Pride Weekend will AIDSWUk '9» LOCAL AND STATE feature many events NOW summit to Patade is Jufy 18, GAGV PicnieJuf y 19 seek new visions By Susan Jordan » last year, with dancing In the The National Organization for thb y«ar is July {5-19, Roundhouse pavilion. Tkkets are Women (NOW) will hold its na­ with the PHde March artd Festival $5 and $13 In advance, and $8 and aonai conference here July 10- on Saturday, juty 18 and the Gay $16 at th«^ gate. The higher prked 12, at the Four Points Sheraton Aiiiance Picnic on Sunday. July 19, tickets include beverages. Tickets Riverside Hotel. are availaMe at aN artt bars, the but related events, ranginf from a The local NOW chapter says, Pride Connection, Rochester Cus* golf tournament to speciaJ events "This natfonal NOW conference torn Leather, SIke of Life Cafe, for gayftunHies, ar e scheduled from wiil be... different from all other Parkleigh and the Rochester Spa July 15 on. NOW conferences. Bring your and Body Club. Pknk fare will be The will start at the friends, your daughters, your sold by Susan Plunkett Catering, Liberty Pole at 6 p.m.. and will AlOS Rochester's 1998 AlOS Walk raised $141.000 on June 7, Yt^ mothers, your sisters, your neigh­ Lorraine's Lunch Basket. SIke of proceed down East Ave. to 1,300 walkers takir^ part in the annual fundraiser for local AIDS bors, your co-workers.** Life and Scoop's ke Cream. The Goodnuui, enops and sldll- tan Church ~ a i^-themed ver­ Forum (GRGLBF) said, "The Pa­ building sessfons. in the evening* sion of miniature golf and a chttd- rade marshals this year wiH be the an evening plenary and opening oriented "fihsitpond" concession past presidents ofthe Gay AHiance ceremony are planned. where children can fish for prizes. of the Genesee Valley, in celebra­ July 11 begins with viSN>n work­ Numerous community groups wiil tion of thc GAGVs 25th anniver­ siiops. starting at 9 a.m. with a have information tables. sary." moming plenary. Caucus meet­ Carol said that there WiH be prizes The Picnk Is the Gay Attianc»*s ings will take place during for the ftoaa, and that people who major and cruciai fundraiser ofthe roundtable lunettes. During die are not af^liated v^rkh any particular year, and repraaents an oppoir^ aftemoon there wHI be keynote group can march behind "gay com- nity to meet afMipurty MMI dic^ speeciies, and in the evening, a munit/* banners. Vendors wiii be sands of other gBy»>MMet^toiaiincuaf talent siK>w and dance with en­ upstairs at Village Gate, and may set and tertainment will run from 9:30 up early and be there all day if they from the Picnic p.m. to midni^t. wish. The bars and musk wlH be and its pro0*ams foncdoninff to The final day of die conference inside also, but thc newty-remod- serve the communiiy all yaar long. consists of a vision plenary from eled courtyard probab^ wfil be the GAGV Community Center Dl* 9 a.m. to noon. In the aftemoon fbcus of a huge par^. Bke laat year. rector Tanya SmoKnsky saki that a Vision Statement wttl be com­ volunteers ara needed in mawy ca- pleted, representing a new **Oec- padtias, from aet-up to daaiMip. they are snflilooldnf IDT vDliinew^i6V at 244- uncecr, orin neadoTmori MDT- A Women^s Rights Tour wiH matfion* can ceV ttw GKQLBF Info follow the ctMifarcnca on July 13, line at 234-8>06. On Wedn4«day^ % ^ Ald^ 14 and iS. Bussas wM depart Gay BH^ N^ w« «ate|d«ia il: The GAGV Pknk wtfl take place trwn die 9iaratton>-Four Points onjuly 19 between I and6p*m.at Hotel on Main Sc and wiN v<:dt Genesee Vaiiey Piu^ the same site PrWa condnuarf on !»• 3 such Jdseork sitas as the Susan B. Anthony Housa in Rodtettar, the Btabadi Ca^ Stanton House in TeaniRochester headjs fof Aiipteidam Gay Games Sanaea FaHs. and die HarHac '•'.'•ji^'^ IS^J:^*, Tubman Housa ki Auburn. The By Suaan lardan w^^^jt^j^^^^^ t^ M ^^t.l^iiM III „ JMIL .ppppiaa m newfonong viffin tour wfll indude a NOW raHy Twelve mamheraofTeam RocNee- bowHof. tnd orli'till^ fiOTlber lHl^4^liiHUHfl^ ^^^a^rf% tf^a4lllkaaAv^h ^riferf^aw ruuiiiliiiii TiiiH YVMifaft, n Oil iNrtdi cwt«nr pr«sidene Pnrlda terwff behaadtatiorAmstardttn each in the followirtg spores: cy- which iai4PfafW| "Tom U'aiiiiiig, ebas daotthlaem was abo a phya^ kaiandki Seneca F^Ns cm July 14, byjuly Jt fartheopaiiiiiccArafM- cBni^ tannis, karaee. maradioaand vHMch yoii can ^ doM. Orianiiiilg Rttlit ifMMta JkirA^- fef igUf wHi

