW&HQWHU3DUNZD\ 6XLWH )DLUID[DQG %=$&OHUN0DLO#)DLUID[&RXQW\JRY,IWKH%RDUGRI=RQLQJ$SSHDOVLVPHHWLQJLQSHUVRQSKRQH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB DQGYLGHRWHVWLPRQ\DUHHQFRXUDJHGEXWLQSHUVRQDWWHQGDQFHDQGWHVWLPRQ\DUHDOVR SHUPLWWHGDW*RYHUQPHQW&HQWHU3DUNZD\)DLUID[9$7KHIROORZLQJLVD GHVFULSWLYHVXPPDU\RQO\RIWKHDSSOLFDWLRQDQGPD\QRWLQFOXGHHYHU\GHWDLO,QWHUHVWHG 983$XVHSHUPLWUHTXHVWE\6WHYHQDQG7UDF\%RXWHOOHWKHRZQHUVWRSHUPLWD SDUWLHVPD\UHYLHZWKHDSSOLFDWLRQLQGHWDLORQOLQHDWOGVQHWIDLUID[FRXQW\JRYOGVQHW&RSLHV UHDUVHWEDFNRIIHHWWRZDOORIWKHUHDUGHWDFKHGJDUDJH IHHWWRWKHHDYH LQVWHDGRI RIWKHVWDIIUHSRUWDUHDOVRDYDLODEOHRQOLQHDW IHHWWRWKHHDYHDVUHTXLUHGUHDQXQEXLOWUHDUGHWDFKHGJDUDJHH[SDQVLRQSUHYLRXVO\DSSURYHG KWWSOGVQHWIDLUID[FRXQW\JRYOGVQHW&XUUHQWLQ3URFHVV%=$DVS[ E\ SXWWLQJ LQ WKH E\WKH%=$LQRQH[LVWLQJJDUDJHLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHVNQRZQDV DSSOLFDWLRQQXPEHURUPD\EHPDGHDYDLODEOHDW*RYHUQPHQW&HQWHU3DUNZD\ZLWK 6RXWK$UOLQJWRQ5LGJH5RDG $UOLQJWRQ5LGJH DGYDQFHQRWLFHE\FRQWDFWLQJWKH&OHUNWRWKH%RDUGRI=RQLQJ$SSHDOVDVOLVWHGDERYH$'$ 5HDVRQDEOHDFFRPPRGDWLRQLVDYDLODEOHXSRQKRXUDGYDQFHQRWLFH)RUDGGLWLRQDO 9$33 FDUU\RYHU $SSHDOE\5HEHFFD+XQWHUWKHSURSHUW\RZQHURID]RQLQJ LQIRUPDWLRQRQ$'$FDOO 77<9LUJLQLD5HOD\&HQWHU GHWHUPLQDWLRQDGGUHVVLQJ]RQLQJUHOLHIQHHGHGIRUDSURSRVHGUHVXEGLYLVLRQRIWKHSURSHUW\DW WK6WUHHW6RXWKORFDWHGLQWKH5=RQLQJ'LVWULFW %DUFURIW $0+-DVRQ6FKQHLGHU63/($SSOXQGHU6HFWRIWKH=RQLQJ2UGLQDQFH WRSHUPLWDUHGXFWLRQWRWKHPLQLPXP\DUGUHTXLUHPHQWVEDVHGRQDQHUURULQEXLOGLQJORFDWLRQ 99$ FDUU\RYHU 9DULDQFHUHTXHVWE\%UHQGDQDQG&DWKHULQH%UDQRQRZQHUVWR WRSHUPLWDGHFNDQGVWHSVWRUHPDLQIWIURPWKHUHDUORWOLQHDQGDSDWLRWRUHPDLQIW SHUPLWDWRWDOPDLQEXLOGLQJIRRWSULQWRILQVWHDGRIDVUHTXLUHGIRUDRQHIDPLO\ IURPWKHUHDUORWOLQH/RFDWHGDW&DVWOH%DU&W$OH[DQGULDRQDSSUR[VTIW GZHOOLQJZLWKDTXDOLI\LQJIURQWSRUFKLQWKH5]RQLQJGLVWULFWUHDUHDUSRUFKRYHUH[LVWLQJ RIODQG]RQHG3'+/HH'LVWULFW7D[0DS IODJVWRQHSDWLRLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHVNQRZQDV1RUWK8WDK6WUHHW %UR\KLOO)RUHVW $00LUFHD$0XQWHDQX63/($SSOXQGHU6HFWRIWKH=RQLQJ2UGLQDQFH WRSHUPLWDUHGXFWLRQRIFHUWDLQ\DUGUHTXLUHPHQWVWRSHUPLWDVHFRQGVWRU\DGGLWLRQIW 983$XVHSHUPLWUHTXHVWE\6FRWW7\VNRZVNLDQG3DWULFLD7\VNRZVNLWKHRZQHUV IURPWKHZHVWVLGHORWOLQHDQGIWIURPWKHHDVWVLGHORWOLQH/RFDWHGDW*URYHWRQ6W WRSHUPLWDVWUHHWVHWEDFNRIIHHWWRWKHZDOOLQVWHDGRIIHHWDVUHTXLUHGIURP1RUWK $OH[DQGULDRQDSSUR[VTIWRIODQG]RQHG5/HH'LVWULFW7D[0DS +HQGHUVRQ5RDGUHDQHQFORVXUHRIDQH[LVWLQJVFUHHQHGFDUSRUWRQDQH[LVWLQJRQHIDPLO\ GZHOOLQJRQDFRUQHUORWLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHNQRZQDVQG6WUHHW1RUWK $0'DQLHODQG/LQGVD\5LFNV9&35$SSO8QGHU6HFWVDQGRI $UOLQJWRQ)RUHVW WKH=RQLQJ2UGLQDQFHWRSHUPLWDVSRUWVFRXUWZLWKDVVRFLDWHGHQFORVXUHWRUHPDLQIWIURP WKHUHDUORWOLQH/RFDWHGDW:DSOHV&UHVW&W2DNWRQRQDSSUR[VTIWRI 983$XVHSHUPLWUHTXHVWE\0DXUHHQ'DQG3KLOLS0&DXJKUDQWKHRZQHUVWR ODQG]RQHG53URYLGHQFH'LVWULFW7D[0DS SHUPLWDUHDUVHWEDFNRIIHHWWRWKHSRUFK IHHWWRWKHSRUFKHDYH IURPUHDUORWOLQH LQVWHDGRIIHHWWRWKHSRUFK IHHWWRWKHSRUFKHDYH DVUHTXLUHGUHQHZHOHYDWHGRQH VWRU\UHDUSRUFKRQDVLQJOHIDPLO\GZHOOLQJLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHVNQRZQDV WK6WUHHW1RUWK -DQXDU\WK -DQXDU\WK 983$XVHSHUPLWUHTXHVWE\&RUH\/DQG0DU\-%UDGOH\WKHRZQHUVWRSHUPLWD VWUHHWVHWEDFNRIIHHWWRWKHSRUFK IHHWWRSRUFKHDYHV IURP1RUWK*DUILHOG6WUHHWDQG $' IHHWWRWKHSRUFK IHHWWRSRUFKHDYH IURPVW6WUHHW1RUWKLQVWHDGRIIHHWWRWKH SRUFK IHHWWRWKHSRUFKHDYHV DVUHTXLUHGIURPHDFKVWUHHWWRSHUPLWDVWUHHWVHWEDFNRI IHHWWRWKHUHDUDGGLWLRQ IHHWWRWKHHDYHV IURPVW6WUHHW1RUWKLQVWHDGRIIHHWWRWKH ZDOO IHHWWRHDYHV DVUHTXLUHGDQGWRSHUPLWDVWUHHWVHWEDFNRIIHHWWRWKHZLQGRZZHOO IURPVW6WUHHW1RUWKLQVWHDGRIIHHWDVUHTXLUHGUHSURSRVHGVWRU\DGGLWLRQZLWKIURQWDQG UHDUSRUFKWRDQH[LVWLQJRQHIDPLO\GZHOOLQJRQDFRUQHUORWLQWKH5]RQLQJGLVWULFWRQWKH SUHPLVHVNQRZQDV1RUWK*DUILHOG6WUHHW /\RQ3DUN
983$XVHSHUPLWUHTXHVWE\-DVRQDQG6XVDQ+DPPWKHRZQHUVWRSHUPLWDUHDU FAIRFAX COUNTY VHWEDFNRIIRRWWRWKHZDOODQGHDYHRIDGHWDFKHGDFFHVVRU\EXLOGLQJ ELNHJDUDJH LQVWHDGRI IHHWDVUHTXLUHGIURPWKHUHDUSURSHUW\OLQHDQGWRSHUPLWDVHSDUDWLRQRIIHHWEHWZHHQD PLANNING COMMISSION PDLQEXLOGLQJDQGDQDFFHVVRU\EXLOGLQJLQVWHDGRIIHHWEHWZHHQEXLOGLQJVDVUHTXLUHGUH SURSRVHGPRGLILFDWLRQVWRDQDFFHVVRU\EXLOGLQJSUHYLRXVO\DSSURYHGE\WKH%=$RQDFRUQHUORW FEBRUARY 10, 2021 LQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHVNQRZQDVWK6WUHHW6RXWK $UOLQJWRQ5LGJH 983$XVHSHUPLWUHTXHVWE\6WHYHQ7LQWHURQEHKDOIRIWKHRZQHUV.DLWO\QQH%URFN DQG&KULVWRSKHU%URFNWRSHUPLWDOHIWVLGHVHWEDFNRIIHHWWRWKHZDOO IHHWWRWKHHDYH LQVWHDGRIIHHWWRWKHZDOO IHHWWRWKHHDYH DVUHTXLUHGIURPWKHOHIWVLGHSURSHUW\OLQHDQG 1RWLFHLVKHUHE\JLYHQSXUVXDQWWRWKHSURYLVLRQVRI6HFWLRQRIWKH&RGHRI9LUJLQLDDV WRSHUPLWDQDJJUHJDWHVLGH\DUGVHWEDFNRIIHHWLQVWHDGRIIHHWDVUHTXLUHGLQWKH5 DPHQGHGWKDWDWDPHHWLQJRIWKH)DLUID[&RXQW\3ODQQLQJ&RPPLVVLRQ 3& RIVDLG&RXQW\RQ ]RQLQJGLVWULFWUHDQHZWZRVWRU\UHDUDGGLWLRQWRDQH[LVWLQJRQHIDPLO\GZHOOLQJLQWKH5 :('1(6'$<)(%58$5<DW30WKHVDLG&RPPLVVLRQZLOOKROGDSXEOLFKHDULQJRQ ]RQLQJGLVWULFWRQWKHSUHPLVHNQRZQDV1RUWK%XUOLQJWRQ6WUHHW 2OG'RPLQLRQ WKHIROORZLQJDSSOLFDWLRQVDWWKHWLPHLQGLFDWHG77KHSXEOLFKHDULQJPD\EHKHOGHOHFWURQLFDOO\ GXHWRWKH6WDWHRI(PHUJHQF\FDXVHGE\WKH&29,'SDQGHPLF3OHDVHFRQWDFWWKH3ODQQLQJ 983$XVHSHUPLWUHTXHVWE\:LOOLDP(3HOOLQHQRQEHKDOIRI$DUUH'DYLG3HOOLQHQ &RPPLVVLRQ DW RU SODQFRP#IDLUID[FRXQW\JRY RU UHYLHZ RQOLQH DW DQG$XQH0DULD3HOOLQHQWKHRZQHUVWRSHUPLWDULJKWVLGHVHWEDFNRIIHHWWRWKHDWWDFKHG ZZZIDLUID[FRXQW\JRYSODQQLQJFRPPLVVLRQDWOHDVWRQHZHHNSULRUWRWKHPHHWLQJIRU JDUDJH IHHWWRWKHHDYH LQVWHDGRIIHHWWRWKHZDOO IHHWWRWKHHDYH DVUHTXLUHGWR DGGLWLRQDOLQIRUPDWLRQRQWKHVWDWXVRIWKHPHHWLQJ7KHPHHWLQJLVDYDLODEOHWRYLHZOLYHRQ SHUPLWDOHIWVLGHVHWEDFNRIIHHWWRWKHIURQWSRUFK IHHWWRWKHHDYH LQVWHDGRIIHHW &KDQQHODQGVWUHDPOLYHRQOLQHDW WRWKHIURQWSRUFK IHHWWRWKHHDYH DVUHTXLUHGDQGWRSHUPLWDULJKWVLGHVHWEDFNRI ZZZIDLUID[FRXQW\JRYFDEOHFRQVXPHUFKDQQHOOLYHYLGHRVWUHDP/LYHDXGLRRIWKH IHHWWRWKHPDLQEXLOGLQJHDYHLQVWHDGRIIHHWIURPWKHVLGHSURSHUW\OLQHDVUHTXLUHGUHD PHHWLQJPD\EHDFFHVVHGYLDWHOHSKRQHDVQRWHGRQWKHZHEVLWH$WWKHSXEOLFKHDULQJDQ\DQG HQFORVXUHRIH[LVWLQJFDUSRUWQHZIURQWDQGUHDUSRUFKHVDQGQGVWRU\DGGLWLRQZLWKQHZHDYHV DOOLQWHUHVWHGSHUVRQVZLOOEHJLYHQDQRSSRUWXQLW\WRH[SUHVVWKHLUYLHZUHJDUGLQJWKH WRDQH[LVWLQJRQHIDPLO\GZHOOLQJLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHVNQRZQDV DSSOLFDWLRQ$OOSHUVRQVZLVKLQJWRSUHVHQWWKHLUYLHZVRQWKHVHVXEMHFWVPD\FDOOWKH3ODQQLQJ 6RXWK,YHV6WUHHW $UOLQJWRQ5LGJH &RPPLVVLRQDWRUUHJLVWHURQOLQHDW ZZZIDLUID[FRXQW\JRYSODQQLQJFRPPLVVLRQVSHDNHUWREHSODFHGRQWKH6SHDNHUV/LVWDQG 983$XVHSHUPLWUHTXHVWE\7LP9DQ9RQQRRQEHKDOIRIWKHRZQHUV0HJDQDQG