Product datasheet Anti-ANGPTL4 Antibody Catalog Number: A01147
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Basic Information Product Name Anti-ANGPTL4 Antibody Gene Name ANGPTL4 Source Rabbit IgG Species Reactivity human Tested Application WB,ELISA Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids. Purification Immunogen affinity purified. Observed MW 45KD Dilution Ratios Western blot: 1:500-2000 ELISA: 1:100-1000
Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing
Background Information Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.
Reference
Anti-ANGPTL4 Antibody被引用在0文献中。
暂无引用
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-ANGPTL4 Antibody Catalog Number: A01147
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Selected Validation Data
Figure 1. Western blot analysis of ANGPTL4 using anti-ANGPTL4 antibody (A01147). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. lane 1: recombinant human ANGPTL4 protein 1ng anti-ANGPTL4 antigen affinity purified polyclonal antibody (Catalog # A01147)probed with a goat anti-rabbit IgG-HRP secondary antibody The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) . A specific band was detected for ANGPTL4 at approximately 55KD. The expected band size for ANGPTL4 is at 44KD.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2
Powered by TCPDF (www.tcpdf.org)