mm E ,_RjJI;:».T^:3C^:: C L O S 1^ y A3 i jaAwfafriiTtmrtthmMiiTTii lAJB. ^rtdi ccNvthfUMd from p* I tf»School of the Am» with a Gay PHde Barbra Kavanaugh tETTERS TO THE EDITOR: , tfiMM^ Oodrs open att 6 p.m. at 45 Prince X"'^ -^VJ^"*., THcoptntom of columnists, edlibrlaiwrt^c- ^ drops out of race for -rn\it . «rs and otli«r contributlra writers i«e / S£ Oi^Jufy 16. the GAGV wHl host an open their wm and do not necessaHly rdlea' hotne st che Communis Center, 179 At­ Lt«G€i¥emor dw cdlMttw attitud* of tikv G^fAitence lantic Ave.^ starting at 7 p.m. Perspectivei oTthe Genesee V^tHey or the finpty Ooset. Bert^ Ksvahamth, the openfy lesbian mem­ We wM pHnt iettein at the edttor^i dfetoe- There will be a community party on ber of Buf&fo City CouncU who attempted ^on and on a space svaHrtAe batis.We WiH Tlw Friday. Jufy 17. ''Break a Sweat for Pride'* to win epiace on the Democratic prinury viewpoints that matter not print personal attadcs on mdMdinlc wM take place at Muthers, beginning at 10 baHot, hts withdrawn from the race. *! t '^>* p.m. The dance party is sponsored by the ICavanaMgh, who tried for ti>e lieutenant -^ Empire $tate PHde Agenda, the GAGV. and n^ .J - govemor slot, said that when she realized COAP (Come Out And Play), and admis- that she did not have enough votes, she • LOCALAND STATE NEWS sk>o te $3at the door, to benefit the GAGV. deckied that she could either travd the state ^rQirt\ Oor Hiiiders Saturday, Jufy 18 will see the first annual trying to get enough signatures on a petition 25 years ago this month,.. Pride season and '^m>iit^ TeamRochester Golf Tournament, with that her name be placed ot\ the ballot, or she letter co Sears coipm^teojHScee^jlaining that registration begioning at 7 a.m. at the could withdraw with enough money to fund From the Empty Cioset, July 1973 Woodcliff Lodge Kesort. The cost is $50 a foture candklacy. She decided that tf she visibility Carbon cop/: Sears* Scars neaHy lost a $Y,Q00^1e because of this The newsletter for the Gay Revolution of Center, however, ignored GROWs involve­ per person. At 8 a.m. the evenc begins wkh had not ^ne welt, it would have reflected on polic)'. Carol said she M'ould E-maH the district Women (GROW) reported on Jufy 10 that a credit policy a Shotgun Scramble format. All proceeds ment. managicrrand atteiii^to t^otniic^^^^^ the lesbian/gay community and might have go toward the expenses of TeamRochester's meeting called by the group in May at the The GAGV Speakers Bureau did a two- May 23, 1998 ofHcc to change thispolicy. I dM purchase the hurt other gay candidates, and she deckied to competKton in the fifth Intematfonat Gay Wonien's Center had resulted in the forma­ part talk show with Wyoma Best on WHEC Scars Customer Service/Credit fl{^S^ances becso$e ^ron, Canjii alEuiltob ^^crc withdraw. Games in , the Netherlands, tion of Rochester's first Rape Crisis Center. TV on July 16 and 17. The first show fea­ 3333 Beverly Road supporti\x, professional and agreeable. 1 com­ Kevin Finnegan, president of Manhattan's Aug. 1-8, The golf tournament welcomes Planned Parenthood and the Women's Health tured Bob Crystal talking abouc gay rights. he Gay Pride Parade and the Gay Aiiiance Picnic will be combined again this year into Hoffman Estates, IL pliment them on the vc^y thcy handled this Gay and Lesbian Independent Democrats, all gay and non-gay golfers. To sign up. call Collective contributed ideas and facilities to The second show featured Michael a Pride Weekend, July 17-19. Since Rochester Pride Parades started in 1989 (then they To ^"hom It May Concem: sitoarion, however, I would like to sec this said, "The Democratic Party is not ready for Leslie Apetz at 482-9356 byjuly 11. Players the project. Publicity about the Rape Crisis Robertson on the subject of gay life. Twere held on June 28 to mark the StonewaU Uprising), conditions for gay people in our SUBJECT: CREDIT POLICY policx' changed immediately. us to be full partners yet, but they've opened will be limited to 10 foursomes, and can societ)' have changed quite a bit. Unfortunately, one thing that hasn't changed enough is I would like to respectfully ask Sears to the door for us like ntrfer before. Barbra is a non-parent she basically has absolutety no Please nonce that a copv of this letter was create their own foursomes or be paired can choose from among five speciat interest inadequate or nonexistent coverage ofgay issues by the mass media. revisit and change its policy concerning re- the right candklate, but this is not the race co rights under New York law... It was the sent to sc\'eral large gay and lesbian newspa­ with a group. workshops each moming and another 6ve Govemor Pataki has been dangling $2 million in Department of Health funding for gay and f\jsing to issue joint credit cards to coupks pers and organizations. This is not stricdy a gay run, each afcemoon. correct decision under the case law that Saturday is also the date of two new lesbian social services in front of New York ga^Tt, and then jerking it back again. Even worse, without the same last name. 1 was in your issue, however, do not forget thc married Kavanaugh plans to keep a high profile in On Saturday at 6 p.m. conference partici­ exists right now in New York" store in Henrietta N.Y, on Saturday, May 23, evena for gay ^milies with children. Bor­ N.Y.S. Senate Majority Leader Joe Bruno and the Republican caucus have made sure once again women \x'ho choose to keep their maiden the Democratic party. pants will move from the downtown Sheraton Richard Alderman, the ex-partner's law­ 1998, to purchase a washer and dr)*cr. My ders Books and Husic wili present a Gay that the gay civii rights bill (now called the Sexual Orientation Non-Discrimination Act), passed names. In tlie competitive environment that Sandra Frankel of Brighton, who has al­ Four Points Hotel to St. Mary's Church, yer, said that che two women had planned partner ViuA I chose a model and were in the Pride Storytime for young children at 10 for thc sixth year by thc Assembly, \^^li not cated columnist Deb Price Hding in a silver Sear^ operates in, one must ask is it vise to ways been supportive of the gay community, where Bishop Clark wilt celebrate Mass and to have a child chrough artificial Insemina­ process of opening a chat^ when Aaron a.m. Tanya Smolinsky said, "This is the first come to the Senate floor for a vote. Due to this converrible, or receiving a medallion from alienate customers. is still in che Lt. Govemor race. deliver the homily. Local supporters of les­ tion. The ex-partner has said that she had a Thibauit informed us that cmly couples with time ever that Borders has had this kind of conser\'ative abuse ofthe democratic process, Mayor Johnson, didn't merit a D^ Csnap. Sincerely, -Christine Dinsmore. The New York fikide bian and gay ministries are welcome at the partial hysterectomy based on her former the same last name could open joint ac^ event. The stories read will be inclusive of after 28 years we srill don't have any form of Can yo/f spell *'invisiblc"? Henry PrzybylolJ^^c^ Mass and at an optional community dinner partner's promise to have a child that would counts. lie went on to explasn that my part­ ^y families and appropriate for young chil­ civil rights protecrion. The inclusion of sexual I think we all want to feel optimistic that Rumford, R.I. National group for with che Bishop following the Mass. be tiieirs. They agreed to share the rights ner Tom could bc added as an authorized dren. Belinda's Bctuquet by Leslea Newman orientarion in thc hate crimes bill has caused it GanncttwiU cover che gay communit^'V major cc: Tlic Empt\' Closet Currentiy. NACDLGM meml>ership in­ and responsibilities of the child's upbring­ user only. Wc confirmed this poiicj'with the is one wondeHul book that will be included. gay Catholics to hold too to go unpassed. AH of these issues seem event a little morc adequately this j'car. It's cludes people from more than 35 Catholic ing. When the baby was bom in 1993 she department manager and nearly canceled thc Options magazine This Is an opportunity to leam about sev­ newsworthy, and affect thous.