PD\DSSHDUDQGEHKHDUGYLDWHOHSKRQHRUSUHUHFRUGHGYLGHR'HDGOLQHVE\W\SHRIWHVWLPRQ\ 3DWULFN.HQQHG\WRSHUPLWDVWUHHWVHWEDFNRIIHHWWRWKHSRUFKIURP1RUWK2KLR6WUHHW DUHRQWKHZHEVLWH,QDGGLWLRQZULWWHQWHVWLPRQ\DQGRWKHUVXEPLVVLRQVZLOOEHUHFHLYHGDW LQVWHDGRIIHHWWRWKHSRUFKDVUHTXLUHGWRSHUPLWDUHDUVHWEDFNRIIHHWWRWKHUHDU *RYHUQPHQW&HQWHU3DUNZD\6XLWH)DLUID[DQGSODQFRP#IDLUID[FRXQW\JRY DGGLWLRQ IHHWWRHDYHV IURPWKHUHDUORWOLQHLQVWHDGIHHWWRWKHZDOO IHHWWRHDYHV RI ,IWKH3ODQQLQJ&RPPLVVLRQLVPHHWLQJLQSHUVRQSKRQHDQGYLGHRWHVWLPRQ\DUHHQFRXUDJHG DVUHTXLUHGDQGWRSHUPLWDUHDUVHWEDFNRIIHHWWRWKHODQGLQJIHHWWRDZLQGRZZHOOIURP EXWLQSHUVRQDWWHQGDQFHDQGWHVWLPRQ\DUHDOVRSHUPLWWHGDW*RYHUQPHQW&HQWHU WKHUHDUORWOLQHLQVWHDGRIIHHWDVUHTXLUHGUHSURSRVHGVWRU\UHDUDQGVLGHDGGLWLRQVZLWK 3DUNZD\)DLUID[9$7KHIROORZLQJLVDGHVFULSWLYHVXPPDU\RQO\RIWKHDSSOLFDWLRQDQG IURQWSRUFKWRDQH[LVWLQJRQHIDPLO\GZHOOLQJORFDWHGLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHV PD\QRWLQFOXGHHYHU\GHWDLO,QWHUHVWHGSDUWLHVPD\UHYLHZWKHDSSOLFDWLRQLQGHWDLORQOLQHDW NQRZQDV1RUWK2KLR6WUHHW $UOLQJWRQ(DVW)DOOV&KXUFK OGVQHWIDLUID[FRXQW\JRYOGVQHWRUZLWKSULRUDUUDQJHPHQWPD\SLFNXSDFRS\RIWKHVWDII UHSRUWDWWKH=RQLQJ(YDOXDWLRQ'LYLVLRQRIWKH'HSDUWPHQWRI3ODQQLQJDQG'HYHORSPHQW 983$XVHSHUPLWUHTXHVWE\6WHYHQ7LQWHURQEHKDOIRIWKHRZQHUV7KHRGRUHDQG *RYHUQPHQW&HQWHU3DUNZD\6XLWH)DLUID[9$$'$5HDVRQDEOHDFFRPPRGDWLRQLV .DULQ%ORVVWRSHUPLWDVWUHHWVHWEDFNRIIHHWWRWKHZDOO IHHWWRWKHHDYH IURP1RUWK DYDLODEOHXSRQKRXUVDGYDQFHQRWLFHSOHDVHFDOO 77<9LUJLQLD5HOD\ &DPHURQ6WUHHWLQVWHDGRIIHHWWRWKHZDOO IHHWWRWKHHDYH DVUHTXLUHGDQGWRSHUPLWD &HQWHU UHDUVHWEDFNRIIHHWWRWKHZDOO IHHWWRWKHHDYH IURPWKHUHDUORWOLQHLQVWHDGRIIHHWWR WKHZDOO IHHWWRWKHHDYH DVUHTXLUHGUHDQHZWZRVWRU\IURQWVLGHDGGLWLRQRQDVSOLW]RQHG 35&&7$//2$.6$75(6721/&35&$SSOWRDSSURYHD35&SODQDVVRFLDWHGZLWK SURSHUW\LQWKH5DQG5]RQLQJGLVWULFWVRQWKHSUHPLVHVNQRZQDV1RUWK&DPHURQ 5=&WRSHUPLWDGGLWLRQDOSDUNLQJIRUDQH[LVWLQJDVVLVWHGOLYLQJIDFLOLW\/RFDWHGRQWKH1 6WUHHW -RKQ0/DQJVWRQ VLGHRI1RUWK6KRUH'U(RILWVLQWHUVHFWLRQZLWK:LHKOH$YHRQDSSUR[DFRIODQG]RQHG 35&&RPS3ODQ5HF5HVLGHQWLDO3ODQQHG&RPPXQLW\+XQWHU0LOO'LVWULFW7D[0DS 983$XVHSHUPLWE\7LP9DQ9RQQRRQEHKDOIRIWKHRZQHU5HJLQD3HWVFKHWR % SHUPLWDVHWEDFNRIIHHWWRWKHZDOOLQVWHDGRIIHHWDVUHTXLUHGIURP1RUWK0DGLVRQ 6WUHHWDQGDULJKWVLGHVHWEDFNRIIHHWLQVWHDGRIIHHWDVUHTXLUHGWRWKHLQWHULRUSURSHUW\ OLQHUHRQHVWRU\VLGHDGGLWLRQDQGQHZIURQWSRUFKRQDQH[LVWLQJRQHIDPLO\GZHOOLQJRQD -DQXDU\WK FRUQHUORWLQWKH5]RQLQJGLVWULFWRQWKHSUHPLVHNQRZQDVWK5RDG1RUWK 'RPLQLRQ -DQXDU\WK +LOOV
$'
6WHSKHQ5LVVH %RDUGRI=RQLQJ$SSHDOV&RRUGLQDWRU Auctions: DC Auctions: DC Auctions: Maryland
$GYHUWLVLQJ'DWHV-DQXDU\WK 1RWLFHRI3XEOLF6DOH 6725$*(75($685(6$8&7,21$' 38%/,&$8&7,21 -DQXDU\WK ,QDFFRUGDQFHZLWK ([WUD6SDFH6WRUDJHZLOOKROGDSXEOLFDXFWLRQ 1RWLFHLVKHUHE\JLYHQWKDWRQ))ULGD\-DQXDU\ $' WKH:DVKLQJWRQ'& WKDWDP1HZ
Trustee Sales: Legal Notices Trustee Sales: DC Fairfax Co.
$/(;&223(5$8&76,1& 0$66$&+86(776$9(1: 7UXVWHH V6DOH :$6+,1*721'& 6XGOH\5RDG*DLQHVYLOOH9LUJLQLD :::$/(;&223(5&20 3DUFHO,' FAIRFAX COUNTY 'HIDXOW KDYLQJ EHHQ PDGH LQ WKH WHUPV RI D &2857$332,17('68%67,787(75867((6 )25(&/2685(6$/(2)5($/3523(57< FHUWDLQ'HHGRI7UXVWGDWHG$SULOLQWKH RULJLQDO SULQFLSDO DPRXQW RI DQG BOARD OF ZONING APPEALS (6W6( UHFRUGHGLQWKH&OHUN V2IILFHRIWKH&LUFXLW&RXUW :DVKLQJWRQ'& RI WKH &RXQW\ RI 3ULQFH :LOOLDP 9LUJLQLD LQ ,QVWUXPHQW1RDQGPRGLILHGE\ ,QH[HFXWLRQRIWKH6XSHULRU&RXUWIRU'LVWULFWRI D /RDQ 0RGLILFDWLRQ $JUHHPHQW UHFRUGHG DV FEBRUARY 10, 2021 &ROXPELD V &RXUW 2UGHU *UDQWLQJ 'HIDXOW ,QVWUXPHQW1RWKHXQGHUVLJQHG -XGJPHQWLQ&DVH&$5 53 9(/2&,7< 6XEVWLWXWH7UXVWHHVZLOOVHOODWSXEOLFDXFWLRQRQ 0257*$*( &$3,7$/ Y -$5(' :$5( WKH XQGHUVLJQHG6XEVWLWXWH7UXVWHHVZLOORIIHUIRUVDOHDW )HEUXDU\ DW SP LQ IURQW RI WKH SXEOLFDXFWLRQZLWKLQWKHRIILFHVRI$OH[&RRSHU EXLOGLQJKRXVLQJWKH3ULQFH:LOOLDP&RXQW\&LUFXLW $XFWV,QF0DVVDFKXVHWWV$YH1: &RXUW/HH$YHQXH0DQDVVDV9$WKH 127,&(,6+(5(%<*,9(1SXUVXDQWWR6HFWRIWKH=RQLQJ2UGLQDQFHWKDWDWDPHHWLQJ :DVKLQJWRQ'&RQ SURSHUW\FRQWDLQLQJDFDVGHVFULEHGE\ RIWKH)DLUID[&RXQW\%RDUGRI=RQLQJ$SSHDOV %=$ RIVDLG&RXQW\RQ:('1(6'$< PHWHVDQGERXQGVRQWKHDIRUHVDLG'HHGRI7UXVW 7+856'$<)(%58$5<$7$0 DQGEHLQJVXEMHFWWRDOOPDWWHUVVKRZQRQDSODW )(%58$5<DW$0WKH%=$ZLOOKROGSXEOLFKHDULQJVRQWKHIROORZLQJDSSOLFDWLRQV E\5%7KRPDV-/WGGDWHG$XJXVW DWWKHWLPHLQGLFDWHG7KLVPHHWLQJPD\EHKHOGHOHFWURQLFDOO\GXHWRWKH6WDWHRI(PHUJHQF\ 7+( $%29( '(6&5,%(' 3523(57< $1' 7RJHWKHUZLWKDULJKWRIZD\RYHU/RWWR5WH FDXVHGE\WKH&29,'SDQGHPLF3OHDVHFRQWDFWWKH6SHFLDO3HUPLWDQG9DULDQFH%UDQFKRI ,03529(0(1767+(5(21VLWXDWHGLQ:DVKLQJWRQ DVVKRZQLQD*UDQWRI(DVHPHQWUHFRUGHGLQ '&DQGPRUHIXOO\GHVLJQDWHGDV/RWLQ6TXDUH WKHDIRUHVDLG&OHUN V2IILFHLQ'HHG%RRN WKH=RQLQJ(YDOXDWLRQ'LYLVLRQ'HSDUWPHQWRI3ODQQLQJDQG'HYHORSPHQWDW RU LQD'HHGRI7UXVWGDWHG2FWREHU 3DJH 6DOH LV VXEMHFW WR DOO SULRU OLHQV %=$&OHUN0DLO#)DLUID[&RXQW\JRYRUUHYLHZRQOLQHDW UHFRUGHGDV,QVWUXPHQW1RDPRQJWKH HDVHPHQWV UHVWULFWLRQV FRYHQDQWV DQG '&/DQG5HFRUGV KWWSVZZZIDLUID[FRXQW\JRYSODQQLQJGHYHORSPHQWERDUG]RQLQJDSSHDOVDWOHDVWRQH FRQGLWLRQVLIDQ\RIUHFRUGRURWKHUPDWWHUV ZHHNSULRUWRWKHPHHWLQJIRUDGGLWLRQDOLQIRUPDWLRQRQWKHVWDWXVRIWKHPHHWLQJ7KHPHHWLQJ 7KHSURSHUW\ZLOOEHVROGE\7UXVWHHV 'HHGDVLV ZKLFKZRXOGEHGLVFORVHGE\DQDFFXUDWHVXUYH\ ZLWKRXWDQ\FRYHQDQWH[SUHVVHGRULPSOLHGLQ)HH RULQVSHFWLRQRIWKHSUHPLVHV7(506&$6+$ ZLOOEHDYDLODEOHWRYLHZOLYHRQ&KDQQHODQGVWUHDPOLYHRQOLQHDW 6LPSOH VXEMHFW WR FRQGLWLRQV UHVWULFWLRQV GHSRVLWRIRURIWKHVDOHSULFH ZZZIDLUID[FRXQW\JRYFDEOHFRQVXPHUFKDQQHOOLYHYLGHRVWUHDP/LYHDXGLRRIWKH HDVHPHQWVDQGDOORWKHUUHFRUGHGLQVWUXPHQWV ZKLFKHYHU LV ORZHU ZLOO EH UHTXLUHG RI WKH PHHWLQJPD\EHDFFHVVHGYLDWHOHSKRQHDVQRWHGRQWKHZHEVLWH$OOSHUVRQVZLVKLQJWR VXSHULRUWRWKH'HHGRI7UXVWUHIHUHQFHGDERYHDQG VXFFHVVIXOELGGHUDWWLPHRIVDOH3ULRUWRWKHVDOH VXEMHFWWRUDWLILFDWLRQE\WKH&RXUW LQWHUHVWHGELGGHUVZLOOEHUHTXLUHGWRUHJLVWHUZLWK SUHVHQWWKHLUYLHZVRQWKHVHVXEMHFWVPD\FDOOWKH&OHUNWRWKH%RDUGRI=RQLQJ$SSHDOVDW DQGPXVWSUHVHQWDELGGHSRVLWZKLFKPD\EHKHOG RUUHJLVWHURQOLQHDWKWWSVZZZIDLUID[FRXQW\JRYSODQQLQJGHYHORSPHQWERDUG 7(5062)6$/($GHSRVLWRIDWOHDVWRUWHQ GXULQJWKHVDOHE\WKHWUXVWHH7KHELGGHSRVLW ]RQLQJDSSHDOVWREHSODFHGRQWKH6SHDNHUV/LVWDQGPD\DSSHDUWREHKHDUGYLDWHOHSKRQHRU SHUFHQW RIWKHZLQQLQJELGDPRXQWZLOOEH PXVWEHFHUWLILHGIXQGVDQGRUFDVKEXWQRPRUH UHTXLUHGDWWLPHRIVDOHLQWKHIRUPRIFDVKLHU VRU WKDQ RI FDVK ZLOO EH DFFHSWHG 7KH SUHUHFRUGHGYLGHR'HDGOLQHVE\W\SHRIWHVWLPRQ\DUHRQWKHZHEVLWH,QDGGLWLRQZULWWHQ FHUWLILHGFKHFNRURWKHUIRUPDV6XEVWLWXWH7UXVWHHV VXFFHVVIXOELGGHUpVGHSRVLWZLOOEHUHWDLQHGDWWKH PD\GHWHUPLQH7KHGHSRVLWUHTXLUHGWRELGDWWKH WHVWLPRQ\DQGRWKHUVXEPLVVLRQVZLOOEHUHFHLYHGDW*RYHUQPHQW&HQWHU3DUNZD\6XLWH