^nds of legitimate to be conceracd, though, because dioceses with ministries ranging from one- was given the ex-partner's last name as her sale. I am shocked that this day and age Sears InNcwsWcekiy eral books avaiiabie for gay families. After conference here Rochesterians, yet I have never seen any refer­ the mass media wield a great deal of power, Thc Rhode Island AJIIiancc person AIDS outreach programs to parish- middle name to indicate the ex-partner's docs not rccogni2c all of its customers. three or four stories are read, the event A national movement providing pastoral care parenthood. Alderman said. ence to them in the Danocrat c^ Cbrortklt. and so often it seems that editorial decisions Rhode Island Gay Website ww^v.glbt.nct based ministries to full-fledged diocesan-sup­ witl conclude with an arts and crafts activ- and support for lesbian and gay Catholics and Because of media silence, most heterosexu­ as to M'hat gets covered and what stays invis­ We spoke to Carol Kalmbachcr, Store Rochester gay Website ported ministries. In February 1997 the two women jointiy ity." their families wilt hold its fifth annual confer­ als are unaware that lesbians, gay men, bisexu- ible arc subjective decisions. It's hard not to bc Manager, and while all involved agreed rfiat u'^'Vi'.gajTOchcs ter. com Registration materials or more informa­ filed an adoption petition under which the At I p.m. the GAGV will sponsor a Gay ence in Rochester, Sept. 17-20. als and people sriU have cause to pessimisric wVten one sees indications that the polic)* was anuquatcd, thcy could not tion about ti^e conference can be obtained bio\o^ca\ mother al\eged\y agreed to give Buffalo gav Website www.buffaiopride.com Family Curing at Charlotte Beach near the fear that their employers uill see them on T\ mainstream journalism may no; bc as accurate offrr a sohjtion. ! asked that Carol v^-ritc a The National Association of Catholic Di­ fromNACDLGM98, \2I UndenStreet,Roch­ up her rights as the birth parent so the two large pavilion, lastirig until 4 p.m. Tanya marching in a Pride Parade, and wnll immedi­ or objective about certain groups as it claims. ocesan Lesbian and Gay Ministries ester. N.Y. 14620-2311; or e-mail: could zdopt the child together. However, Smolinsky commented. The GAGV rec­ ateiy fire them — for "poor job performance" For jnsrancc, a May D^CsiVxiclc about thc (NACDLGM) conference is titied "Imaging [email protected]. they ended the relationship before the adop- / ognizes that many people in the community or some other excuse, rather than for the real horde.*; of visitors expected to descend on litde Justice," which Casey Lopata. local co-chair tion proceedings were final. This fact was who have children want to partkipate in reason of bigotr}'. Funny that homophol)ic Seneca Fails for the women's rights cdebra­ Corrections of the conference, said reflects this state- Syracuse lesbian cited by the appeals court m its ruling. The pride events but aren't comfortable bring­ lx>sses shouid be so warj- of telling the truth, rion this month listed a "Committee on Les­ mentfromthe 1997 document, "Always Our court said that "it was insufficienc to show ing their children to our annual Picnic. This since (as most straights don't realize) it is stiii bian \'^isibilit>'** as one of the invading alien Three graphic credits were omitted in the Children," from the Committee on Marriage loses custody fight to that the child has bonded psychologicaify first-time event at Chariotte Beach is espe- quite legal to fire, or refuse to hire, peopie enrities. Bfupty Closet reitdcTS Unow that it's thc June Empty Closet- The photo of the and Family Life of the Nadonal Council of with the non-parent." ciaify for community members who have biological mother solely on the basis that they are gay, lesbian, Cdalttion for lesbian Visibility', and that it was MOCHA Profect staff on pa^ one (top Catholic Bishops: -Associated Press children. Having two children myself, t am transgender or bi — or are perceived to bc so. founded in Seneca Falls in 1995 and has been left) is by Ron Cl^rk. "Nothing in the Bible or in Catholic teach­ A state appellate court has ruled that a particularly iooking forward to celebrating There must be some kind of guilt festering there ever since. But it's clearly not quite The photo of the '93 March on ing can be used to justify prejudicial or Syracuse lesbian who had planned to adopt Partner notification Gay Pride with other timiHes." The outing deep inside these employers, or they wouldn't visible enough y^x — to some. Washington (betow left) is by Ellen discriminatory attitudes and behaviors." her lover's child before they ended the rela­ offiers swimming and playtime at the beach, The conference will open with a welcome bill passes in Albany feel that insunct to coyer themselves. A small matter, perhaps, although ituiica- Mahaffy. tionship does not have any custody rights to and the chance to meet other gay families. by Bishop Matthew 14. Clark ofthe Roches­ Coming out is, of course, our best hope for tivc of thc level of knouiedge of thc gay The Pride graphic (betow) is by Paul the child. At the end of che legislative session on June For informatfon on any aspect ot Gay ter Dfocese, who Is recognized nationally for ending prejudice and discrimination, but it is communitj' deemed adequate by i>eXr edi­ Jutton. On June 12 che Appellate Division of State 19. the New York Scace Legislature approved Prkle, call 244-8640. his caring outreach to lesbian and gay Catho­ not aJwa^'s possible for ever\'One to bc totally tors. But then there's thc tcsdmony of Sgt. Supreme Court here in Rochester ruled a bill CO mandate that people who tesc posi­ ^K^^i, lics and their families and friends. out. For thc financially secure middleclass, Steve Scott, liaison to the gay community' for 'U» SONDA continued from p. I unanimously that the ex-partner has no legal tive for HIV muse provide names of sexual or however, thc reslity is that most of us have thc Monroe Count)' Sheriffs Department. conservative Sen. Serphin Maltese {R* Each day. the conference will open with a standing tn this state, whkh does not recog­ drug use partners, so chat the partners can be litde to fear (but fear itself) if we choose to Qu^hs) was the onfy Repubtkan to vote plenary session with presenters addressing nize same-sex marriages. notified of possible exposure. Scotr told this reporter, "'Last summer, a topks that include 'Toundatlonal justke: stand up proudly for ourselves and each other. agftlnst the btii, while the six other Repub­ The decision reversed the ruling of an The bill wil! also require doctors to report Gannett reporter called and was asking about Toward a Catholk Case for Supporting Gay Unfortunately, it's not exactly comforting to licans on the 12-person committee voted in Onondaga County Family Court judge who the names of people with HIV to publk leu'd behavior in the parks. Hc said, 'Is it all and Lesbian Civil Rights Legislation" and reflect that, while we may still be caught on TV favor. Paula Ettelbrick, legisfative counsel had given the ex-partner temporary visita­ officiais. Anonymous testing v/iti still be avail­ h€>moscxual activity'doxi'n there?* I said. That's '^Pastoral lmplicatk>ns of Catholic Sociai Jus­ cameras»we have Uttle to fear from exposure in for ESP A, said that key Republicans like Sen. tion rightt to the child. The.appeals court able. (The Empty Oosec hopes to print an not thc cascj and whatever \t»yx story is, it's tice Tradition fbr Ministry with Gay and thc Oemocrat <& Chromcie^ judging from last Dean Skelos, a powerful Republkran Irom dismissed that case for tack of standing. artkle in the August issue about how the law \iTong.* The)' seemed to want to kc)' in strictly Lesbian Cathoftcs.** year's Parade coverage, which as I recall was on homosexual acri\4ty." tradMonaify conservatto Nttsau Co.. voted The bfologkal mother's lawyer, Marsha will affect the gay community.) On Friday and Saturday, participants also two or three paragraphs on an inner page of Let's have fun on Pride Weekend, ixt's for SONOA on May 26. Hunt, said, *The appeUate court... said that as -Associated Press Sccrion B, uithout even a single photo. parade and picnic and part}'. But let's not How many rimes can some 2,000 people, dismiss ^drvt polidca) aspect of tiie word "Pride." ii9ma^mmn'mH our confidendai GAGV Membeiship includes an llwpty Chset wearing everjtiiing from "straight-appearing" Because the struggle isn't over yet* Because wc garb to the full Carmen Miranda, march dou^ need to bc visible—we have to bc seen to bc Y sul>f4=f|^tion metlcd toyoof home eleven times a year in a plain East Avenue without meridng a single photo­ believed. And because Gay Pride fsn*t ftist a nc^hJ^ !f-thc-nionth: Sdflespect siiould Even d>c sight of Gannett-published sj'ndi- bc a feeling for all seasons. check this DOX: Ll V^'- I Suittfijofdcfi rmUmwtmtnmm^nl^4*0lr^ih.J^4Jmr:ln _' ;' th» 00y AUiance of the Genesee Valley! Q Enclosed is a check payable to GAGV I flarVtwRttSKn }The Empty Closet D SubscHbe! ljfc';i**<«lFbaM>iiWlrfHl»»pWi*i^^ %!**>»•<<» »a^»rnttfcry» -Wwwfc LBV£L»0!UAa» GMBCK CMNB> Q Please charge my q VISA or q Mastercard accounc tmmitk •wfc ilwMHii wt F*