VDOHDQGDSSOLHGWRWKHVDOHSULFH,IKHOGE\WKH DXFWLRQLVZDLYHGIRUWKH1RWHKROGHUDQGDQ\RILWV )DLUID[DQG%=$&OHUN0DLO#)DLUID[&RXQW\JRY,IWKH%RDUGRI=RQLQJ$SSHDOVLV VXFFHVVRUVRUDVVLJQV7KH1RWHKROGHUPD\ELGXSWR WUXVWHHDOORWKHUELGGHSRVLWVZLOOEHUHWXUQHGWR PHHWLQJLQSHUVRQSKRQHDQGYLGHRWHVWLPRQ\DUHHQFRXUDJHGEXWLQSHUVRQDWWHQGDQFHDQG WKHDPRXQWRZHGRQWKH1RWHSOXVDOOFRVWVDQG WKHXQVXFFHVVIXOELGGHUV6HWWOHPHQWLVWREH H[SHQVHVRIVDOHRQFUHGLWDQGPD\VXEPLWDZULWWHQ PDGHZLWKLQGD\V7KHVXFFHVVIXOELGGHUZLOOEH WHVWLPRQ\DUHDOVRSHUPLWWHGDW*RYHUQPHQW&HQWHU3DUNZD\)DLUID[9$7KH ELG WR WKH 6XEVWLWXWH 7UXVWHHV ZKLFK VKDOO EH UHVSRQVLEOH IRU REWDLQLQJ SRVVHVVLRQ RI WKH IROORZLQJLVDGHVFULSWLYHVXPPDU\RQO\RIWKHDSSOLFDWLRQDQGPD\QRWLQFOXGHHYHU\GHWDLO DQQRXQFHGDWVDOH7KH%DODQFHRIWKHSXUFKDVH SURSHUW\DQGIRUDOOFRVWVDQGIHHVUHODWHGWR ,QWHUHVWHGSDUWLHVPD\UHYLHZWKHDSSOLFDWLRQLQGHWDLORQOLQHDW SULFHWREHSDLGLQFHUWLILHGIXQGVZLWKLQWKLUW\ UHFRUGLQJ WKH 7UXVWHHpV 'HHG LQFOXGLQJ WKH GD\VRIILQDOUDWLILFDWLRQRIWKHVDOHE\WKH&RXUW JUDQWRUV WD[ 7KH VXFFHVVIXO ELGGHU ZLOO EH OGVQHWIDLUID[FRXQW\JRYOGVQHW&RSLHVRIWKHVWDIIUHSRUWDUHDOVRDYDLODEOHRQOLQHDW 7,0(,62)7+((66(1&(,I3XUFKDVHUIDLOVWRVHWWOH UHTXLUHGWRH[HFXWHD0HPRUDQGXPRI7UXVWHH V KWWSOGVQHWIDLUID[FRXQW\JRYOGVQHW&XUUHQWLQ3URFHVV%=$DVSE\SXWWLQJLQWKHDSSOLFDWLRQ ZLWKLQ WKH DIRUHVDLG WKLUW\ GD\V RI WKH 6DOHDYDLODEOHIRUUHYLHZRQWKH)RUHFORVXUH6DOHV QXPEHURUPD\EHPDGHDYDLODEOHDW*RYHUQPHQW&HQWHU3DUNZD\ZLWKDGYDQFHQRWLFH UDWLILFDWLRQ WKH 3XUFKDVHU DJUHHV WR SD\ WKH SDJHRIZZZJODVVHUODZFRPRXWOLQLQJDGGLWLRQDO 6XEVWLWXWH7UXVWHHVpUHDVRQDEOHDWWRUQH\IHHVDV WHUPVRIVDOHDQGVHWWOHPHQW$7UXVWHHpV'HHG E\FRQWDFWLQJWKH&OHUNWRWKH%RDUGRI=RQLQJ$SSHDOVDVOLVWHGDERYH$'$5HDVRQDEOH RUGHUHGE\WKH&RXUWSOXVDOOFRVWVLQFXUUHGLIWKH ZLOOEHSUHSDUHGE\7UXVWHHpVDWWRUQH\DWKLJK DFFRPPRGDWLRQLVDYDLODEOHXSRQKRXUDGYDQFHQRWLFH)RUDGGLWLRQDOLQIRUPDWLRQRQ$'$ 6XEVWLWXWH 7UXVWHHV KDYH ILOHG WKH DSSURSULDWH PRWLRQ ZLWK WKH &RXUW WR UHVHOO WKH SURSHUW\ ELGGHUpVH[SHQVH7KLVLVDFRPPXQLFDWLRQIURPD FDOO 77<9LUJLQLD5HOD\&HQWHU 3XUFKDVHUZDLYHVSHUVRQDOVHUYLFHRIDQ\SDSHUILOHG GHEWFROOHFWRU*ODVVHUDQG*ODVVHU3/&RQ ZLWKWKH&RXUWLQFRQQHFWLRQZLWKVXFKPRWLRQDQG EHKDOIRI$WODQWLF7UXVWHH6HUYLFHV//&DQGRU DQ\6KRZ&DXVH2UGHULVVXHGE\WKH&RXUWDQG 5(26ROXWLRQV//&DQGRU$XFWLRQFRP9$//& $00LFDK50F&UDFNHQ6309$SSOXQGHU6HFWVDQGRIWKH H[SUHVVO\DJUHHVWRDFFHSWVHUYLFHRIDQ\VXFK 6XEVWLWXWH7UXVWHHV&URZQ&HQWHU%XLOGLQJ6XLWH =RQLQJ2UGLQDQFHWRSHUPLWDUHGXFWLRQWRWKHPLQLPXP\DUGUHTXLUHPHQWVEDVHGRQDQHUURU SDSHURU2UGHUE\FHUWLILHGPDLODQGUHJXODUPDLO (DVW0DLQ6WUHHW1RUIRON9$)LOH LQEXLOGLQJORFDWLRQWRSHUPLWDQDFFHVVRU\VWRUDJHVWUXFWXUHWRUHPDLQIWIURPWKHVLGHORW VHQWWRWKHDGGUHVVSURYLGHGE\WKH3XUFKDVHUDQG 1R7HO EHWZHHQ DVUHFRUGHGRQWKHGRFXPHQWVH[HFXWHGE\WKH DP QRRQRQO\ OLQHDQGIWIURPWKHUHDUORWOLQHDQGWRSHUPLWDQLQFUHDVHLQIHQFHKHLJKWLQDIURQW\DUG 3XUFKDVHUDWWKHWLPHRIWKHVDOH6HUYLFHVKDOOEH /RFDWHGDW:DJRQ:KHHO5G$OH[DQGULDRQDSSUR[VTIWRIODQG]RQHG5 GHHPHGHIIHFWLYHXSRQWKH3XUFKDVHUGD\VDIWHU 5XQ'DWHV-DQXDU\WK 0RXQW9HUQRQ'LVWULFW7D[0DS SRVWPDUNHGE\WKH8QLWHG6WDWHV3RVW2IILFH,WLV -DQXDU\WK H[SUHVVO\ DJUHHG E\ WKH 3XUFKDVHU WKDW DFWXDO $' UHFHLSWRIWKHFHUWLILHGPDLOLVQRWUHTXLUHGIRU $0'DYLG0RUJDQDQG$QQ0DULH)0RUJDQ6335$SSOXQGHU6HFWV VHUYLFHWREHHIIHFWLYH,IWKH3XUFKDVHUIDLOVWRJRWR VHWWOHPHQWWKHGHSRVLWVKDOOEHIRUIHLWHGWRWKH DQGRIWKH=RQLQJ2UGLQDQFHWRSHUPLWDUHGXFWLRQRIFHUWDLQ\DUGUHTXLUHPHQWVWRSHUPLW 6XEVWLWXWH7UXVWHHVDQGDOOH[SHQVHVRIWKLVVDOH DQDGGLWLRQ VFUHHQHGSRUFK IWIURPWKHUHDUORWOLQHDQGDUHGXFWLRQWRPLQLPXP\DUG LQFOXGLQJDWWRUQH\IHHVDQGIXOOFRPPLVVLRQRQWKH JURVVVDOHVSULFHRIWKHVDOH VKDOOEHFKDUJHG 75867((p6 6$/( 2) 52*(56 '5 )$//6 UHTXLUHPHQWVEDVHGRQDQHUURULQEXLOGLQJORFDWLRQWRDOORZDQDGGLWLRQ HQFORVHGFDUSRUW WR DJDLQVWDQGSDLGIURPWKHIRUIHLWHGGHSRVLW,QWKH &+85&+9$,QH[HFXWLRQRIDFHUWDLQ UHPDLQIWIURPWKHVRXWKVLGHORWOLQH/RFDWHGDW6ZLQEXUQH&W)DLUID[ HYHQWRIUHVDOHWKHGHIDXOWLQJ3XUFKDVHUVKDOOQRWEH 'HHGRI7UXVWGDWHG-XQHLQWKHRULJLQDO DSSUR[VTIWRIODQG]RQHG53URYLGHQFH'LVWULFW7D[0DS HQWLWOHGWRDQ\VXUSOXVSURFHHGVRUSURILWVUHVXOWLQJ SULQFLSDODPRXQWRIUHFRUGHGLQWKH IURPDQ\UHVDOHRIWKHSURSHUW\UHJDUGOHVVRIDQ\ &OHUNpV2IILFH&LUFXLW&RXUWIRU)DLUID[&RXQW\ LPSURYHPHQWVPDGHWRWKHUHDOSURSHUW\,QWHUHVWLV 9LUJLQLDLQ%RRNDW3DJHDV,QVWUXPHQW $06KLQ+\R-LQ.LP63%5$SSOXQGHU6HFWRIWKH=RQLQJ2UGLQDQFHWR WREHSDLGRQWKHXQSDLGSXUFKDVHPRQH\DWWKHUDWH 1R7KHXQGHUVLJQHG6XEVWLWXWH SHUPLWDUHGXFWLRQWRPLQLPXP\DUGUHTXLUHPHQWVEDVHGRQDQHUURULQEXLOGLQJORFDWLRQWR RISHUDQQXPIURPWKHGDWHRIVDOHWRWKHGDWH 7UXVWHHZLOORIIHUIRUVDOHDWSXEOLFDXFWLRQLQWKH WKHIXQGVDUHUHFHLYHGLQWKHRIILFHRIWKH6XEVWLWXWH IURQW RI WKH &LUFXLW &RXUW EXLOGLQJ IRU )DLUID[ SHUPLWDQDFFHVVRU\VWUXFWXUH FKLOGUHQpVSOD\URRPVWXGLR WRUHPDLQIWIURPWKHUHDUORW 7UXVWHHV,QWKHHYHQWWKDWWKHVHWWOHPHQWLVGHOD\HG &RXQW\&KDLQ%ULGJH5RDG)DLUID[9$RQ IRU$1<5($621:+$762(9(5WKHUHVKDOOEHQR OLQH/RFDWHGDW*DGVHQ'U)DLUID[DSSUR[VTIWRIODQG]RQHG5 )HEUXDU\ DW $0 WKH SURSHUW\ DEDWHPHQW RI LQWHUHVW 7D[HV ZDWHU UHQW &OXVWHU %UDGGRFN'LVWULFW7D[0DS FRQGRPLQLXPIHHVDQGRUKRPHRZQHUDVVRFLDWLRQ GHVFULEHGLQVDLG'HHGRI7UXVWORFDWHGDWWKH GXHVDOOSXEOLFFKDUJHVDVVHVVPHQWVSD\DEOHRQDQ DERYHDGGUHVVDQGPRUHSDUWLFXODUO\GHVFULEHGDV DQQXDOEDVLVLQFOXGLQJVDQLWDU\DQGRUPHWURSROLWDQ IROORZV/27)(1:,&.3$5.$67+(6$0( $0*HUDOG10LUDQGD-U63%5$SSOXQGHU6HFWRIWKH=RQLQJ GLVWULFWFKDUJHVLIDSSOLFDEOHWREHDGMXVWHGIRUWKH $33($56 '8/< '(',&$7(' 3/$77(' $1' 2UGLQDQFHWRSHUPLWPRGLILFDWLRQVWRWKHOLPLWDWLRQVRQWKHNHHSLQJRIDQLPDOV FKLFNHQV FXUUHQW\HDUWRGDWHRIVDOHDQGDVVXPHGWKHUHDIWHU 5(&25'(',1'(('%22.$73$*($021* /RFDWHGDW5K\PH&W$QQDQGDOHDSSUR[VTIWRIODQG]RQHG5%UDGGRFN E\WKH3XUFKDVHU3XUFKDVHUVKDOOEHUHVSRQVLEOHIRU 7+( /$1' 5(&25'6 2) )$,5)$; &2817< WKHFRVWVRIDOOWUDQVIHUWD[HVGRFXPHQWDU\VWDPSV 9,5*,1,$7(5062)6$/($//&$6+$ELGGHUpV 'LVWULFW7D[0DS DQGDOORWKHUFRVWVLQFLGHQWWRVHWWOHPHQW3XUFKDVHU GHSRVLWRIWHQSHUFHQW RIWKHVDOHSULFHRU VKDOOEHUHVSRQVLEOHIRUSK\VLFDOSRVVHVVLRQRIWKH WHQSHUFHQW RIWKHRULJLQDOSULQFLSDOEDODQFH www.washingtontimes.com SURSHUW\3XUFKDVHUDVVXPHVWKHULVNRIORVVIURP RIWKHVXEMHFW'HHGRI7UXVWZKLFKHYHULVORZHULQ WKHGDWHRIVDOHIRUZDUG,IWKH6XEVWLWXWH7UXVWHHV WKHIRUPRIFDVKRUFHUWLILHGIXQGVSD\DEOHWRWKH DUHXQDEOHWRFRQYH\JRRGDQGPDUNHWDEOHWLWOHWKH 6XEVWLWXWH7UXVWHHPXVWEHSUHVHQWDWWKHWLPHRI -DQXDU\WK 3XUFKDVHU VVROHUHPHG\LQODZRUHTXLW\VKDOOEH OLPLWHGWRWKHUHIXQGRIWKHGHSRVLWWRWKH3XUFKDVHU WKHVDOH7KHEDODQFHRIWKHSXUFKDVHSULFHZLOOEH -DQXDU\WK 7KH VDOH LV VXEMHFW WR SRVW VDOH DXGLW E\ WKH GXHZLWKLQILIWHHQ GD\VRIVDOHRWKHUZLVH QRWHKROGHUWRGHWHUPLQHZKHWKHUWKHERUURZHUILOHG 3XUFKDVHUpVGHSRVLWPD\EHIRUIHLWHGWR7UXVWHH EDQNUXSWF\ HQWHUHG LQWR DQ\ 