, ••* .•-.•' *"-"• Name I - > • . - 'fit ..•• • ' • w^f HbosehoU i^^iimai^ Q Stiiden^ l^ennnalfy Signature of cardhcrfder , I We'd like to ask you to become Address I Contributor «s6«op«JiA]r O O^^niltttkHi SSdenimdfy I GAGV members (see ad on next NaAic: ^ I IhMn fldOaMseAsr (3 Bysineiw |75snnuidBy I P^gc) but ifyou just want a M«IUm*Hlk, nw (wMicwit**. ll|l|HlriMW*W!im,hWHlli,»twi»mHM);, I •^ ^iff^n|ilH Tar subcripdon includes It isnic*. I • *\nma\\wu\mmv,Wt,tmft^t^Mimfrfmmm^-k\wf\\httnimm^tii^^ Paq>crsue mailed in pbin envelopes. Return Oty and State: Zip: itmm^mi*U,s*d^nmtnm\jmmtmvJi^Ut^ > LJ 1 yrar $i5 (S2.3 Canadian; 528 International) to E.C. PRESS, 179 Adamk Avenue. Roch- I- Piihi*f«if«n tmtmmtMMm. Thn I'jmft^ OMV M fiMMted 11 whn i pur . '^'j. I ffivmnlht.tmidimiimy pimkimeiHitK r^ftft%>$Ai fetwfltficlfctM ' Home Phone: Business: LJ 2 years: S2nh MiMttt^tm fit ncit Support s I mm:»KSathbi0t4AmM^dtttumwpektitthtmnMk,wi)imhKituKtiiim fimn inrfnlcmtitnyv. HK poHtcannN ntf the IMMC nr f^mn^afJk nttitt k C h €i $ n :w: . , .^^..:i^.^...^-ei. g><--. .-.^ ^..^ati. -* "111 ' -^ •••^-•- IM] ... jjititiiigtmaiKmMtmm cans (dse natkMiai ^y and lesbian Repub- Kevin Dowilngk Hayward City Council. state tn 1999. ""We tael lc*i w Important,* resident She Is seeidhg asylum here be­ Play about gay Christ Kate Monteiro, president of the fOiode icafi |r«iiip) CO ht¥e a booth at the state Dumanis* oppcment sent nmtk^ to voters .Maivin saML 'that our ^rldtt ffremi are be­ cause she has b«eh beaten; IttnnMsd arid Island Alliance for Lesbian and Gay Civfi Rflpiibitcsn cemention on June 12-13 in professir^ to uptieiifS»HitiQini values** and coming gfobai.** forcibfy detained by botf> Russian^ poMce to go ahead despite Rights, sakl "For ttie gay communtty, it .FOfrVNtefth, warnk)g of *'SfM«isl interest groups, (inchid- 4xMi Chtt>bero Jr., The Wasitinglon Bhde and orpnized crfrM Hfures. fbr beir^ a means the state fias made clear that pri­ lesbfw)andforadvocatinftorch^r%hctfor The Texas R^ublkans also compared ing) gay ri^Ke o^pniaations** which are at- threats of violence vate sexual conduct is private. The l^eis- lesMans and gay men. the LogCid>ih Republkans to pedophMes. tenrtptirY W '^eomipi;*' the. Judidal system. lature has removed one of the prime African American- A New York tlieater tiiat canceled the pro­ * TexaisR^ublican Communications Di­ Judge Dumanis we«YC cm to take 72 percent of fiarassment tools, as well as wfiat has An cariierappeatvittsrefecqidfaytiui U.S. ducdon of a pU^ about a gay Christ afcer Hispanic Quilt shown rector Robert Black saki "^e're not tite vote. been a general stigmatizing and threaten- Board Jeffanm%rMfonApp«ds.Atiiii^^ receiving bomb and death threatt has now SPiRf «9 aifow a forum for the kind of -Gay andi^esbian Vkcory Fund ir*g force." at DC EhKic Pride Lambda L^Dehmtmnmd BJucMpp^fthd decided to go ahead with tite play. wo«i a ruHng d«at lesbians and piffliert who hactMlfeMgu;^^ i^instpeople offaith that The 102-year-otd taw prohibited oral On May 25, die Black Lesbiwi and Gay Pride Pat Robertson On May 28, officiais of the Manhattan suffvM* violence In tiieir homMahdsfieednot ti^Tcocas Freedom Network, or the KKK and ana! sex for both heterosexuals and • NATIONALAND INTERNATIONAL NEWS Pknk in Washingcon D.C. was the site for Theater Club, an off-Broadway non-profit, prove their persectnors tud ''meiiefous or tiw National Man-Boy Love Associa­ homosexuals, defining tiie practices as the unvetflr^ of the first panel of the first threatens Orlando announced tiiat it will proceed with the fall intent" when they tried to fordbfy *'cure" tion or >M4K»ever else wantt to spew." "abominable and detestable" actt punish­ June 28 and Jufy 9, 2000. Afrkan American Hispank AIDS Quiit. production of Terence Mcfslatfy*s Corpus International ffKys with psychiatric hospltal^iction, elec- Rkh Tafel, ^(ecutive director of the Log with terrorist bombs able by up to 20 years in prison. The pane! is goki with red, black and green Oiristi, assuming the polke can provide ad­ Mkhael Mills of the San Frandsco-bised troshock and drugs. Cabin Hepublkans, said, 'Tou can't call Anti-gay political broadcaster Pat Robertson edges, and listt the names of the deceased equate security measures. Rhode Isfand would become the 30th groups plan march Intemational Lesbian and Gay Human Rightt yourself a b^tent party and discriminate threatened Disney Worid and the town of founders ofthe Pknic — Henry Chln,"Danny ff Pitcherskaya retums to Russia, she A recorded message received at the the­ stace vi^thout a sodomy taw, along with Commission said that his organization is against people at the same time. As a Oriando, Fla. with terrorist bombs, "earth­ in in 2000 Williams, Chauncy LyIes and Larry Sphistrict of Columbia, Sbcteen states urging gays in the U.S. and other countries to Christian minister, I am offended that our quakes," **meteors" and "hurricanes" in June Gay rights activists from . North inside an outilne of die African continent. ued brutality by pofke and by attadcers Terence McNaIfy" and the theater sttff with still retain such laws: Afabama; Arizona, write to the Prime Minster ef Itafy, Romano organizatfon is being accused of 'spewing on his cable TV show The 700 CM}. America and three otiier continents have who are Ignored by polke. *The evidence "extermination** and buming the theater to Rorida, Georgia, Idaho, Louisiana, Minne­ Prodi, to ask that he prevent RutelK and Organizers hope tiut the Quitt Wtl pro­ hace' against people of faitiw There is no Robertton implied tiiat terrorist actt WK>ukl agreed to hold an intemational march for before the Board was overwhelming tiiat the ground. (McNally was raised Catholk.) soca, Mississippi, North Carolina, Utah others from interfering with the march, and vide an accessible means for AfHcan Ameri­ question titat onfy one side in this is bc a legitimate response to allowing ^y ofp- ^y crvll rights in Ron^e on July 8, 2000. Pitcherskaya is at risk of being persecuted The Catholk League for Religk>u$ and Civil and Virginfa (applying to both straight and pofttting out that *^e freedoms of assembly cans to iKMior foved or>es who have died of spresdlr^ f^tred — that is Robert Black nizations to put up rainbow flags on streetpoles The Worid Gay March wiil include for being a lesbian if she is sent back to fMghtt has promised to "wa^ a war that no gay couples), and Maryfand, Kansas, Mis­ and association" are protected xmder Article AIDS. and the Texas GOP. What Is H going to in celebration of diversity in Oriando. v^ere conferences and celebrations, and will Russia,** saki Lambda Staff Attomey Suzanne one will forget" in order to enforce censor­ souri and Arkansas (applying onfy to same- 11 of the European Convention for the The EMack Pride Festival ori Memorial Day take for good Republicans to wake up and Disney Worid is located. Roberoon, founder take place at the same time when over a B. Goldberg. "The Board should have ship of the play. sex coupies). Protection of Human Rightt and Fundamen­ weekend, which included parties, receptions, of the anti-gay Christian Coalition, obiected million pilgrims are expected in Rome for granted Alia asylum now, not left her in confrontwhatishappeningto their party?** Supportive testimony came from people tal Freedoms, of which leafy Is signatory. plays, poetry slams, live entertainment, cruises to '*Gay Days" at Disney theme parks. "tn a worid in which abortion clinics are a millennium jubilee commemorating the legal limbo." Log Cabin planned a ratfy in Fort Worth with disabilities, wfio have also experi­ Among those who have written to Rutelli and artt festivals, drew over 4,3CK> peopte. David M. Smith, communications director bombed and churches are bumed, we couldn't founding of Christianity, whkh Pope John Pitcherskaya has been targeted by polke on June 13. enced state interference with their sexual is Robert Miaifovich, president of Dignity The purpose was to raise money for local and senior strategist for the Human Rightt produce the play responsibly," said Execu­ Paul II called for in 1994. The Vatican and since her youth. After years of beatings And -GLAAD practices. USA. a national gay Cacholic group. AIDS or^nlzations. Black Lesbian and Gay Campa^, saki, "Pat Robenson practicaify tive Producer Barry Grove. Thc N.Y.C Po­ the Italian govemment are hostile to the arrestt on charges of "hooligani|IVh** (a -Rhonda Smith, The Washitigtott Bhde Sabbadini said that Worid Pride Rome Pride Day, Inc. Is preparing to file for tax- G^ candidates win invited a terrorist attack on the city of Or­ lke Department has now promised protec­ march. Italian gays say that city inspectors charge ofcen used to allow police to arrest 2000 had been endorsed by the committee exempt status with the 11^, which organizers lando. In the wake of last year's bombings at tion. have begun a campaign of harassment and detain persons for up to I S-tiays with­ Gainesville, Fla. OKs that organizes EuroPride, a Gay pride cel­ hope will help draw more sponsors and Califomia races Olympic Parle, the Atianta gay nightclub and a -Wayne Hoffman, The Washingtoti Biade against gay bars and meeting places in out trial, or five years following a convic­ ebration held each year in a different Euro­ ultimately make tiie festival free of charge. Three candidates endorsed by the Gay number of attacks on women's reproductive pro-gay ordinance Rome. tion), Pitcherskaya's business has been de­ Rhode Island repeals pean city. The event has also been endorsed -Nicholas Boggs, TTie Washingtcm Bkide and Lesbian Victory Fund have won races heatth care facilities, his remarks are an out­ Mayor Franco Ruteiti of Rome was stroyed and a co-worker murdered. Her The City Commission of Gainesville, Ffa by the International Association of Lesbian in Califomia, and a fourth has won Demo­ rageous act of irresponsibility that have the reportedly considering a ban, the Italian case now goes back to Immigration court, sodonny legislation voted 3-1 on June t to add sexual orienta­ and Gay Pride Coordinators, which includes Russian lesbian must cratk endorsement for a House seat. potential to incite more violence." press said injanuary, but has since backed where her claim was originaify rejected. Rhode Island's Senate approved a repeal of tion to the city's anti-discrimination ordi­ members from the U.S. One member is San Christine Kehoe won the Democratic '*Pat Robertton has exposed himself and down. Renato Sabbadini. the Italian gay pr€iive persecution the state sodomy law on June 2. The Repub­ nance, after months of heated debate. Francisco's Gay Pride Festival, and official -Ijambda Legal Defense and Education nomination for Catifomia's 49th District the Christian Broadcasting Network to sig­ civil rights leader designated as coordina­ Russian lesbian Alia Pitcherskaya, who is try­ lican govemor, Uncoln Almond, was ex­ Debra Oakley Maivin said that organizers of Fund seat in the U.S. House of fVepresentatives. nificant legal action should such a terrorist The ordinance makes it illegal to dis­ tor of the march, said that it will be just ing to seek admissfon to this country to avoid pected to sign the legislation by the end of Rome Pride plan to work closely with the Kehoe is the first openfy lesbian candidate action take place," said Tony Varona, HRCs criminate against people based on their one of a series of cultural, political and persecution, was told on June 6 by an immi- Texas GOP excludes June. organizers of both the Millennium march, to win the Congressional endorsement of chief counsel. "These remarks cleariy indicate sexual orientation, and covers employ­ artistic events associated with Worid grationjudge that she must prove that she is The state House voted 49-40 on May 7 to planned for April 2000 in Washington D.C, a major political party. a reckless disregard for the safety and welt- ment, pubtic accomodations and housing. Pride Rome 2000. which will take place in likely to be persecuted if she retums to Log Cabin group repeal che law, and the Senate followed. and with the 50-State Action organizers who The three elected officials are Bonnie being of the peopte of Oriando. ** Gainesville is in an area whkh has seen Rome and other Italian cities between Russia. On June 3, the Texas Republican f^rty Dumanis, San Diego Superior Court; Ken Both House and Senate are overwhelmingly much anti-gay organizing in recent years. are planning a series of marches In every U.S. -Associated PV-ess; Human Rightt Cam­ Pitcherskaya, 36. is now a San Francisco refused to allow the Log Cabin Republi- Hahn, Los Angeles County Assessor, and Democratic. - M. Jane Taylor, The Wdshington fiiode paign ROCHESTER PRIDE WEEKEND Ti6e Alliance of Genesee Valley; Celebrating 25 Years Annual Pride Parade and Cultural Festii^al Saturday, June 18, 6 pm

Parade begins at 6pm at the Liberty Pole, move^ down EastAve. to Goodma^n St. and endd at ViUage Gate Square, Tropbi4M will be awarded for bedtfloatd Groups can regUter to march together Call 234-8706 for registration information Cciltarql Ftttlveil at Village Gate ImmotJigtaly ft^oyAij 4Hbe>^^ |^^ Vendors Mu^ie Ca^h Bar Daaelng Entertainment Great people and lobtt of fun

Thank you to the generous organizations and individuals who have offered special support and/or Hnancial backing for thie^vesktr > The Pride Connection Tim Tompkins, Inc. Blair Design Studio/ Celeste Wair Rochester Custom Leather Muthers Calvert Group/ Bill Glave CFR American Expreaa Financial Adviaors Christiania Carol and Carrie Cleveland Southwedge Collision

Sponsored by the Greater Rochester Gay and Lesbian Busirtees Fonmi and The Gay Alliance oi Genesee Valley. f^t'^^e'O'jr^f » 04f090 9 0 4m»*^0Mj0*0*^Mea^^ f *^>^''-'i^'^^***^*»'»'»'Tfc^V»%.w».s,v\.%^.-^

i^iuk^i^i^aii:*^ v

'ThoM CBUpiiftw mMdh the mottien IMMI Wftant nktm away terview: INMII tlw calMpM^ in w^Jer to haum moea i^ma wtth «ach Lesbian psychiatrisc Nanette GairtcciL studies lesbian othwr* waett moMi wttttf to stiii moms and childten on a long-term basis be tDfallMrirtMM llw couples that hadfaoaii MWMHib cMid. • • -^ \ 15tli-19th z By BsdMer aadbbfattn co-cnodbeis WCVC intteracwed H^MO wlien the July In the earfy f 980s Iocs ofle^3fans «ctr begin' iM« Inchide: biao psfdxiatcisc, was knetesKd tti studyif^ are 10, and this for tfae first time inchides had bn^ccn up. Those cotsples in which ihe wiio once idenrificd as feafaseitt ace now in­ Priile PaffWrie Wednesday, July 15 mothers had spent time away from die dud- vohred m'idimcfi; a forwVNiicft faave died. But dicsc pioneer Icdbtam. interviews wtdi die cfaildtea tfaccnseives. Hien AKI'Ss Gmy Bingo Night at fite Sdioof of tite Arts "Wc had ao nK»ey,'* she said in a%oeci]t ti&c fiunilies wiQ bc uBtcrvievcd next when tfac drcti, in order to have tnore time with each Nanette has stayed in soncfa widi fust alxxxt all Saturday July 18th at 6:00 pm Doors open 6:00 pm at 45 Prince St. iiucivicw, *'hmtdicxmrse none of due work Fve ditkitcn arc 17« and wfaen tbey ave 25. other, were morc likely to still bc together tiian ciiciiiDnfienfto>filcs at the Liberty Pole ever dooe has been foodcd. It's ofuafiy coo ^'Whcn we interviewed die modscrs ac first, thc entries diat had been mosc child-focused. break up and dien get involTed wnfa new part- conuovetiial to be fonded by any erf'tlic tradt- wfaen tlicy were pregnant, dicy ancidpofced Now thc team is interviewing thc 10-ycar- nets, Nanctce iocogpowees iM diesc ''step- Tiiursday, July 16 cfooal 9tMxrccs, socfa as cfae Nacionai Tntckmry bdf^ out as Scsbiansy" said Nanette ""For the old children* "It's vcty exdting to bc inter­ moms'* in die scudy, ''Tfuf meana wc may be GACVs Annual GAGV Communtty Center^ Open House of Heaitii. Ic's yeas ahead o£ns cmc fo terms of most pan thcy used unknown dotiors, because viewing the idds for the fitst time,'* said Nanette. die onl)'sttftdy diat iias tfK»«e pniidpaffits at the Doors open 7:00 pm at 179 Atiantic Avenue wfaen socfa jgcocks wxdd food this kind of dacre was a lot mote four at tfaat time that "Because we have these very articulate kids end of tfae scidy tlian «t die begBonaa^ * she Priiie Picnic research. Wc decided if wc waited for fondiog somehow the state would come in and take the who are highly educated araund issues of di­ said. Fnday July 17 versit)', radsm, and homophobia." ^coctes to get over tiicar homophobia to fond children awav. Bv thc time of die next inter- ^iore information aiiout tfae sttidy results Sunday July 19th at 1:00 pm, Brealc a Sweat for Pride dak study, ve'd be watting anocfaer decade. So Doing longitudinal research is not easy. can be read in: Nanette Gartrefi et aL (1996), views, whc^n tfae ciuklicn were toddlers, many Co-Sponsored by ESPA, GAGV and COAP we went ahead aod fonded k oorscivcs.'' of dicm ic^etied tfais and wished diey had When Nanette had a fiood in her basetnent a "The Nationai LestMan Fam% Study: Intcr- at Genesee Valley Parle Doors open 10:00 pm at Muthers Nanette's study is now the loc^gcst-mnnii^ used a Icnown donor who could have partid­ fi:w years ago, some ofthe file cabinets got wet. views With Prospecnvc Modvis." Americatt Atl proceeds benefit the Gay Alliance study of lesbians WIK> had diOdicn via dcxior pated in the child's tife as a fadier. Lesbians "I was jErandcally using a hair dryet to dry thc Jatitms/^Orrhtpif)Mitfty^rciutae66^nmDbeTZ, ''•i inscmiciackxu tiiat wc inter\'icwed even a few yc^rs later had pages ofthe interviews so the data woukin't be PP.272-2S1. of the Genesee Valley Saturday, July 18 ''It's already been wcO-doctmicntcd diat kkis b^un to use knovm donors. Wc actually lost,** she recalls. Nanette phones all rhc fami­ Estber RotMiim Is Ptit^tsor iif Psychology at tljf 1st Annual teamRodhester Golf Tournament of lesbian moms are health)-,'' Nanette told mc, stopped in\-iang new participants in 1992 be­ lies each year co sec if the)' have moved, so she UnitYrstty ef Verjimmi and EJitor afthe^orsmsX of Tournament begins at 8:00 am at the Woodcliff Lodge "so we're not trying to rc-estabUsh that. What cause the *old* lesbians differed -so much from won'tlose touch with them. A coiq>le of \k*omcn Lesbian Studies. Resort. Call Leslie Apetz at 482-9356 to register we're interested in is how thcj- have coped with thc 'neu*' ones in terms of donor identit)'." bocDOphobia.** At thc dme, Nanette's maior Not surprisingjy, the children were vet)' Gay Pride Storytime for Young Children collaborator was living in Wasfui^;ton, D.C. much desired. When the lesbians were first and Nanette was living in Boston, so die>' intervieu-cd ahilc p>regnant, about half the 10:00 am at Borders Books, Music & Cafe began the researdi with lesbians in those two u'omcn were in coupled relationships, and had Gay Camping at its Best dties. Then Nanette moved to San Francisco been \iiih their parmcrs from a fc\i- months to GAGVs Gay Famiiy Outing and included lesbians firom thc Bay Area. a decade or more. Others ^-crc single mothers. 1:00-4:00 pm at Charlotte Beach near the large pavilion Hie first step was finding lesbian nxxhers to When Nanette's team re^ntervicwcd che partidpate. Nanenc's research team advertised mothers when die childrcn were a year and a 983S OLD STATE RD. GRGLBF^ Cultural Festivai in bookstores and gay and lesbian newspapers. half, thcy were not surprised to find com­ Following the Pride Parade at the Village Gate They made up flyers to distribute at lesbian pletely exhausted, harried mothers who had ANGEXJCA. NY f 4706 films and comnttmity events. Thcy went to aU ver)' litde time for their own lives other than ^ tbe -wonVsVkOp* on choosing children suid told childrcaring and paid cmplojTncnt. One ofthe participants abour the study. Hie originai study areas of difficult)' was thc iinJc contact viith '^C^r 'yfli^rc Oyt^0Ttptt%t\oyt began widi 154 mothers. their partners, and this "was often a source of Tlic first interviews took place \i'hcn thc tension. By the time ofthe interviews when thc motfaos were pregnane Then xhe mothers and children were Bve, a number of the coupes CAMPGBOtJMD Call the GAGV at 244-8640 Leam Meadowview Campground BE ONB OF THB SELECT FEW TO HAVE A toeoled ie tt«iMUe^. ta. (7i7}ft7e-^MW at IFiUage Gate Square GUeST ^iOi'SE IN •.eel/'^fli^^piMiai^ . MON^ REAt Ajoftnut CTiaaeiM ce wB«fea>: 9MUm§ iffiU^emi i TO TH8S YEAR'S GAGV PRIDE PICNIC C. k -i: BegLonera: WedmaaAay Xl^fbts 6:80-8:80 WHAT A $100 RAiNBOWPASS ENTTTLES YOU TO: XBtem&oaiate; Saturday Morning lO-BToon (^ A.(\y Vv'd^:'-PiC''^\c_'-r]i.n\\-^> v.- ;: *'- T 2 GAGV 2STH ANNJVERARY T-SHIRTS nCDS CZiA88B8 Csoo iMtlovr^: • 2 BEVERAGE TICKETS TO THE PICNIC WHICH INCLUDES 2 MUGS V .r^ ! f:,Vv^ci 4wiy«*io fmariM'ir tPairao*** JhOjrufBi • 1 LIMfTED VIP PARKING SPACE NEXT TO THE ROUNDHOUSE (INSTEAD OF THE LOT ADJACENT TO THE PARK) ItelMftntarLMlaiACiirnB&MMfMM Where to buy your Picnic ticket: • 10 ENTRIES IN THE RAFFLE DRAWING FOR THE SMIGHT STAY m MONTREAL The Peiim Summer Jni! Anthony's 522 • Avenue Pub • Muther's T A USTINQ m OUR AUGUST iC Tt^^^MCYOU AD Common Grounds • Pride Connection Nni^DMBMnifirlH^BB Bachdor Forum • Club Marceiia • Tara"« NfMr A $S0 TtUAtttSLB PASS ENTmM VOU TO: • a BEVERAGE TICKETS TO THE PICNIC WHICH fiHBB te Ml Ml Aaari fihi Rochastar Custom Leathers INCLUDES 2 MUGS NriMiNFwlMiRQchhKVIbl SBicwood • SMca of Ufe • Partdeigh ^ 1 UMITED VIP PARKING SPACE NBCTTOTHE Aak alMmt Vlia IMOay Vooatlaw BUuey OOMbl pnvMiMimibiirialaifint Rochester Spa & Body Club ROUNDHOUSE (INSTEAD OF THEt^pT APkMCarr TOTHEPARK) BBIAN AMBROSE gUk • 10 ENTRIES IN THE RAFFLE DRAflMNGFO^mE &A880AlMimaQ» 784-7440 • 874 N. Goodman a., Bte O-Sea aaiHiM of «w OMIWM voiqf GM nr ilin aSmilei kMl yNrMMMiphMIIMhK WE NEED YOU TO VOLUNTEER AT THE PICNIC CALL 244-8640 %\ .%>.rr- • • .•••-•f . «.*>'^v».V'.vv\.:vv'v%%'-i-*%%*r^%r*-rrr,-:*-%-v,rrr*rr*-j-^^^

vi -frv

is Those couples in which the mothers bad spent time away terview: from the diMrenp in order to have mofe <^ne with each Lesbian psychiatrist Nanette Gartrell studies lesbian otiier^ were inore IHcely to still moms and children on a longterm basis be together ttiaii the couples that had been tYiostr child- By Hadicr Rothblum co-mothers were intc^e^^ed again when the lSth-19th In thc carly 1980s lots oflesbians werc begin­ children were a }'ear and a half old and when ning to figure out ways to have children by thcy were five. Nanette's team is currendy Nanette Gartrell GRGLBF's Annual