7LPHLVRIWKHHVVHQFH6XEVWLWXWH7UXVWHHKDV $' UHSD\PHQWIRUEHDUDQFHDJUHHPHQWUHLQVWDWHGRU LGHQWLILHGDQXQUHOHDVHGVHFXULW\LQVWUXPHQWZKLFK SDLGRIISULRUWRWKHVDOH,QDQ\VXFKHYHQWWKH PD\EHVXSHULRUWRWKHVXEMHFW'HHGRI7UXVW 3XUFKDVHUDJUHHVWKDWXSRQQRWLILFDWLRQE\WKH 6XEVWLWXWH7UXVWHHGLVFODLPVDQ\LPSOLFDWLRQWKDW 6XEVWLWXWH7UXVWHHVRIVXFKHYHQWWKHVDOHLVQXOODQG WKH3URSHUW\ZLOOEHVROGIUHHDQGFOHDURIDOOOLHQV YRLGDQGRIQROHJDOHIIHFWDQGWKHGHSRVLWUHWXUQHG ,I WKH VDOH LV VHW DVLGH IRU DQ\ UHDVRQ WKH ZLWKRXWLQWHUHVW 0DWWHU 3XUFKDVHUDWWKHVDOHVKDOOEHHQWLWOHGWRDUHWXUQ 9$$%& Trustee Sales: DC Trustee Sales: DC RIWKHGHSRVLWSDLG7KH3XUFKDVHUPD\LISURYLGHG /DXUD+*2 6XOOLYDQHWDO6XEVWLWXWH7UXVWHHV E\WKHWHUPVRIWKH7UXVWHHpV0HPRUDQGXPRI 9,5*,1,$'(3$570(172) :DVKLQJWRQ7LPHV-DQ-DQ-DQ)HE )RUHFORVXUH6DOHEHHQWLWOHGWRDFDQFHOODWLRQ $/&2+2/,&%(9(5$*(&21752/$87+25,7< 6HULDO $' IHHIURPWKH6XEVWLWXWH7UXVWHHEXWVKDOOKDYHQR +HUPLWDJH5RDGs32%R[ $/(;&223(5$8&76,1& $/(;&223(5$8&76,1& 5LFPRQG9$ IXUWKHU UHFRXUVH DJDLQVW WKH 0RUWJDJRU WKH 0$66$&+86(776$9(1: 0$66$&+86(776$9(1: 0RUWJDJHHRUWKH0RUWJDJHHpVDWWRUQH\$IRUP :$6+,1*721'& :$6+,1*721'& Trustee Sales: FRS\RIWKH7UXVWHHpVPHPRUDQGXPRIIRUHFORVXUH 5(7$,//,&(16($33/,&$7,21 :::$/(;&223(5&20 :::$/(;&223(5&20 Fairfax Co. VDOHDQGFRQWUDFWWRSXUFKDVHUHDOSURSHUW\LV 38%/,6+,1*127,&( &2857$332,17('68%67,787(75867((6 &2857$332,17('68%67,787(75867((6 DYDLODEOH IRU YLHZLQJ DW ZZZEZZVDOHVFRP )25(&/2685(6$/(2)5($/3523(57< )25(&/2685(6$/(2)5($/3523(57< %,''(56 $5( 67521*/< (1&285$*(' 72 )2//2: &'& *8,'$1&( $1' :($5 $ &29(5 75867((p66$/(2) 29(5%27+126($1'0287+$1'35$&7,&( )XOOQDPH V RIRZQHU V WK6W1( WK6W1( :DVKLQJWRQ'& :DVKLQJWRQ'& (6,'('5,9( 62&,$/',67$1&,1*$77+($8&7,21$GGLWLRQDO $/(;$1'5,$9,5*,1,$ WHUPVLIDQ\WREHDQQRXQFHGDWWKHVDOHDQGWKH 6DLJRQ2XWFDVW//& ,QH[HFXWLRQRIWKH6XSHULRU&RXUWIRU'LVWULFWRI 7KH ODQG LV GHVLJQDWHG RQ WKH UHFRUGV RI WKH &2817<2))$,5)$; 3XUFKDVHUPD\EHJLYHQWKHRSWLRQWRH[HFXWHWKH &ROXPELD V &RXUW 2UGHU *UDQWLQJ 'HIDXOW $VVHVVRUIRUWKH'LVWULFWRI&ROXPELDIRUDVVHVVPHQW FRQWUDFW RI VDOH HOHFWURQLFDOO\ 7KLV LV D 7UDGLQJDV -XGJPHQWLQ&DVH&$5 53 86%$1. DQGWD[DWLRQSXUSRVHVDV/RWLQ6TXDUH:DV ,QH[HFXWLRQRIDFHUWDLQGHHGRIWUXVWGDWHG FRPPXQLFDWLRQIURPDGHEWFROOHFWRUDQGDQ\ 6DLJRQ2XWFDVW 1$7,21$/$662&,$7,21127,1,76,1',9,'8$/ PRUHSDUWLFXODUO\GHVFULEHGLQVDLG'HHGRI7UXVW LQ WKH RULJLQDO SULQFLSDO DPRXQW RI LQIRUPDWLRQREWDLQHGZLOOEHXVHGIRUWKDWSXUSRVH *HRUJH:DVKLQJWRQ%OYG &$3$&,7<%8762/(/<$675867(()257+(50$& UHFRUGHG LQ WKH &RXQW\ RI )DLUID[ 7KH VDOH LV VXEMHFW WR VHOOHU FRQILUPDWLRQ 758676(5,(6&77Y(67$7(2)52%,(( ,QH[HFXWLRQRIWKH6XSHULRU&RXUWIRU'LVWULFWRI $VKEXUQ FLW\WRZQ 9LUJLQLDDV%RRN3DJHDV,QVWUXPHQW 6XEVWLWXWH7UXVWHH(TXLW\7UXVWHHV//& /RXGRXQ FRXQW\ 9LUJLQLD 0&:,//,$06WKHXQGHUVLJQHG6XEVWLWXWH7UXVWHHV &ROXPELD V &RXUW 2UGHU *UDQWLQJ 'HIDXOW 1RDVDPHQGHGE\DQLQVWUXPHQW ZLOORIIHUIRUVDOHDWSXEOLFDXFWLRQZLWKLQWKHRIILFHV -XGJPHQW LQ &DVH &$ 5 53 .&6 7KUHH&KRSW5RDG6XLWH5LFKPRQG9$ DSSRLQWLQJWKHXQGHUVLJQHGDV6XEVWLWXWH7UXVWHH )RUPRUHLQIRUPDWLRQFRQWDFW%::/DZ*URXS RI$OH[&RRSHU$XFWV,QF0DVVDFKXVHWWV /(1',1* //& Y 1(:721 1: //& WKH GHIDXOWKDYLQJRFFXUUHGLQWKHSD\PHQWRIWKH 7KH DERYH HVWDEOLVKPHQW LV DSSO\LQJ WR WKH $YH1::DVKLQJWRQ'& XQGHUVLJQHG6XEVWLWXWH7UXVWHHVZLOORIIHUIRUVDOHDW //& DWWRUQH\V IRU (TXLW\ 7UXVWHHV //& 9,5*,1,$$/&2+2/,&%(9(5$*(&21752/ $%& RQ SXEOLFDXFWLRQZLWKLQWKHRIILFHVRI$OH[&RRSHU 1RWHWKHUHE\VHFXUHGDQGDWWKHUHTXHVWRIWKH ([HFXWLYH%OYG6XLWH5RFNYLOOH0' $87+25,7<IRUD0L[HG%HYHUDJHOLFHQVHWRVHOO $XFWV,QF0DVVDFKXVHWWV$YH1: KROGHUWKHXQGHUVLJQHG6XEVWLWXWH7UXVWHHZLOO ZHEVLWH ZZZEZZVDOHVFRP 9$ RUPDQXIDFWXUHDOFRKROLFEHYHUDJHV 7+856'$<-$18$5<$7$0 :DVKLQJWRQ'&RQ RIIHUIRUVDOHDWSXEOLFDXFWLRQLQWKHIURQWRIWKH EXLOGLQJKRXVLQJWKH&LUFXLW&RXUWRIWKH&2817< $QWKRQ\&DWVHOLGHV 7+( $%29( '(6&5,%(' 3523(57< $1' 7+856'$<-$18$5<$7$0 2))$,5)$;9$ORFDWHGDW&KDLQ%ULGJH -DQXDU\DQG 0HPEHU ,03529(0(1767+(5(21VLWXDWHGLQ:DVKLQJWRQ 5RDG)DLUID[9LUJLQLDRQ)HEUXDU\ $' '&DQGPRUHIXOO\GHVLJQDWHGDV/RWLQ6TXDUH 7+( $%29( '(6&5,%(' 3523(57< $1' DW$0WKHSURSHUW\GHVFULEHGLQVDLGGHHGRI LQD'HHGRI7UXVWGDWHG1RYHPEHU ,03529(0(1767+(5(21VLWXDWHGLQ:DVKLQJWRQ WUXVW ORFDWHG DW WKH DERYH DGGUHVV ZLWK 127(2EMHFWLRQVWRWKHLVVXDQFHRIWKLVOLFHQVH UHFRUGHGDV,QVWUXPHQW1RDPRQJWKH '&DQGPRUHIXOO\GHVFULEHGLQD'HHGRI7UXVWGDWHG LPSURYHPHQWVWKHUHRQDQGPRUHSDUWLFXODUO\ PXVWEHVXEPLWWHGWR$%&QRODWHUWKDQGD\V '&/DQG5HFRUGV -XO\UHFRUGHGDV,QVWUXPHQW1R GHVFULEHGDVIROORZV/276 %/2&.- IURP WKH SXEOLVKLQJ GDWH RI WKH ILUVW RI WZR DPRQJWKH'&/DQG5HFRUGV 0(025,$/+(,*+763/$75(&25'(',1'((' Auctions: Virginia UHTXLUHGQHZVSDSHUOHJDOQRWLFHV2EMHFWLRQV 7KHSURSHUW\ZLOOEHVROGE\7UXVWHHV 'HHGDVLV %22.7$73$*($1''(('%22.=$7 ZLWKRXWDQ\FRYHQDQWH[SUHVVHGRULPSOLHGLQ)HH 7KHSURSHUW\ZLOOEHVROGE\7UXVWHHV 'HHGDVLV VKRXOGEHUHJLVWHUHGDWZZZDEFYLUJLQLDJRYRU 3$*(,17+(&2817<2))$,5)$;9$7(506 6LPSOH VXEMHFW WR FRQGLWLRQV UHVWULFWLRQV ZLWKRXWDQ\FRYHQDQWH[SUHVVHGRULPSOLHGLQ)HH HDVHPHQWVDQGDOORWKHUUHFRUGHGLQVWUXPHQWV 6LPSOH VXEMHFW WR FRQGLWLRQV UHVWULFWLRQV 2)6$/(1HLWKHUWKH6XEVWLWXWH7UXVWHHQRUWKH KROGHURIWKHQRWHVHFXUHGE\WKHGHHGRIWUXVWZLOO 127,&( 2) 38%/,& 6$/( 6HOIVWRUDJH &XEH 5XQ'DWHV-DQXDU\WK VXSHULRUWRWKH'HHGRI7UXVWUHIHUHQFHGDERYHDQG HDVHPHQWVDQGDOORWKHUUHFRUGHGLQVWUXPHQWV FRQWHQWV ZLOO EH VROG IRU FDVK E\ &XEH6PDUW VXEMHFWWRUDWLILFDWLRQE\WKH&RXUW VXSHULRUWRWKH'HHGRI7UXVWUHIHUHQFHGDERYHDQG GHOLYHU SRVVHVVLRQ RI WKH SURSHUW\ WR WKH -DQXDU\WK VXFFHVVIXOELGGHU7KHSXUFKDVHUDWWKHVDOHZLOO 0DQDJHPHQW//&6KLUOLQJWRQ5G$UOLQJWRQ VXEMHFWWRUDWLILFDWLRQE\WKH&RXUW 9$DWDSSUR[DP(LVHQKRZHU $' 7(5062)6$/($GHSRVLWRIDWOHDVWRUWHQ EHUHTXLUHGWRSD\DOOFORVLQJFRVWV5HDOHVWDWH SHUFHQW RIWKHZLQQLQJELGDPRXQWZLOOEH 7(5062)6$/($GHSRVLWRIDWOHDVWRUWHQ WD[HVZDWHUVHZHUIHHVDQGRWKHUSXEOLFFKDUJHV $YH$OH[DQGULD9$DWDSSUR[DP UHTXLUHGDWWLPHRIVDOHLQWKHIRUPRIFDVKLHU VRU SHUFHQW RIWKHZLQQLQJELGDPRXQWZLOOEH ZLOOEHSURUDWHGDVRIWKHGDWHRIVDOH7KHULVNRI 8SVKXU6W1::DVKLQJWRQ'&DWDSUR[ FHUWLILHGFKHFNRURWKHUIRUPDV6XEVWLWXWH7UXVWHHV UHTXLUHGDWWLPHRIVDOHLQFDVKFHUWLILHGFKHFNRU ORVVRUGDPDJHWRWKHSURSHUW\SDVVHVWRWKH SP)ORULGD$YH1::DVKLQJWRQ'&DW DSUR[SPWRVDWLVI\DOLHQIRUUHQWDORQ-DQXDU\ 9$$%& PD\GHWHUPLQH7KHGHSRVLWUHTXLUHGWRELGDWWKH RWKHUIRUPDV6XEVWLWXWH7UXVWHHVPD\GHWHUPLQH SXUFKDVHULPPHGLDWHO\XSRQWKHFRQFOXVLRQRIWKH WKDWZZZVWRUDJHWUHDVXUHVFRP 9,5*,1,$'(3$570(172) DXFWLRQLVZDLYHGIRUWKH1RWHKROGHUDQGDQ\RILWV 7KHGHSRVLWUHTXLUHGWRELGDWWKHDXFWLRQLVZDLYHG 6XEVWLWXWH 7UXVWHHpV VDOH 7HUPV $ ELGGHUpV VXFFHVVRUVRUDVVLJQV7KH1RWHKROGHUPD\ELGXSWR IRUWKH1RWHKROGHUDQGDQ\RILWVVXFFHVVRUVRU $/&2+2/,&%(9(5$*(&21752/$87+25,7< GHSRVLWRIWHQSHUFHQW