donor insemination. Nanette Gartrell, a les­ intervie\('ing the fatnilies now chat the children •-. •?'' for Gay Pricle Indude; bian psychiatrist, -v^^as interested in studying are 10, and this for thc first dme indudes had broken up. Those couples in which che who once idendfa^ as lesbiahs Me now in­ Pride Parade Wednesday, July 15 mothers had spent rime away from thc chil­ volved niirfi a>cn; a lc«^ women have died. But these pioneer lesbians. interviews with thc childrcn themselves. Then ARI^ Gay Bingo Night at the Scliool of tlie Arts "We had QO money," she said in accent the families will bc interviewed next when thc dren, ih order to have morc time with each Nancnc has stayed in toudi widi fust about all Saturday July 18th at 6:00 pm Doors open 6:00 pm at 45 Prince St. interview, •*lHit of course none ofthe work I've children arc 17, and when thcy are 25. other, were more likely to still be together than thc wonien fromtiheot%inftt!$ampJe. Ascoi^les at the Uberty Pole ever done has been funded. It*s usually too '*Whcn wc interviewed thc mothers at first, the couples that had been most child-focused. break up and then get mvolved widi new part­ controversial to be funded by any of the tradi­ when thcy were pregnane, thcy andcipaied Now thc team is interviewing the 10-year- ners, Nanette incorporates all these "step- Thursday, July 16 donal sources, such as the National Insdtutes being out as lesbians," said Nanette. "For the old childrcn. "It's vcry exciting to bc inter­ moms" in the scud\\ 'This rneams we may be GAGVs Annual GAGV Conwmmity Center^ Open HtHsse of Heaidi. It's years ahead of its time in terms of most part jthey used unknovTk donors, because viewing thc kids for the first time," said Nanette. the only study that has more pardc^nts at the Doors open 7:00 pm at 179 Atlantic Avenue when such s^cndes would fund this kind of there wsis a lot more fear at that time that *Ticcausc wc have these vety articulate kids end of die study tiian at die beginntng!" 5 she research. We decided if we u'aited for funding somehow the state would come in and take the who arc highly educated aroimd issues of di­ said. Pride Picnic versit)', racism, and homophobia." Friday, July 17 agencies to get over their homophobia to fund childrcn away. By the time of thc next inter­ More information about die study results Breali a Sweat fdr Pride this study, we'd bc waiting another decade. So Doing longitudinal research is not easy- can bc read in: Nanette Gartrell es al. (1996), Sunday July 19th at 1:00 pm, views, when thc children were toddlers, many Co*Sponsored by ESPA, GAGV and COAP we went ahead and funded it ourselves." of them regretted this and v-Hshed they had When Nancnc had a flood in her basement a "Thc National Lesbian Famih' Study: Inter- at Genesee Valley Park Nanette's study is now thc longest-running used a known donor who could have parrici­ few years ago, some ofthe file cabinets got wet. \iCM's With Prospective Mothers." Atttrrican Doors open 10:00 pm at Muthers study of lesbians who had children via donor pated in thc child's life as a father. Lesbians "I was frantically using a hair dryet to dr)' the Jotirrtat efOrtteps^tdtit^^ytAntne 66, number 2, Alt proceeds benefit the Gay Alliance inseminadon, that we interviewed even a few years later had pages ofthe interviews so the data wouldn't be pp. 272 281. of the Genesee Valley Saturday, July 18 "It's already been wcU-documentcd that kids begun to use knouTi donors. We actually lost," she recalls. Nanette phones all thc fami­ Bsthtr R^thhittiN is Profrssor of PsyctHtit^* at the fst Annual TeamRodhester Golf Tournament of lesbian moms are healthy,*' Nanette told mc, stopped inviting new participants in 1992 be­ lies each year to see if they have moved, so she University of I'^nrtmnt and Editor o/'Z-iv Journal of Tournament begins at 8:00 am at the Woodcliff Lodge won'tlose touch with them. A couple ofwomen "so we're not trying to re-establish that. VC'hat cause the 'old' lesbians differed so much from Lesbian Studies. Resort. Call Leslie Apetz at 482-9356 to register w^e're interested in is how thcy have coped with thc 'new' ones in terms of donor identit)-." homophobia." At the time, Nanette's major Not surprisingly^ the children were vcry Gay Pride Storytime for Young Oilidren collaborator was living in Washington, D.C. much desired. VC^en the leshians were first and Nanette was living in Boston, so they inter\newcd while pregnant, about half thc 10:00 am at Borders Books, Music & Cafe began the research x^rith lesbians in those two women were in coupled relationships, and had Gay Camping at it's Best ^ties. Then Nanette moved to San Francisco been unth their parmcrs from a few months to GAGVi Gay Famiiy Outing and induded lesbians from the Bay Area. a decade or more. Others werc singic mothers. 1:00-4:00 pm at Charlotte Beach near the large pavilion The first step was finding lesbian mothers to When Nanette's team re-interviewed thc participate. Nanette's research team adverdscd mothers when the children were a year and a 9S35 OLD STATE RD. GRGLBF^ Cultural Festivai in bookstores and gay and lesbian newspapers. half, thcy were not surprised to find com­ Following the Pride Parade at the Village Gate At They made up flyers to distribute at lesbian pletely exhausted, harried mothers who had ANGEUCA. NY 14706 films and community events. They went to all ver>' litde time for their own lives other than the ^or\cs\\op» on choosing childrcn and told childrcaring and paid emplo^Tncnt. One ofthe parddpants about thc study. Thc ori^nAl study areas of difficult)' was thc iittJc contact wirh began with 154 tnothcrs. their partners, and this was often a source of =^^one: "^16-567-3100 The first interviews took place when the tension. By the rime ofthe interview's when the Call the <;AGV at 244-8640 mothers were pregnant. TTien the mothers and children werc dve, a number of the couples CAMPGROUND JCNe5PCNC©HCTM^lL,COM Leam Meadowview Campground & RV Park A 3-MrGHT "^TAV BE ONE OF THE SELECT FEW TO HAVE A at Village C3*ate Square lM«le4 ie MMlM#e. r«i. (TITJITS-^MM AT JHE:Ci..r^C1[^F-(.,i-L MON^ REAL ASStSltS CSLASSaS C8 WttAks): TO THIS YEAR'S GAGV PRIDE PICNIC •\:ck\j\ ' ^'1 •;• Beginners: WedJiesday BTl^ts 6:S0^:30 WHAT A $100 RAiNBOWPASS ENim.ES YOU TO: Intennedlate: Satxurdaar MontlnKs lO-lToon t ••' 1; ! i '-t. ?- V • 2 GAGV 25TH ANNIVERARY T-SHIRTS XZBS tSLASaXB Csee li^low): V 2 BEVERAGE TICKETS TO THE PICNIC WHICH Monday through Friday INCLUDES 2 MUGS JBiy6'io JtoyxB'iT jfBiy«o»»4 JTciy ar'9i V 1 LIMfTED VIP PARKING SPACE NEXT TO THE ROUNDHOUSE (INSTEAD OF THE LOT ADJACENT TG THE PARK) Wlm0 to buy your Pictiic ticitBt: • to ENTRIES IN THE RAFFLE DRAWING FOR THE 3-NiGHT STAY iN MONTREAL Anthony's 622 • Avenue Pub • Muther's • A USTING IN OUR AUGUST EC THANKYOU AD Common Grounds • Pride Connection miATAtSOTtttAtttSLttPASSENTtTLeSyttUTty. Tell in *3 Bacheibr Fomm • ChJb Marcella • Tara's • 2 BEVERAGE TICKETS TO THE PtCNIO WHICH Sign: Rochester Custom Leathers INCLUDES 2 MUGS Slikwood • SMce of Ufe • PartdeJgh V 1 UMTTEO VIP PARKING SPACE NEXT TO THE Atfk alxmt Thm Vrldajr VooasktAmm Stovy CXlvbl Rochester Spa & Body Club ROUNOHOUSE (INSTEAD OF THEl^f AaMCerr BRIAN AMBROSE Mk TOTHEPARK) • 10 ENTRIES IN THE RAFFLE DR>MM(NG FORTHE & Associates %^ SSmdStTlntdmnea $BatHt0U^^

WE NEED YOU TO VOLUNTEER AT THE PICNIC. CALL 244-8640 I.-'

I

Rescue Who?

ByKeiiyJU>bcl Rescue handed out religious pamphlets and Oisney tops the encertainment fbod chain. Ask "ministered" to gay visitors at the Magic King­ Ellen. Ask Flip Bcnham and his pals from dom; protested two Bames and Noble Book­ Opcradon Rescue. They demonstrated on June stores, and picketed two family pknning clin­ 5-7 to protest CJay Day at Disney. ics in Orlando, Fla< Orange Co* deputy shenffe Fm no stranger to Flip and his friends. I stood by in riot gear. lived in Arkansas from 1985 to 1994. Bill Flip Benham says that it hurts him t(»tl>mk Clinton's presidendal campaign and the first of people "shakif^ their fists at GodtJ* What year following his elecdon resulted in a swarm really hurts Flip is the nodon that Americans in of visitors to "Arkansas: the Natxiral State." growing numbers support civil dghts for gays (Aduuisas used to bc called the "Land of Op­ and lesbians and support women's access to portunity/' but diat is the subject for another reproducrivc health services, and that book­ column.) stores offer children and adults the tools they Most memorable were the visitors who need to think crirically about issues facing our helped us understand the linkages berwcen society. issues. First, Iitde Rock was targeted by Rev. It hurts me to think of childrcn entering OtwcU from Texas. He and 40 ofhis followers Disneyland and WaltDisnc)' World subjected picketed first CJovemor and then President­ to the Flip Bcnhams and those ofhis ilk. But it elect Clinton's home church. Thcy targeted hurts mc even more to think ofthe children of lesbians and gay men, people of color, doctors the demonstrators — children that are gay, who provided family planning services, and lesbian, bisexual, transgendered or question­ people lix-ing with HIV and AIDS with their ing — learning to hate themselves and learn­ wrath. For three months, Sunday after Sunday, ing that to love they'll have to leave their wegathercd lOOcounter-protesters across from families. thc church. We were subjected to taunts and As a recent report issued by NGLTF's Policy physical threats. Worst ofall. week after week, Institute indicates, the rate of disapproval of we watched the children of Otwell followers homosexual relationships has dropped pre­ hoisted on top of coffins and encouraged to cipitously over the last 10 years. By shining a shout AIDSphobic chants. light on our families, Flip and friends provide By the time Flip Benham, Operarion Res­ us with a tremendous opportunity' to do what cue, and other demonstrators came to picket our communirics have done best — educate and block entrance to fanuly planning clinics, those around us through Uving lives based on "WC -were ready. W c Vubd molded ourselves into love, respect, and accountabiUn' to our com­ the Arkansas Libert>' Alliance, a coalition rep­ munity'. resenting sodal^ polidcal and religious organi­ ^rty I Jibe! is Executin Dinctor of the National zadons. Wc had hands-on traimng from the Cay and lesbian Task Force which has narked to Fund for the Feminist Majorit}*. Some of the eliminate prejudice, violence and injustice against gay, most ardent foes of women's right to choose ksbian, bisexsial and transgettdetvdpeopie at the local, were on the scene. Randall Terr\', Joseph state artd national level since its inception in 1973. As Scheidler and others attempted to divide our part ofa broader sociai justice ntoi'tment forfretdottt, town. Importandy, few people took the bait. jttstice and equality, NGLTF is cnatiitg a world that Most heartbreaking were the scenes of chil­ respects and celebrates tbe diversity of human e>:pres- dren yelling threats and taunts as we escorted sion and identity where all people may fidly participate women to dinics for famity planning services. in society. Moving fast forward to today, Operarion

Disney update: few join Operation Rescue Few people cumed out for Opcracian Rescue's protest at Walt Disne)''s magic kingdom in COnHtKClAt^ Orlando. Fla, on June 6. Reuters, Associated Press and thc Oriando Setitinel tcported that only around 200 showed up for thc anti-gay group's demonstration against the annual 60 Browns Race - 262-2700 Disne>- Gay E>a>-s. Mean«4ule, Reuters said that an estimated 120,000 ^ys visited Orlando and Disney Worid. "In spue of all die hoopla, it had the feeling of a ven- normal day." said ivBL tsmmEs Overlooking the High Falis Gorge Disney spokesperson Bill Warren to the Sentinel. No arrests were made at the anti-Gay dap protest, although a fcu' people were arrested on various charges during the related protests staged by Operation Rescue at local women's health clinics. -GLAAD 1^ 00 rr Across from Kodalc or) State Street vmiour anoKn Please check Frontier Field events special hours Open All Vter Lunch Mon.-Fri. 11:30 a.m. • 2 p.m. KEN SALTZMAN Olnn«r Mon.-TTiiirB. 6 -10 pm Come oisit Roche^er's APAINTER Fri. ft S«t. 5 -tl pm •iiIlK^ Reservatkms Recommended newest altematiue in ittuque FREE ESTtMATES tm Oonmoaha Atumjts Ammbh home furrdshings •Vt •••.•^'... r ' & decoratbte accessories! f 2. •Mpjm. •"!'.. '.'II '^V''f'^-.-i-;'l^.'''''4r^"'T^''''''"''' -L_ ^ -^rj,, -."*>, ^-^^..ii^' 3. 1 ^< •' 4> 1M4 •- vr--

ir=::*I"*r)-3-.'-«*-»*r'. 1.111,11.1 Ull 1,1,11• IL nuKijIllilWI."'! nwiiiinj,iiviiy H.I, "'"^'"J' "'lj;fe!"s!"'^"i.^'-y''""^^'^'^S^^5^

•f-4 Pride Parades C" vf-:.^ • • ••--'• • - •••'••• •• -* • celebrate Pride?

fByB3fn thoi^k wm a Greek symbol for energ)% to pride: Vprid\ ^ (ME» fr. OE pryde, fr. ptttd sytnboJise '^y power." 'proud-more ftrproud] 1^ the quality or state of Wc also have an incredible histor>' to cel­ being proud: «s «: inordinate self-esteem; con- ebtate rig^t here in Rochescer. Rochester is cd£ IM A ceasaiudyc or |tasd&drfe self-respect c: home to the Gay Alliance of thc Genesee del^t or eiMkKi arising from sotne 4u:t; pos­ Valley (GAGV), one of die three oldest gay session, or rebtionship 2s pniiid and lesbian community centers in the United or disdatofril behavior or tieatment: disdain 5 States. This is a fact to be proud of. I believe a: osccntadouJi ^splay b: hig^st pitch: prime diat many of us who have spent several j'ears in 4: a souicr ^jpride: dur best in a group or dass Rochestcr take the gay, lesbian, bisexual and 5: a company erf Hons 6: a showy or in^ressive transgendered culture here fbr granted. Wc gtoup < a - of dancers> {Merriatit WehsSers have a much more open and accepting com­ CoH^aUDirtim^ryy munity than even our immediate upstate neigh­ Every year wc celebra^ pride. Why? Let's bors to the east and west in Syracuse and dunk ablRit this. We are a wondci^idtydiverse Buffalo. Every one of us is able to live our Uves cottimurmy -widi an incredible history to be more openly and widi more acceptance bc* proud o£ Historically, very cariy accounts of cause we live in Rochester. Atth^l9^PrttfiftPSrade homosexuality and to cultural importance ex­ What makes Rochester different? Many striving for a safer place to live, dc\'eloping ist in die love between waniors exalted by things impact our acceptance here on a daily make Rochester a better place to be gay. The relaaonships with the cit>- and count)' go^-cm- Homer in the IHad^m Sappho's lyrics to her basis. As a part of thc Gay Alliance for over Gay Affiance ofdie Genesee Valle)'has touched mcnt in order to have our voices heard, and female lovers, and, later in the necessity and two years now, I have realized that a lot of what all af our lives in some way. So during this offeringprograms to make each and ever)* one beauty of love between men and boys ex* makes Rochester different is thc impact that year's pride weekend, I hope that everj'one vnW. of Uft stiongisr «s individuals. Uus is only part plained by Plato. Tods^ we continue to l:M>nor thc GAGV and its volunteers have had here come out and cekbrate ^-ith us. Attending the ofthe Alliance's accomplishments; but all step­ diis history in our lai^guj^ and symbolism. fior 25 years. That's right, 25 years of giving us picnic is not only fun, but it gives back to our ping stones in the eradication of homophobia. Women who love wonien arc lesbians, which a face in thc greater Rochester community, communit}'. Ifyou cannot make it to the pic­ is derived from I^esbos, Saj^ho's island home. standing up for our rights, advocating for do­ Wc arc lucky. Lucky to live in Rochester and nic, take this rime to become a member ofthe And during the fervent organizing in the wake mestic partnership and equality', raking sensi­ lucky that thc GAGV has been at work for us AUiance, or do both. I'our support is needed ofthe StonewaU Riots, gay and lesbian activists tivity training into the communit)-, providing for 25 ycai^. Wc all live fuller lives because of to continue our work here. adopted the Greek letter lambda, which thcy safe space to explore thc coming out process, it. SoJct's take time this summer to celebrate Our community* has an incredible his ton-; pride. As a cotnmuiut)'^ wc arc utiiting to bring let's pufl together and celebrate Pride like we Rochester the Ptide Celebration that we de­ have never done before. Come out and honor serve. For the first tinac we are offering five the 25'\'caT anniversary- of the Alliance and daj-s of events and wc hope to only GROW what it has accomplished for all of us. As Pride from here! acti>-isf Cindy Archer stated, "Pride is the op­ For the Gay Alliance, the picnic at Ocncscc posite of shame, it lifts people up and banishes Valley Park on Sunday, July 19, is our largest fear. Life is too precious and short to live in fundraiser. This is thc event that has funded fear or shame." I think we O\A-C it to ourselves thc Alliance for several years. Thc picnic has and our communin,*. kept the doors open at thc Alliance in order to iGm Brumber is l^tce-Prtsident ofthe Gay Alliance of the Genesee I'^alley. Wednesday, July 15 School of the Arts prizes Boors open @ GrOOrpm Bin^o starts @ 7:0aJpTa

Seatmg is LumTEDi otkah aD]y...aony, jto ahmska mco0pt9di Call the BINGO office @ 442.2220 for more info ajid to reserve tatoles for groups of 6.

ALEXItDiyiS i. SAMSitSSOOMTE aaaiiw<

•.(•>'it- i WMjifrsmmmm

^•>;'

•^'*' ^.iwi>.wi.??i».-• ..-Tiimj.-^'.rrnr- - - •• ".• • -yv^i.

tb^a ffl^lf^^^j!!^'.jj^--'>i""g.^'-.-! •''••'• '•'I •'•''IK.*' MP TV C L p S !• T TATI X

Oa WttMHIP MtfVMC* Sundays, 10 8.m. mUAK^la»ml^fmiM»f«SM

fSinrdi of CoMHiM^ui 3(a4Cocl«yRbiR! 2 Summer f unr^rGiJ^rS 71fif39S^t^0 Eyewear that inspires! Natt9OfRteB5&20,}iistYMlar Eye exMns available by appointment CanoMttgua. Preferred Care and Blue Choice eccepted

IS tn eyewear ^j[ tlOO S. CHa«ea Ave (a44-iS4B x97«) 8300 «V. IM«« M (7«9-i«MI) ^flitoa? Experience tbe veirsatHity lnlv2o-7flni ASofebyDay • ABedbylligiit

Freewheelers PROVINCETOWN E"*^. .y BICYCLE STORE & REPAIR CENTER * Wf ect Booking Service • Irxfividuals i Groups • No Fee for Our Services t\ m-t^^t/. SERVICE EXCLUSIVES ONfCALLDOESITALL ^s^^^V 508 487-1863-fex: 508 487-6140 SSife "^ cmble bikcj from scrofch because focfory o$»cmbly 1 800 87P40WN * ifftfownres9aol.com proper lubricofion, alignmenf and inspecfion. IN TOWN RESERVATIONS a new bicycle mA receive Iifefime free moinfenonce. -Ji' rfftamwandftiiwM'a V. ^•.•U:•^tv•-• ..'V In Rodiester Jl < pm in\ .• i[i a I ; wi^^.or:r mM(^ **1 FREEWHEELERS SELLS

•-.-,•• *^ • • TERR/ PRECISION BIKES FOR WOMEN - SPORIS EQUIPMENI THAI f IIS MicltQWTrPlaza -vnaFlQor > :5?5-7310 '7ristv/ntinat.imi andiftie to fi7e.^ IRON HORSE > NORCO " SIOWE > MIS KONA BlCyClES ARE NOV IN STOCK! 1757 Mt. Hope Avenue ia.^xt to Ro«ePhoVo) Want a date? Find one at Rocheslei NY 14620-716-^73-372^ JHh $l>!}|nii., the MANBATfr tea! t.. . . • r Friday, Duly 24 >1P «« •^ •^m TgP ^^ Rochester Costom Leathers |#. Village Gate 7:cx> pm - 9:00 pm '^"tl^J-^ I^GapdeR Store Bring a Friend! » $5 Admission pF 'T lllii At Ted Collins ^OHH^J^Tree & Landscape 8000 Victor-Mendon Rd., Victor, NY 14564 • 381.90«W924.7105,«rt 33 Summer Is For Gardening • Fine quality Chamber's planters for your paUo, deck and gwden. • New perennial area. 100s to choose fixwn. empl^fees? • Wide Assortment of top quality nursery stock. _*: - , . • We deliver for you. Call In your order, have it de&veftdtolfour door". • Bulk Mulch. Don't delayl Call now few ddivery. ••>- Deal • Green Bonus Card. Our p<^ular program contiMies. Eaeft flireatsavings ! -.IV thtt vnlte sittiiiRi at Ite Ulte 'Dtbveryfe, applied. M«nt>an thU .d,, ««*« 10* ««»«rt — «**«>« puietaw* BEteb CM te pucteseil tt Your Store for Cafl lie. Nil €MMIM P8 SMi JhHi^ Value A Service >••- ^^ RMIMV Mip iMitt dNIirt Gl^ SM9- »'fr for^ymtir -K- '^^"^fc-vV-V •*-... ; ' W^emt^tmlM-^m^mffi^^tke ''•:''ti__^ ittlteMllittfMMHteMiMlB^rnilViNMiNL

iiPiliAMlfeiJrir Uni iiii IMBVPbiki iWhrMlMMrf&iniii Jl7tl-271

Proceeds from^lw AIDSWalk wilt be shared among local AIDS organizations. inCww^..^, Catholic Charhies, Community Health Network Elisha House. The Connection at St. TOASTBNG THE TOWN: Above* Toronto's Singing Out performs at the Gay Men's Mary's, the Health Asssociation HART Program, Mary Canola Children's Center. Men of Chorus concert. Toast of the Town, with the Rochester Women*s Community Chorus. Color Health Awareness Project ^^ at Cobbs HUl Park. A celebration with food and live music followed the 10 k pledge walk, organized by AIDS Rochester..

•J:

The concert took piace at the School of the Arts on June 20. '^•"'\ tht>Bf'>f.-ji'd At^r-iiv*.' IS ''\e pr-'-,'.- to c^o!. will be so nice to yen!