RIWKHVDOHSULFHRU WKHDPRXQWRZHGRQWKH1RWHSOXVDOOFRVWVDQG DVVLJQV7KH1RWHKROGHUPD\ELGXSWRWKHDPRXQW WHQSHUFHQWSULFH RIWKHRULJLQDOSULQFLSDO 5XQ'DWH-DQXDU\WK$' +HUPLWDJH5RDGs32%R[ H[SHQVHVRIVDOHRQFUHGLWDQGPD\VXEPLWDZULWWHQ RZHGRQWKH1RWHSOXVDOOFRVWVDQGH[SHQVHVRIVDOH 5LFPRQG9$ ELG WR WKH 6XEVWLWXWH 7UXVWHHV ZKLFK VKDOO EH RQ FUHGLW DQG PD\ VXEPLW D ZULWWHQ ELG WR WKH EDODQFHRIWKHVXEMHFWGHHGRIWUXVWZKLFKHYHULV DQQRXQFHGDWVDOH7KH%DODQFHRIWKHSXUFKDVH 6XEVWLWXWH7UXVWHHVZKLFKVKDOOEHDQQRXQFHGDW ORZHU LQ WKH IRUP RI FDVK RU FHUWLILHG IXQGV 5(7$,//,&(16($33/,&$7,21 SULFHWREHSDLGLQFHUWLILHGIXQGVZLWKLQWKLUW\ VDOH7KH%DODQFHRIWKHSXUFKDVHSULFHWREHSDLGLQ SD\DEOHWRWKH6XEVWLWXWH7UXVWHHPXVWEHSUHVHQW GD\VRIILQDOUDWLILFDWLRQRIWKHVDOHE\WKH&RXUW FHUWLILHGIXQGVZLWKLQGD\VRIILQDOUDWLILFDWLRQRI DWWKHWLPHRIVDOH7KHEDODQFHRIWKHSXUFKDVH 38%/,6+,1*127,&( 7,0(,62)7+((66(1&(,I3XUFKDVHUIDLOVWRVHWWOH WKHVDOHE\WKH&RXUW7,0(,62)7+((66(1&(,I SULFHZLOOEHGXHZLWKLQGD\VDWWKHRIILFHRIWKH ([WUD 6SDFH 6WRUDJH ZLOO KROG D SXEOLF ZLWKLQ WKH DIRUHVDLG WKLUW\ GD\V RI WKH 3XUFKDVHUIDLOVWRVHWWOHZLWKLQWKHDIRUHVDLGGD\V 6XEVWLWXWH 7UXVWHH 7KH 6XEVWLWXWH 7UXVWHH DXFWLRQ DW WKH ORFDWLRQ LQGLFDWHG UDWLILFDWLRQ WKH 3XUFKDVHU DJUHHV WR SD\ WKH RIWKHUDWLILFDWLRQWKH3XUFKDVHUDJUHHVWRSD\WKH UHVHUYHVWKHULJKWWRVXVSHQGELGGLQJSULRUWR 6XEVWLWXWH7UXVWHHVpUHDVRQDEOHDWWRUQH\IHHVDV 6XEVWLWXWH7UXVWHHVpUHDVRQDEOHDWWRUQH\IHHVDV FRPSOHWLRQRIWKHVDOH7LPHLVRIWKHHVVHQFHDV )XOOQDPH V RIRZQHU V RUGHUHGE\WKH&RXUWSOXVDOOFRVWVLQFXUUHGLIWKH RUGHUHGE\WKH&RXUWSOXVDOOFRVWVLQFXUUHGLIWKH WR WKH FORVLQJ GDWH DQG WKH SD\PHQW RI WKH 3RWRPDF 0LOOV 5G :RRGEULGJH 9$ 6XEVWLWXWH 7UXVWHHV KDYH ILOHG WKH DSSURSULDWH 6XEVWLWXWH 7UXVWHHV KDYH ILOHG WKH DSSURSULDWH SXUFKDVHSULFH,ISD\PHQWRIWKHEDODQFHGRHV RQ -DQXDU\ DW 30 =RILD//& PRWLRQ ZLWK WKH &RXUW WR UHVHOO WKH SURSHUW\ PRWLRQ ZLWK WKH &RXUW WR UHVHOO WKH SURSHUW\ QRWRFFXUZLWKLQWZHQW\GD\VRIWKHVDOHGDWHWKH 3XUFKDVHUZDLYHVSHUVRQDOVHUYLFHRIDQ\SDSHUILOHG 3XUFKDVHUZDLYHVSHUVRQDOVHUYLFHRIDQ\SDSHUILOHG GHSRVLW ZLOO EH IRUIHLWHG 6HOOHU VKDOO QRW EH ZLWKWKH&RXUWLQFRQQHFWLRQZLWKVXFKPRWLRQDQG ZLWKWKH&RXUWLQFRQQHFWLRQZLWKVXFKPRWLRQDQG 7UDGLQJDV UHVSRQVLEOH IRU DQ\ FRVWV LQFXUUHG E\ WKH =RILD V.LWFKHQ DQ\6KRZ&DXVH2UGHULVVXHGE\WKH&RXUWDQG DQ\6KRZ&DXVH2UGHULVVXHGE\WKH&RXUWDQG H[SUHVVO\DJUHHVWRDFFHSWVHUYLFHRIDQ\VXFK H[SUHVVO\DJUHHVWRDFFHSWVHUYLFHRIDQ\VXFK SXUFKDVHULQFRQQHFWLRQZLWKWKHLUSXUFKDVHRU 7KHDXFWLRQZLOOEHOLVWHGDQGDGYHUWLVHGRQ :LOVRQ%OYG6WH VHWWOHPHQWLQFOXGLQJZLWKRXWOLPLWDWLRQVWDWHDQG ZZZVWRUDJHWUHDVXUHVFRP3XUFKDVHVPXVW $UOLQJWRQ FLW\WRZQ SDSHURU2UGHUE\FHUWLILHGPDLODQGUHJXODUPDLO SDSHURU2UGHUE\FHUWLILHGPDLODQGUHJXODUPDLO VHQWWRWKHDGGUHVVSURYLGHGE\WKH3XUFKDVHUDQG VHQWWRWKHDGGUHVVSURYLGHGE\WKH3XUFKDVHUDQG ORFDOUHFRUGLQJIHHVWLWOHLQVXUDQFHRUUHVHDUFKRU EH PDGH ZLWK FDVK RQO\ DQG SDLG DW WKH $UOLQJWRQ FRXQW\ 9LUJLQLD DVUHFRUGHGRQWKHGRFXPHQWVH[HFXWHGE\WKH DVUHFRUGHGRQWKHGRFXPHQWVH[HFXWHGE\WKH DQ\RWKHUFRVWVRISXUFKDVHUpVDFTXLVLWLRQ7UXVWHH DERYH UHIHUHQFHG IDFLOLW\ LQ RUGHU WR 3XUFKDVHUDWWKHWLPHRIWKHVDOH6HUYLFHVKDOOEH 3XUFKDVHUDWWKHWLPHRIWKHVDOH6HUYLFHVKDOOEH VKDOO KDYH QR GXW\ WR REWDLQ SRVVHVVLRQ IRU FRPSOHWH WKH WUDQVDFWLRQ ([WUD 6SDFH 7KH DERYH HVWDEOLVKPHQW LV DSSO\LQJ WR WKH GHHPHGHIIHFWLYHXSRQWKH3XUFKDVHUGD\VDIWHU GHHPHGHIIHFWLYHXSRQWKH3XUFKDVHUGD\VDIWHU SXUFKDVHU$OOULVNVRIFDVXDOW\SDVVWRVXFFHVVIXO 6WRUDJHPD\UHIXVHDQ\ELGDQGPD\UHVFLQG 9,5*,1,$$/&2+2/,&%(9(5$*(&21752/ $%& SRVWPDUNHGE\WKH8QLWHG6WDWHV3RVW2IILFH,WLV SRVWPDUNHGE\WKH8QLWHG6WDWHV3RVW2IILFH,WLV ELGGHUDWFRQFOXVLRQRIELGGLQJ7KHSURSHUW\DQG DQ\SXUFKDVHXSXQWLOWKHZLQQLQJELGGHU $87+25,7<IRUD:LQH %HHU2Q2II3UHPLVHV H[SUHVVO\ DJUHHG E\ WKH 3XUFKDVHU WKDW DFWXDO H[SUHVVO\ DJUHHG E\ WKH 3XUFKDVHU WKDW DFWXDO WKHLPSURYHPHQWVWKHUHRQZLOOEHVROGq$6,6rDQG WDNHVSRVVHVVLRQRIWKHSHUVRQDOSURSHUW\ 0L[HG%HYHUDJHOLFHQVHWRVHOORUPDQXIDFWXUH UHFHLSWRIWKHFHUWLILHGPDLOLVQRWUHTXLUHGIRU UHFHLSWRIWKHFHUWLILHGPDLOLVQRWUHTXLUHGIRU ZLWKRXWUHSUHVHQWDWLRQRUZDUUDQWLHVRIDQ\NLQG DOFRKROLFEHYHUDJHV VHUYLFHWREHHIIHFWLYH,IWKH3XUFKDVHUIDLOVWRJRWR VHUYLFHWREHHIIHFWLYH,IWKH3XUFKDVHUIDLOVWRJRWR 7KHVDOHLVVXEMHFWWRDOOOLHQVHQFXPEUDQFHV VHWWOHPHQWWKHGHSRVLWVKDOOEHIRUIHLWHGWRWKH VHWWOHPHQWWKHGHSRVLWVKDOOEHIRUIHLWHGWRWKH FRQGLWLRQVHDVHPHQWVDQGUHVWULFWLRQVLIDQ\ 5XQ'DWH-DQXDU\WK 6XEVWLWXWH7UXVWHHVDQGDOOH[SHQVHVRIWKLVVDOH 6XEVWLWXWH7UXVWHHVDQGDOOH[SHQVHVRIWKLVVDOH VXSHULRU WR WKH PHQWLRQHG GHHG RI WUXVW DQG $' 1DWH5H\QROGV LQFOXGLQJDWWRUQH\IHHVDQGIXOOFRPPLVVLRQRQWKH LQFOXGLQJDWWRUQH\IHHVDQGIXOOFRPPLVVLRQRQWKH 0HPEHU JURVVVDOHVSULFHRIWKHVDOH VKDOOEHFKDUJHG JURVVVDOHVSULFHRIWKHVDOH VKDOOEHFKDUJHDJDLQVW ODZIXOO\DIIHFWLQJWKHSURSHUW\6DOHLVVXEMHFWWR DJDLQVWDQGSDLGIURPWKHIRUIHLWHGGHSRVLW,QWKH DQGSDLGIURPWKHIRUIHLWHGGHSRVLW,QWKHHYHQWRI SRVWVDOHFRQILUPDWLRQWKDWWKHERUURZHUGLGQRW 127(2EMHFWLRQVWRWKHLVVXDQFHRIWKLVOLFHQVH HYHQWRIUHVDOHWKHGHIDXOWLQJ3XUFKDVHUVKDOOQRWEH UHVDOHWKHGHIDXOWLQJ3XUFKDVHUVKDOOQRWEHHQWLWOHG ILOHIRUSURWHFWLRQXQGHUWKH86%DQNUXSWF\&RGH PXVWEHVXEPLWWHGWR$%&QRODWHUWKDQGD\V HQWLWOHGWRDQ\VXUSOXVSURFHHGVRUSURILWVUHVXOWLQJ WRDQ\VXUSOXVSURFHHGVRUSURILWVUHVXOWLQJIURPDQ\ SULRU WR WKH VDOH DV ZHOO DV WR SRVWVDOH IURP WKH SXEOLVKLQJ GDWH RI WKH ILUVW RI WZR IURPDQ\UHVDOHRIWKHSURSHUW\UHJDUGOHVVRIDQ\ UHVDOH RI WKH SURSHUW\ UHJDUGOHVV RI DQ\ FRQILUPDWLRQDQGDXGLWRIWKHVWDWXVRIWKHORDQ UHTXLUHGQHZVSDSHUOHJDOQRWLFHV2EMHFWLRQV LPSURYHPHQWVPDGHWRWKHUHDOSURSHUW\,QWHUHVWLV LPSURYHPHQWVPDGHWRWKHUHDOSURSHUW\,QWHUHVWLV ZLWKWKHORDQVHUYLFHULQFOXGLQJEXWQRWOLPLWHGWR 38%/,&$8&7,21 VKRXOGEHUHJLVWHUHGDWZZZDEFYLUJLQLDJRYRU WREHSDLGRQWKHXQSDLGSXUFKDVHPRQH\DWWKHUDWH WREHSDLGRQWKHXQSDLGSXUFKDVHPRQH\DWWKHUDWH GHWHUPLQDWLRQRIZKHWKHUWKHERUURZHU V HQWHUHG RISHUDQQXPIURPWKHGDWHRIVDOHWRWKHGDWH RISHUDQQXPIURPWKHGDWHRIVDOHWRWKHGDWH LQWRDQ\UHSD\PHQWDJUHHPHQWUHLQVWDWHGRUSDLG $8&7,21:,//,1&/8'('()$8/7('+286(+2/' WKHIXQGVDUHUHFHLYHGLQWKHRIILFHRIWKH6XEVWLWXWH WKHIXQGVDUHUHFHLYHGLQWKHRIILFHRIWKH6XEVWLWXWH RIIWKHORDQSULRUWRWKHVDOH,QDQ\VXFKHYHQW *22'6$1'0(5&+$1',6()52077+(86725( 7UXVWHHV,QWKHHYHQWWKDWWKHVHWWOHPHQWLVGHOD\HG 7UXVWHHV,QWKHHYHQWWKDWWKHVHWWOHPHQWLVGHOD\HG 6(/)6725$*(:$5(+286(38%/,&$8&7,21 5XQ'DWHV-DQXDU\WK WKHVDOHVKDOOEHQXOODQGYRLGDQGWKH3XUFKDVHUpV IRU$1<5($621:+$762(9(5WKHUHVKDOOEHQR IRU$1<5($621:+$762(9(5WKHUHVKDOOEHQR VROHUHPHG\LQODZRUHTXLW\VKDOOEHWKHUHWXUQ :,//%(+(/'$7 -DQXDU\WK DEDWHPHQW RI LQWHUHVW 7D[HV ZDWHU UHQW DEDWHPHQW RI LQWHUHVW 7D[HV ZDWHU UHQW RI WKH 3XUFKDVHUpV GHSRVLW ZLWKRXW LQWHUHVW $' FRQGRPLQLXPIHHVDQGRUKRPHRZQHUDVVRFLDWLRQ FRQGRPLQLXPIHHVDQGRUKRPHRZQHUDVVRFLDWLRQ $GGLWLRQDOWHUPVWREHDQQRXQFHGDWWKHVDOH)RU 86725(6(0,1$5<5')$//6&+85&+9$ GXHVDOOSXEOLFFKDUJHVDVVHVVPHQWVSD\DEOHRQDQ GXHVDOOSXEOLFFKDUJHVDVVHVVPHQWVSD\DEOHRQDQ ))5,'$<-$18$5<7+$730 DQQXDOEDVLVLQFOXGLQJVDQLWDU\DQGRUPHWURSROLWDQ DQQXDOEDVLVLQFOXGLQJVDQLWDU\DQGRUPHWURSROLWDQ PRUHLQIRUPDWLRQFRQWDFW$EE\0R\QLKDQ(VT GLVWULFWFKDUJHVLIDSSOLFDEOHWREHDGMXVWHGIRUWKH GLVWULFWFKDUJHVLIDSSOLFDEOHWREHDGMXVWHGIRUWKH PHPEHURI6XUHW\7UXVWHHVDWRU ZZZPZFODZFRP 7(5062)6$/(&$6++2856725(029( FXUUHQW\HDUWRGDWHRIVDOHDQGDVVXPHGWKHUHDIWHU FXUUHQW\HDUWRGDWHRIVDOHDQGDVVXPHGWKHUHDIWHU *22'6 127,&(2)$33/,&$7,2172(67$%/,6+%5$1&+ E\WKH3XUFKDVHU3XUFKDVHUVKDOOEHUHVSRQVLEOHIRU E\WKH3XUFKDVHU3XUFKDVHUVKDOOEHUHVSRQVLEOHIRU WKHFRVWVRIDOOWUDQVIHUWD[HVGRFXPHQWDU\VWDPSV WKHFRVWVRIDOOWUDQVIHUWD[HVGRFXPHQWDU\VWDPSV -DQXDU\ 7UXVWDU%DQNDW:DONHU5RDG*UHDW)DOOV DQGDOORWKHUFRVWVLQFLGHQWWRVHWWOHPHQW3XUFKDVHU DQGDOORWKHUFRVWVLQFLGHQWWRVHWWOHPHQW3XUFKDVHU -DQXDU\ $GYHUWLVHG-DQXDU\WK 9LUJLQLD ILOHG DQ $SSOLFDWLRQ ZLWK WKH VKDOOEHUHVSRQVLEOHIRUSK\VLFDOSRVVHVVLRQRIWKH VKDOOEHUHVSRQVLEOHIRUSK\VLFDOSRVVHVVLRQRIWKH $' $' )HGHUDO 'HSRVLW ,QVXUDQFH &RUSRUDWLRQ WR SURSHUW\3XUFKDVHUDVVXPHVWKHULVNRIORVVIURP SURSHUW\3XUFKDVHUDVVXPHVWKHULVNRIORVVIURP (VWDEOLVKD'RPHVWLF%UDQFKDW0RQWURVH WKHGDWHRIVDOHIRUZDUG,IWKH6XEVWLWXWH7UXVWHHV WKHGDWHRIVDOHIRUZDUG7KHVDOHLVVXEMHFWWRSRVW 5RDG 3RWRPDF 0DU\ODQG $Q\ SHUVRQ DUHXQDEOHWRFRQYH\JRRGDQGPDUNHWDEOHWLWOHWKH VDOHDXGLWE\WKHQRWHKROGHUWRGHWHUPLQHZKHWKHU ZLVKLQJWRFRPPHQWRQWKLVDSSOLFDWLRQPD\ILOH 3XUFKDVHU VVROHUHPHG\LQODZRUHTXLW\VKDOOEH WKHERUURZHUILOHGEDQNUXSWF\HQWHUHGLQWRDQ\ KLVRUKHUFRPPHQWVLQZULWLQJZLWKWKHUHJLRQDO OLPLWHGWRWKHUHIXQGRIWKHGHSRVLWWRWKH3XUFKDVHU UHSD\PHQWIRUEHDUDQFHDJUHHPHQWUHLQVWDWHGRU 7KH VDOH LV VXEMHFW WR SRVW VDOH DXGLW E\ WKH SDLGRIISULRUWRWKHVDOH,QDQ\VXFKHYHQWWKH GLUHFWRU RI WKH )HGHUDO 'HSRVLW ,QVXUDQFH QRWHKROGHUWRGHWHUPLQHZKHWKHUWKHERUURZHUILOHG 3XUFKDVHUDJUHHVWKDWXSRQQRWLILFDWLRQE\WKH &RUSRUDWLRQDWWKH$WODQWD5HJLRQDO2IILFH$WWQ EDQNUXSWF\ HQWHUHG LQWR DQ\ UHSD\PHQW 6XEVWLWXWH7UXVWHHVRIVXFKHYHQWWKHVDOHLVQXOODQG $WODQWD5HJLRQDO'LUHFWRUWK6WUHHW1(6XLWH IRUEHDUDQFHDJUHHPHQWUHLQVWDWHGRUSDLGRIISULRU YRLGDQGRIQROHJDOHIIHFWDQGWKHGHSRVLWUHWXUQHG $WODQWD*$QRWODWHUWKDQILIWHHQ WRWKHVDOH,QDQ\VXFKHYHQWWKH3XUFKDVHUDJUHHV ZLWKRXWLQWHUHVW GD\V IURP WKH GDWH RI WKLV SXEOLFDWLRQ 7KH WKDWXSRQQRWLILFDWLRQE\WKH6XEVWLWXWH7UXVWHHVRI QRQFRQILGHQWLDOSRUWLRQVRIWKHDSSOLFDWLRQDUHRQ VXFKHYHQWWKHVDOHLVQXOODQGYRLGDQGRIQROHJDO 7KRPDV - .RNROLV &UDLJ $ 3DUNHU 6XEVWLWXWH ILOH DW WKH DSSURSULDWH )',& RIILFHV DQG DUH HIIHFWDQGWKHGHSRVLWUHWXUQHGZLWKRXWLQWHUHVW 7UXVWHHV DYDLODEOHIRUSXEOLFLQVSHFWLRQGXULQJUHJXODU 0DWWHU EXVLQHVV KRXUV 3KRWRFRSLHV RI WKH :DVKLQJWRQ7LPHV'HF-DQ-DQ-DQ QRQFRQILGHQWLDOSRUWLRQRIWKHDSSOLFDWLRQILOHZLOO /DXUD+*2 6XOOLYDQHWDO6XEVWLWXWH7UXVWHHV EHPDGHDYDLODEOHXSRQUHTXHVW :DVKLQJWRQ7LPHV'HF-DQ-DQ-DQ 3DU 6HULDO $' PFF 6HULDO $' SIGN UP FOR OUR NEWSLETTER 5XQ'DWH-DQXDU\WK washingtontimes.com/careers $' Facebook.com/TheWashingtonTimes Breaking news delivered to your inbox B8 | FUN & GAMES (Tl)c lUaol)iiif|tu)i (Times ☆ R WEDNESDAY, JANUARY 20, 2021
JANRIC CLASSIC SUDOKU NEWSDAY CROSSWORD www.stanxwords.com Rating: Gold Alphabetical Enders By S.N., Edited by Stanley Newman Fill in the blank cells using numbers 1 to 9. Each number ACROSS 63 Region 10 Court reporter, 32 Stand up can appear only once in each row, column and 3x3 block. 1 Remainder 64 Bursts, as for short 33 Coffee order i 8 5 Smart-alecky balloons 11 Take heed of 36 Be worried about Use logic and the process of elimination to solve the tO Unexpected 65 Looks to be 12 Eden resident 38 Miles away puzzle. The difficulty level ranges from Bronze (easiest) to obstacle 66 Try out 13 Elapse 42 Smart one Silver to Gold (hardest). 14 Brainstorm 18 Still asleep 44 Cause of ruin 15 Loosen, as DOWN 19 One end of a pin 45 Campfire one’s laces 1 Kelly of 23 Radiators, for remnants 9 © 2018 by Janric Enterprises. Dist. by Creators Syndicate, Inc. 16 Phrase on a morning TV example 46 Produces, as chore list 2 Modily, as prose 24 Nation on the pennies ANSWERS TO PREVIOUS PUZZLES: 17 Paying for 3 Religious Adriatic 48 Breaking-off everyone's meal offshoot 25 Unpleasant, sound 6 1 4 9 7 5 3 8 2 20 Go to an event 4 Confiscate informally 49 Equestrian sport 3 8 9 2 I 6 7 4 5 21 Foe 5 Time for a large 26 One-for-one 50 Perched upon 22 Shout from crossword deal 52 Bearded 5 7 2 8 4 3 ] _9__6_ Scrooge 6 With 59 Down, 27 Real estate barnyard beast 8 2 6 4 5 ] 9 7 24 Italian farewell director from listings 53 Remedy 26 S&L'S Taiwan 28 Attractions in 54 Very long time 4 3 5 7 9 2 6 1 8 medium-term 7 Nickname Athens 55 The thing there _6__3__8__2__5_ nSHHH often ng that's three 29 Remnants 57 Tummy muscles 1 JL 31 Furious consecutive 30 Middle traffic 58 Sandwich bread 8 1 .•• 1 ft i / 34 1 a holes of golf letters light 59 See 6 Down 9 1 7 4 2 35 Run _ (go Wild) 8 Taste, as of tea 31 Breakfast syrup 60 Thanksgiving 6 5 S 36 Charge fora 9 Up to now flavor veggie 7 4 8 3 2 9 5 6 cab ride 37 Part of a t 3 a 5 6 7 a 11 12 13 group of 4 - 14 JUMBLE/David L. Hoyt & Jeff Knurek RUBES/Leigh Rubin IN THE BLEACHERS/Steve Moore 38 No longer a 16 Unscramble ihese JiamWes. ” one teller to each square, threat 17 ia 19 to form tour ordinary woftfs. 39 Grand-scale TISEU story 20 40 Family rooms ” r T ^ 22 ,, 25 \j 41 What stuffs 24 socks M 2 6 27 23 29 30 »32 33 PUCEO 42 Model airplane w wood 34 35 36 43 One of three ■ ■ 37 36 39 SRBABO in 5 Across 44 "Great" ■ 40 A___L Australian coral 41 attraction 43 44 45 RYPITU 46 The Red Planet 47 Physicians' org. ■ '¡6 47 cm Now arrange ihe -arcled totters _ r-202i TltouiWConiPni Agency.to ULCform the suipmse answer, as 48 Iberian nation ■ 48 49 so Kil 52 53 54 55 AH fftghü Rffwrwd sui^gesíed by tne above cartoon. 51 Lion or leopard sp ^ ~>y ’ y - 56 Well short of ■ 56 57 56 59 60 what's needed 61 Very much 81 62 63 62 How improvisers ■ ■ 64 65 66 YesJwüay' “play it" CBEATOfiS SYNDICATE* 5*51 STJUJLEY MEWWiH STMKWQRDSCAOLCCM 1/20/21 B.C./Mastroianni & Hart LOLA/Todd Clark
BOUND & GAGGED/Dana Summers BUCKLES/David Gilbert
THE BUCKETS/Greg Cravens ROSE IS ROSE/Pat Brady & Don Wimmer
DOGS OF C-KENNEL/Mick & Mason Mastroianni HERB & JAMAAL/Stephen Bentley
CARPE DIEM/Niklas Eriksson BROOM-HILDA/Russell Myers
USTtM KIVDO, TW£ LAW S4YS YOU IWt 70 Kit? AT LiAZT SIXTY PtffcfiA/T of youg eyes. Ofj ?mt WAV.
DICK TRACY/Joe Staton & Mike Curtis POOCH CAFE/Paul Gilligan THOSE PMetv: ■ HARP IW HERei ^ yw NSW IMHSKS . ffcl THg HgC<
STRANGE BREW/John Deering BOTTOM LINERS/Eric & Bill Teitelbaum THE FLYING McCOYS/Glenn & Gary McCoy PARDON MY PLANET/Vic Lee BLISS/Harry Bliss
Í
THE EXPRESSION HAPPY AS A CLAM 15 EASED QW HIM. WEDNESDAY, JANUARY 20, 2021 ☆ R SPORTS | B9 How low can they go? Dipping scores show evolution of golf
BY DOUG FERGUSON 20 under with 12 holes remain- players who are bigger, stronger
ASSOCIATED PRESS ing in 2017, played it safe and and faster, and equipped with shot 17-under 267 to win by fi ve. better training, more knowledge HONOLULU | Chris Kirk shot Right behind is Bay Hill, the and video, perhaps the most un- 65 four days in a row and it course where Tiger Woods has derrated piece of technology. wasn’t enough to win on the won a record eight times. He Matt Kuchar spoke to this PGA Tour. still hasn’t had a week like the a year few years ago when Joaquin Niemann can appre- late Payne Stewart did in 1987 he said, “It is what we should ciate the feeling. The dynamic when he shot 264. No one has expect.” 22-year-old from Chile played come within fi ve shots of Stew- “Guys in any sport, any both tournaments ASSOCIATED PRESS art’s record. activity, have fi gured out how On golf in Hawaii and was Kevin Na shot a 5-under 65 in the fi nal round to win the Sony Open in Honolulu by one stroke over Chris Kirk. Tom Lehman shot 268 at to get better with all the extra a combined 45- Muirfi eld Village to win the work and study and whatever under par. Memorial in 1994. Greg Nor- else,” Kuchar said. “We see He lost in a playoff at Ka- He won by one shot in 2017 the winning score was 10 shots All of them probably deserve man, Woods and Patrick it everywhere, whether it’s palua and fi nished one shot over Adam Hadwin, a day after higher. an asterisk because golf courses Cantlay all have come within a the track or the pool, the golf behind in the Sony Open. Hadwin shot 59. There was only a tropical only look the same. They have stroke of that record. course, hoops.” For those who are either put None of this should be cause breeze, not the notorious trade become longer by various mea- And yes, Woods still has a Why should golf be any off or put to sleep by low scor- for alarm. Some of it has to do wind, at Kapalua the previous sures. Lawn mowers are better, few scoring records to claim. diff erent? ing on the PGA Tour, relief is with the weather. week for the Sentry Tourna- too. Nothing is ever exactly how One of them is at East Lake, The best players will fi nd a probably not on the way. The day after Kevin Na won ment of Champions. Harris it was. where he shot 23-under 257 in way because they always have. Next up is The American the Sony Open by one shot over English and Niemann fi nished The oldest 72-hole record 2007. Not even Johnson with a Rory McIlroy once said the Express in the California desert, Kirk and Niemann, the wind at 25-under par, and seven on PGA Tour courses remains 10-shot head start in the new game is changing but not nec- a tournament still known as the blew so hard it felt as though others fi nished at 20 under or at Riviera in 1985, when Lanny FedEx Cup scoring system essarily for the worse. Every Bob Hope in some circles and the island of Oahu might get better. Wadkins shot 20-under 264 on could top that. generation gets better with defi ned by low scoring under blown across the ocean. For the Golf has been that way for a soggy course in Los Angeles. Those records surely will more knowledge and science any name. tournament week, there was more than a century. Wadkins is proud of that mark, fall in time. That’s how golf has — and yes, technology — at its Since going to 72 holes in barely enough wind to move a Instead of worrying how low and he surely is happy Dustin evolved, much like other sports. disposal. 2012, the highest winning score palm frond. the scores are getting, perhaps Johnson wasn’t aware of the re- Sprinters have better shoes. “So if we’re not better,” he was 20-under 268 by Hudson A year ago, with 30 mph it’s worth celebrating which re- cord — nor did he particularly Swimmers have better suits. concluded, “then we’re doing a Swaff ord. gusts every round until Sunday, cords have stood the longest. care — when Johnson reached That doesn’t even account for pretty bad job.”
NFL executive time to explore Tennessee’s Ryan Cowden, the manager in 2018, but was unable HURNEY other opportunities. Chargers’ JoJo Wooden, Atlanta’s to put together a winning roster. From page B10 Rivera added fuel to the spec- Nick Polk and an internal candi- Hurney, critics say, has a ulation when he praised Hurney date in Stokes. Kyle Smith, the spotty record with late-round who led with six starts, turns 37 after the executive was let go. team’s vice president of player draft picks and has faced criti- in May. “I really appreciated working personnel, was not believed to cism for his handling of the sal- Washington offi cially began with him,” Rivera said. “He’s a in the running for the position. ary cap. interviewing candidates for the very hard worker and a very Hurney’s pending hire could Still, Rivera trusts Hurney, job last week, but rumblings that bright man. He knows the game. be met with some skepticism. who hired the coach in 2011. Ri- Hurney could land with the team If you look at what he helped us After all, Hurney struggled to vera has said he wants Washing- started weeks before. build in Carolina when he helped sustain success in Carolina — ton’s front offi ce to be collabora- The Panthers fi red Hurney us build our run, it’s pretty im- making the playoff s in just three tive — modeling it after places in December after four seasons pressive. He pretty much put a of his fi rst 11 seasons at the helm. like Seattle and Kansas City, at the helm, and Carolina owner lot of pieces into place.” ASSOCIATED PRESS He rejoined the Panthers on an contenders that have a general David Tepper said the move was Rivera also interviewed San General manager Marty Hurney (right) spent parts of fi ve seasons with interim basis in 2017 and then was manager but whose coach retains done in part to give the veteran Francisco’s Martin Mayhew, Washington coach Ron Rivera in Carolina, having been fi red twice. promoted to full-time general fi nal say. Now, Rivera has his man.
showed that he discounted what- nine innings and his 6.2 strikeouts to give. His inconsistency infl ated to 1.38, and Corbin — who, at 31, is contact on his best pitches. Ac- NATIONALS ever happened in the coronavi- per nine was also a career-low his statistics. In 43 games in 2019 the youngest of the group — saw cording to FanGraphs, 47% of From page B10 rus-altered 2020 season. With mark. and 2020, he allowed one run or his fastball drop almost 2 mph in the balls in play last season off just 60 games and a pandemic to But Lester’s 2019 production fewer 16 times. The southpaw velocity. Lester were ground balls, and a The unknown is signifi cant, navigate, the drop in production wasn’t much better. He still won gave up fi ve runs or more another In other words, there’s fl uc- career-low 16.8% were line drives. though. He’s a fi ve-time All-Star from Schwarber and Bell was fi g- 13 games and pitched 171.2 in- 14 times. tuation season-to-season for the Lester is no longer the pitcher — the most recent selection com- ured to be an outlier rather than nings, although he allowed a Lester won’t be the only best of arms. Over Lester’s career, who led the Red Sox to two World ing in 2018 — who hasn’t played what to expect going forward. league-high 205 hits. His WHIP pitcher on the staff looking for a he’s managed to redefi ne himself Series championships in 2007 or at that level consistently of late. That might be in play for Les- rose to 1.50 and his 4.46 ERA was bounce back year. time and again, altering the way 2013, or the hurler who helped end When Rizzo signed Lester’s ter, too, who appeared 12 times his highest since 2012. Strasburg pitched just five he works to fi nd outs. Chicago’s title drought in 2016. former teammate Kyle Schwarber last year. His 5.14 ERA was the Looking more closely at those innings in 2020 before season- He may have to do so again, But he doesn’t need to be, to play left field and traded worst of his career, he allowed two seasons, though, there are ending carpal tunnel surgery. perhaps building off a 2020 sea- either. Not as the fourth fi ddle for fi rst baseman Josh Bell, he a career-high 1.6 home runs per signs Lester still has something Scherzer saw his WHIP increase son in which he forced weak in a band full of Stradivariuses.
AFC From page B10 Brees broke 11 ribs in 2020 5, turned and quickly threw it following a TD run by former NFL and missed four games, so it’s away as Tremaine Edmunds Chiefs running back Kareem Though Allen led the way From page B10 easy to say he should have re- had him by the legs and Trent Hunt, Henne was intercepted with a three-touchdown outing in tired a year ago. Murphy fell on top of him. in the end zone by Karl Joseph a playoff -opening 27-24 win over Bills and Josh Allen, who has “No complaints. No re- Jackson’s concussion left with eight minutes remaining. Indianapolis, the defense was the completed 68.1% of his playoff grets,” said Brees, who tossed Huntley, who had been pro- The Chiefs forced a punt star in a 17-3 win over Baltimore passes after completing 69.2% the football around with his moted from the practice squad, and Henne got the ball back on Saturday. of his throws in his breakout kids and Brady long after the to fi nish the game and he com- with just over four minutes Aside from holding the Ra- 2020 regular season. game ended. pleted 6 of 13 passes for 60 left. Cleveland couldn’t stop vens to their lowest scoring out- “There are obviously so yards, not nearly enough for a Henne from scrambling for 13 put in 12 years, including playoff s, Winston winging it many incredible memories, so comeback. yards on third-and-14 or from the Bills sealed the victory on Winston’s long touchdown many incredible relationships “We’ll hold our head high completing a short pass on cornerback Taron Johnson’s NFL throw was his only pass, leav- that have come as a result of walking out of here and into the fourth-and-inches to Tyreek playoff -record matching 101-yard ing him with a perfect passer playing in this game, and you ASSOCIATED PRESS off season,” Ravens coach John Hill with 74 seconds left to seal interception return in the fi nal rating of 158.3. His TD gave the found out so much about your- Ravens backup Tyler Huntley Harbaugh said. the Chiefs’ 10th win this season minute of the third quarter. Saints a 13-10 lead over the Bucs self, and you fi ght through so was 6 of 13 for 60 yards and a by six points or less. Most important, the Ravens’ in the second quarter. But he much when you play this game,” quarterback rating of 59.8 in Henne’s heroics The Browns’ biggest regret dynamic QB Lamar Jackson was didn’t get another snap in New Brees said. Sunday’s 17-3 loss to the Bills. Henne played a major role was wide receiver Rashard Hig- held in check, going 14 of 24 for Orleans’ 30-20 loss that many “And I would say this season in Kansas City squeaking past gins’ fumble near the goal line 162 yards with just 34 yards rush- believe was Drew Brees’ fi nal I probably had to fi ght through Cleveland to earn a third con- in the closing minutes of the ing before being knocked out of game after 20 NFL seasons in more than I’ve ever had to in any Johnson tied an NFL record secutive AFC championship fi rst half. Higgins hauled in a the game with a concussion on which he threw for 85,724 yards, other season in my career, from with a 101-yard interception game at home. pass from Baker Mayfi eld while the fi nal play of the third quarter. including the playoff s. injury to all the COVID stuff to return for a touchdown that The 35-year-old veteran of stumbling near the Chiefs’ The outing continued a trend: That’s more than 16 miles just crazy circumstances, and it gave the Bills a 17-3 lead. 11 NFL seasons in Miami, Jack- 5-yard line and launched him- Buff alo’s defense peaking over the worth of completions. was worth every moment of it. Facing second-and-10 at sonville and K.C. completed the self toward the pylon. fi nal stretch of the season. After If this was it, Brees went Absolutely.” Baltimore’s 25, center Patrick Chiefs’ fi eld goal drive after Ma- Just as Higgins extended his allowing 273 points through a out with a whimper: 134 yards Mekari snapped the ball over homes was thrown down hard arms, he was blasted by Chiefs 32-30 loss at Arizona in Week 10, passing and three interceptions Practice squad jump Jackson’s head. The quarter- by Browns linebacker Mack linebacker Daniels Sorenson, Buff alo has given up just 137 over in the worst playoff game of Jackson was forced out of back turned and chased the Wilson. But with Kansas City who sent the ball bouncing out the past eight games. Johnson’s his career. the game two plays after Taron bouncing ball down inside the clinging to a fi ve-point lead of the end zone for a touchback. touchdown was the fi fth scored on a return in Buff alo’s past six games. The Bills’ defense might have seasons, but it remains a prideful playoff game on Saturday. That chances of containing Jackson said Hughes, who sacked Jackson going to give up 30 points ... I fi nished 14th in the NFL in yards unit. way, he got an opportunity to and the Ravens’ NFL-best run- twice. “When we see the guys on think we went out there and we allowed, after ranking among Defensive end Jerry Hughes spend the early afternoon hearing ning attack. TV talking about how they don’t played like we had something to the top three the previous two was thankful Buff alo had the late TV analysts dismiss Buff alo’s “We took it as a challenge,” play defense in Buff alo, we’re prove.”
MAJOR LEAGUE BASEBALL had a career record of 324-256 GOLF He also will miss the Gen- Hurricanes players were added depth chart. Hall of Fame pitcher and an ERA of 3.26 while pitch- Fift h back surgery has esis Invitational on Feb. 18-21, to the COVID-19 list Tuesday. The 31-year-old Ingram was ing for the Dodgers, Houston where he serves as host. The NHL already postponed on the inactive list for four of Sutton dies at 75 Astros, Milwaukee Brewers, Woods on Tour sidelines the start of the Dallas Stars’ Baltimore’s last fi ve games, Don Sutton, a Hall of Fame Oakland Athletics and Califor- Tiger Woods has suff ered a season after six players and two including playoff matchups pitcher who was a stalwart nia Angels before beginning a setback with his back, disclos- NHL staff members tested positive. against Tennessee and Buff alo. of the Los Angeles Dodgers’ second career as a broadcaster. ing Tuesday that he recently Carolina-Nashville nixed He fi nished with 299 yards on a rotation spanning an era from Sutton’s passing comes on had a fi fth surgery that will career-low 72 carries. Sandy Koufax the heels of seven Hall of Fam- keep him from starting the aft er positive virus tests NFL He lost playing time after to Fernando ers dying in 2020, the most sit- year until after the West Coast The NHL postponed its fi rst Ravens release veteran spraining his ankle in a 30-28 SPORTS Valenzuela, ting members of Cooperstown Swing on the PGA Tour. game since the league’s season win at Philadelphia on Oct. 18. BRIEFS died Tuesday. to pass away in a calendar year. Woods will not play next began, calling off Tuesday running back Ingram From wire dispatches and staff reports. He was 75. They were Lou Brock, Whitey week in the Farmers Insurance night’s game between the Hur- Three-time Pro Bowl run- The Hall of Ford, Bob Gibson, Al Kaline, Joe Open at Torrey Pines, which ricanes and the Predators hours ning back Mark Ingram has PRO CALENDAR Fame in Cooperstown said Sut- Morgan, Phil Niekro and Tom he has won seven times, most after Carolina won the fi rst of a been released by the Baltimore HOME GAMES SHADED Wednesday Th ursday Friday ton died at his home in Rancho Seaver. recently in 2013. He also won two-game set in Nashville. Ravens, who used the 10-year Buff alo Mirage, California, after a long Sutton is survived by his son, the U.S. Open in 2008 at Tor- The NHL did not specify veteran as a starter for the fi rst Sabres 7 p.m. struggle with cancer. Daron, wife Mary and daugh- rey Pines, which hosts the U.S. which team prompted the seven games this season before NBC-W+ A four-time All-Star, Sutton ters Staci and Jacquie. Open again in June. postponement, though four dropping him deep on the FM 106.7 ON WASHINGTONTIMES.COM Follow us on Twitter @WashTimesSports and on Facebook at Washington Times Sports PPORTSORTS ■ Comics B8 SWEDNESDAY, JANUARY 20, 2021 ☆ washingtontimes.com/sports SECTION B
NFL Ex-Carolina exec Hurney set to join Washington as GM
BY MATTHEW PARAS across two stints with the Caro- former Redskins execu- previous coaching staff s, Thomas Davis. The Fan that the general manager
THE WASHINGTON TIMES lina Panthers. Hurney held the tive Bobby Beathard, brought in trainer Ryan Washington’s general man- position is “more than meets the same title with Carolina from who hired him as an Vermillion and re- ager position has been vacant eye” and said it required a lot of Washington coach Ron Rivera 2002 to 2012 and later from 2017 assistant general man- shuffl ed Washington’s since 2017 when the team fi red “operational stuff .” interviewed at least six-candi- to 2020. He is largely credited for ager in 1990 with the front offi ce with hires Scot McCloughan. Rivera opted This coming off season also dates for the team’s general man- helping build rosters that reached San Diego Chargers. like Rob Rogers and against fi lling the spot last off sea- fi gures to be vitally important for ager vacancy. But when it came two Super Bowls, once in 2004 But it was Hurney’s Hurney Eric Stokes — both of son, opting to promote 36-year- the franchise. After a surprising down to picking someone to help and another in 2015. connection to Rivera whom worked with old Kyle Smith to an elevated 7-9 season in which Washington him guide the franchise through The move also marks a home- — along with his years Rivera in Carolina. personnel role. Under Rivera, made the playoff s, the team will what will likely be critical off sea- coming for the 65-year-old Hur- of experience — that ultimately Hurney has built a reputa- owner Dan Snyder said Wash- look to build on its success and son, Rivera opted for familiarity. ney, a Maryland native who was landed him the job. tion as an executive with a keen ington would adopt a “coach- must fi nd a long-term answer Washington is expected to a sportswriter for The Washing- Since Rivera arrived in Wash- eye for top-end talent. From centric” approach, meaning Ri- at quarterback. The team used hire Marty Hurney as its next ton Times before becoming a ington last year, the 59-year-old 2002 to 2012, eight of Hurney’s vera is believed to have the fi nal four diff erent signal-callers last general manager — reuniting public relations assistant for the coach has leaned heavily on 10 fi rst-round picks became Pro say under most football matters. season, and veteran Alex Smith, Hurney with Rivera after the two Washington Redskins in the late his Carolina connections. Last Bowlers, including Cam Newton, Rivera, though, at times has worked together for fi ve years 1980s. He worked closely with year, he hired 12 members of his Luke Kuechly, Julius Peppers and been stretched thin. He told 106.7 » see HURNEY | B9
NATIONALS
Lester, if AFC CHAMPIONSHIP | BILLS AT CHIEFS | 6:40 P.M. SUNDAY, CBS he’s back, fi xes hole in rotation Lessons Former All-Star seen as add to Big Three
BY ANDY KOSTKA learned THE WASHINGTON TIMES Week 6 loss to Chiefs was In the best-case scenario, the Washington Nationals’ tentative turning point for Allen, Bills one-year deal with left-hander Jon Lester could solve several problems. Pending a physical, the Nation- als have added a three-time World Series champion who always seems to pitch his best in the biggest mo- ments. The deal reunites Lester with Dave Martinez and Jim Hickey, his former bench coach and pitch- ing coach, respectively, from his time with the Chi- Jon Lester’s cago Cubs. career numbers And Lester Seasons...... 15 Innings.....2,598⅔ potentially Wins...... 193 fills a hole Losses...... 111 in the team’s Strikeouts....2,397 starting ro- Hits...... 2,451 Runs...... 1,131 tation that Home runs.....269 is the key to ERA...... 3.60 any hopes of making an October push. But the sign- BY JOHN WAWROW defending Super Bowl champion to get corrected?”’ selling out to stop Mahomes or
ing of ASSOCIATED PRESS Chiefs (15-2) in the AFC champion- Buff alo’s off ense fi nished with Edwards-Helaire. Lester ship game on Sunday. a season-low 206 yards, with He might have to make the same comes with uarterback Josh Allen The outcome three months ago Allen managing 122 yards passing choice this weekend with the run- an element spent the regular season left Bills coach Sean McDermott — the third-year player’s second- ning back expected to return after of uncer- leading the Bills to a taking a sobering approach to cor- lowest total in a game he starts and missing three games with an ankle tainty: He’s Qfranchise-record matching recting what went wrong. fi nishes. injury. Mahomes’ status, however, a 37-year-old 13 wins and their fi rst AFC East “Two good opponents, I know. As for the defense, Buff alo suc- remains uncertain after he sustained coming off title in 25 years. Buffalo’s defense But the minute losing gets easy, cessfully limited Patrick Mahomes a concussion in a 22-17 win over the two seasons has done its part the past two that’s not a good deal,” McDermott to 225 yards passing, his third- Browns on Sunday. in which he underperformed. His weeks in getting the team to its fi rst said following the loss, which came lowest total of the season, and two If there is a bright side, the Bills velocity dipped and his ERA in- conference championship game ap- on the heels of a 42-16 defeat at touchdowns. The Bills were instead have grown progressively better, fl ated. His WHIP rose, as did the pearance since 1994. Tennessee. trampled by rookie Clyde Edwards- particularly on defense, in having percentage of balls in play off Lester Both units will need to be much “We take it hard. There’s no Helaire, who fi nished with a season- won 11 of 12 since the loss and eight classifi ed as hard hits. sharper than in a 26-17 loss to Kan- moral victories,” he added. “We’ve best 161 yards rushing. straight to match the team’s longest The Nationals entered the off - sas City in Week 6 if the second- got to really take a good look at our McDermott defended his team’s run since 1990. season in need of another arm seeded Bills (15-3) stand a chance football team and be truthful with defensive approach by calling it a to add to the Big Three — Max of upending the top-seeded and ourselves and say, ‘What do we have “pick your poison” choice between » see AFC | B9 Scherzer, Stephen Strasburg and Patrick Corbin — the stars at the top of the rotation. The seem- ingly never-ending competition between Erick Fedde, Austin Voth and Joe Ross for the fi fth starting place continues into 2021. Washington allowed Anibal It takes two: Backups step up as playoff s take toll on QBs Sanchez to depart in free agency after two years fi lling the fourth- BY ARNIE STAPLETON midway through the third quarter quarterbacks took all the snaps
starter role, so general manager ASSOCIATED PRESS against Cleveland. was the Packers’ 32-18 win over Mike Rizzo needed to make a In his 72nd NFL game, Henne the Rams, when MVP favorite move. And in many ways, bring- Backup quarterbacks did more atoned for an end zone intercep- Aaron Rodgers threw for 296 ing in Lester — whose option than just hold clipboards in the tion with two huge plays to allow yards and two touchdowns and with the Cubs was declined — is NFL’s divisional playoff round. the Chiefs to escape with a 22-17 Jared Goff was an effi cient 21 of 27 the sort of move Rizzo loves. Jameis Winston threw a 56- win over the Browns. a week after he was pressed into Lester is a veteran with a his- yard trick-play touchdown pass A day earlier, another ex-MVP, duty just 12 days postsurgery on tory of success. He reportedly is to Tre’Quan Smith on his fi rst Lamar Jackson, was knocked out his broken right thumb. signing an aff ordable $5 million playoff action after 76 regular- of Baltimore’s 17-3 loss at Buff alo Rodgers and Tom Brady, mak- deal. He won’t need to be an season games over six seasons. and was replaced by Tyler Hunt- ing his 14th conference champi- ace like he’s been throughout Chad Henne, the Chiefs’ ley, an undrafted rookie from onship appearance in 21 seasons, his career, but he’s displayed the ASSOCIATED PRESS 35-year-old backup, also got his Utah who ascended to QB2 status square off next week at Lambeau required durability to still soak up Th e Chiefs lost Patrick Mahomes (left ) to a concussion and fi rst taste of the playoff s Sun- last month when Robert Griffi n Field. Mahomes will have to clear innings. That’s the known. were in danger of losing the AFC divisional game Sunday day when he was pressed into III (hamstring) and Trace Mc- concussion protocol to face the against the Browns until 35-year-old backup quarterback Chad duty after former MVP Patrick Sorely (knee) ended up on IR. » see NATIONALS | B9 Henne stepped in and kept their Super Bowl hopes alive. Mahomes suff ered a concussion The only game that both » see NFL | B9