Gov Kk l.esbian Pride Month in Rochester! IVe lmv€ prtmdiy spotisored & supported our local cottimutiity orgauixations atid events includittg: AIDS Rochester Community Health Network AIDS Walk Sponsor 96, 97, '98 Rochester Gay Mens' Chorus --i^/ (;•;:. •v*-\ icnti" Gay Bingo Rochester Freedom Singers HPA - Dining for Dollars Rochester Womens* Community Empire State Pride Agenda Chorus A NE^^ PERSPECTIVE: A new picture of thc AIDS virus as it invades ceils, courtesy ESPA Night of 100 Parties Tim Mains Campaign Fund of WOKR Channel 13. A new study has revealed more detaUs about complex protein gp 120 GAGV Picnic Image Out - Rochester Gay & and how it ''uftlocks" the celt. The new information may help to block the vims' access. GAGV Winter Ball Lesbian Film Festival Rochester Gay Sr lesbian QK.£^T. Bowling Tournament Sponsor Cultural FesUval Womens* ScrfCball Team Sponsor Mocha Project Womens' Volleyball Team Sponsor Greater Rochester Gay 8r Lesbian In Thc Ufe - Local Underwriter Business Fbrum

'••/•'; -Cj - Lots of rt**^ ^ M.l V I : : \ t . ^ vMv . ! \ ; K \f \ i 1 \ ^ t> Ll i^: IMI ^gs, accessoile* 242-7840 -»#- t

•'^^i'^^^L^ 728 South Avenue •Aw- ' ^fldrt.-Sat. I0am-9pnrv, Sun. 12noon-6pm Unhprse Queen or the Galaxy** on July 22 at Club Maixdia. v0|^ •'••;v-v. •'••"•"'• croipitd. The pafeant begins at 10:30 pjn.. and witt feature fUMtt r'J'--.-••?"''^•••"•'• auMlJMhlo's Aimant. who recently made the top 10 in the Mia USA reM^wdons or contest Information. caH 4S4-5M3. •. - •. • - /'•li- . •, ."^ •-'-. ^v;*^ ^

W^ -.-«IMK>»«*W;4C

am

**.•.*•»• ;***%• TT.-.-,rT<^,,,, "• • *t»t* *»••«• tt*« •* ' f ;• -f

.•:vyr:^*i.>>-a.' PAGE B5 PAGE BI2 Columnists Gay Groups • Farewell to Tom Fronczak and B Lambda Car Club Fingct Lakes 7i* Atttbetttk Seifi welcome to chapter holds its Classic Car Bruce Wilbur's The Scettic Rottte. Show during Pride events.

PAGE BI8 Calendar PAGE B3 •4' HAVi YOU «eT THE «©DOK Share it with the restof thegaycommunity! The • Pride Parade, GAGV Picnic, Check it out % fempty Ckwet IS ahvays lookingfor lnfermatk>n regarding evema and socW ac^ and ail the other events of H Book and nnusic reviews. you laK>w something, send it to us! Subm^sk>ns are due by the I Sth of each month at: Pride Weekend 1998. \ '%' The Empty Closet. 179 Adantk: Ave.. Rochester, NY 14607-1255; Or caH 244-9030.

1 Jl ? ^f*^^ -.^ir<^^' ^^^^^.T^^r^yf^^^^^ ^ '^'*-^ J-: c a N

Coftting up... a possibilin-, a hunk) soap opera star enters the fray, and the sexual and Blackfriars verbal sparks he creotcs throw a WTench stages Sumnner into their ncvfound romance. At the same time as rhe couple tries to na\n- "Camp" plays gatc their new romance, thc wedding slowly becomes enshrouded in chaos: Blackfiiftirs Theater will present Stun- sexual confusion, madcap moments mer *'Camp/* three comedies in ro­ of manral tension, nnd mns of alcohol tating rep, from JuJy 10 to 26. ensue until nil chnos erupts on the The Queen of B/rrgo, by Jeanne couch of thc bridal suite. Michcis and Phyllis Murphy, ex­ / TIjifik I Do boasts snappy dialogue, plores thc bingo adventures of t^'o giddy romance, and the one and only sisters over 50, and is directed by Alexis Arqucrre, who h.ns recently tit­ Ken Higgins. Thc performances will illated audiences \orh his wacky per­ be July 18 at 6 p.m.; July 19 at 7:30 formances as a melancholic Boy p.m.; July 24 at 8 p.m., andjuly 26 at George impersonator in thc main­ 3 p.m. (This sounds like a natural stream film Iht W'eddiii^ Singer^ and a for regulars at ARI's Gay Bingo teenage girl in last yearns runawav fes- Night.) ti^al hit. Scream Ttnt Scnam. Me afsd Je^^My hy EHzahttth L. Tickers for each show arc $10 and Fuller, directed byjohn Hftldoupis, will bc avail.ible at Tiie Pride Connec­ traces Fuller's true^fi£e account of rion and Silkwood Books. Tickers will the time in summer 1985 when Bette Davis came to stay For th^ night, also Wc available at thc Littic Theater on tVvt tX^vy t^\ T\"^C scv^uTA^n^. and ended up sta>ing^uzM>flth. Cau­ tion; strong langua^ (Bctte swore "like a trooper," it seems). Fasten CLV presetxts your seatbelts... The piay will run July 17 at 8 p.m.; July 19 at 3 p.m.; Cytron/Reagon July 23 at 8 p.m., avfed July 25 at 6 concert, women's p*m. . .'• . Psy^ha Beach Par^^ by Chaiies dance in Seneca Busch, directed by pmm Gen^, is Falls July 17,18 •'Gidgct crossed u'ish IU I^ttmFitttFS tfEve and Mtmtmie Dmm. Ifjdiivft Seneca Falls injuly will be a whirlwind Enjoy the view of downtown Rochester whik easily offended this is not the play of ^'omen's evenr;, including an a|>- sipping a cold refreshing cocktail. / for you*" It wifil»e ps^Msnced on July pearanc^ b}* Hillary- Rodham Clinton, PS: tt's the best cruising spot! 16 atS p^.; July 18 at 9:3Dp.m4ju^ and a perfonnance h\' rhe Rochester 25 at 9:30 p.flft^a«>d Jfrfy 26-ai7a0 Women's Communit}' Chorus. The • ...BLOU/ OUT! pjn. Coalition for Lesbian Visibility, Adult Aitemative Retro Dance VJ.P.tllNh4PMfEf FROZBI Show )«i»r^eahi-enjeY i hour Blackfriars Theater \^ locaied ar founded in Seneca Falls in 1995, laill Pance 10pln^2am open bar 11:30pm-12:30am sponsor a women's dance and a con­ $1.S0 Rolling Rocks 281.Awn Sc and is air-<:ondidoned. 5pi 2forl£j^ $1 Rnts All Night cert by Sara C\Tron and Toshi Reagon. 30f Chkken Wings TECHNO 10pm'2am "ndpets arc JIO. For reaervadons» 2 fo|;;$ v«iei|fuom 10pm-2am with DJ T R.T, call 454-1260. C\tron's humor and Reagon's mu­ OJ Samnvy DJ Damian sic wiil be featured on April 18 at 8 Inru^geOutto p.m., at the M\"nderse Academy audi­ ond Tea £3^^ 14 15 "c torium, 105 Troy St. in Seneca Falls. Adiklt Aitemative screen two films .y VJJ>. HUMP NTTE! Dance Retro Dance Advance sale rickets arc $15, and are Tea Dance '%^ 10pm-2am S^tt>wyo^Mt4y available at Silkwood Books and the 30t Oiicken Wings 2forl£?lSJs fl Pints AH NigM Pride Connecdon. Tickets at the door « 2 fbr 1 Well/Dom % After the successful scfcemro of DJ Sammy 10pm-2am with DJ T.RT TECHNO 10piii-2am ^iUbe $18, if avaiiabie. DJDenmii Firs at Geofge EaatmaA Hooae last Thc Mt'omen's Event dance part)' T:\'t I.miiaieir>• IIix mondi, ImageOut is hok&igamMher boch in a shrnip. Kira's aspirauons to be a^^eet will be held on Juh' 17. Onh' 250 rick­ GAY PICNIC 19 20 21 22 m,mUm:^ 25 fundrftiaer on Juiy 2^ to lEi;9pqnidbe cant inr chek Uves. A raucous film that bridges TEADANCE UESBUW AUNT OAY. conik are ohdercat by her sti^ fright^ 4kwk- gpps between sorai^t and queer. Smm Ptt^ ets wiH be sold, so if \'ou are interested, Adult Aitemative VJJP. HUMP WIEt CHRBnMASII wedc-Joog festh^ in Octdtkcr. Retnember last yeor? Atiewhtmmtfm0 Sfcowf ypur cart mjog t hew troua open nyc outings, and her suoceasfid GeA^a high encigy is supported h^ a unique caB CLV at (315)568-9364. Dance ywksbktttautmktmtt^ Y^wewihhaittotteet ImageOuc win screen two films pocket^, pocked, packedi $1.50 Rolling Rocks epcfl Mr TK90pin-i2:30m comedacnne sister, who pilfers all of Kin's cast c^chatactefs: a love-starved cafe owner, a 5pm*Mtdnight your own tkrftnwl $1 PlifC^AIINkM DITJtT* at dte little Thcacer for their exdu­ 30^ Chicken Wings $l:4Wftte Al NigM matetial. To maloe umtieis more compAicaeedy IVehdirchef; a new-age roommate, a sialicer 2 for 1 WeliyDom 2 fori - 1ECHN01Qpm-2Mn 10pfii-2am sive Kodiester engagements. Don*c 10pm-2am «tf TAT. to ovetahadow her career inadeqoaoeSr Ksra wtlh an oral fixation, and a woman obsessed DJ Sammy Retro wrth DJ TJftt fiiDMnien n^M dke o^>ortuni^ to sod Smm atted%its to skep with as i^any >oiii Hfaafl^j|t;fi9s^^ dso rftOaie^ Tea Dance Adult Aftemative Retro Dance atTofoaio's Dance 10pni-^2ain iMdepmLeaMHi^i^^ and Video Spm-Midnight - ir^r t^'^'.- Aznesen, waa fer4 Ci/. , K M f advenl^nit «id inaeciiritics of Kfra, tc's * W'Pi^g^lgk.jLMn comic andSydney, Vwhcre it AND OVER ONLY WITM PROPER I.D. • NO COVER CHARGE • SPECIAL EViNTS $3 COVER INCLUDis ARST DMNK FRK (WBI tk DOMBfld Itltiatkn^, ^^^ *^l?'%b^ food-obseaaed best Musicikn Toshf Reagon wW perform wtth ^>end.Kifa's and Sydney^ livea ase - ^^ Just when the ex- -r^-^^ kciafdipor' fobmmace^ think a luiiSiiite berwcen them is comic Sara Cytron In Seneca FaHs onjuly 18. ^"^i~T\*|lB*''-3?V;i

v^-l-ffef J-'b.d^ J^^A^ M P T V C L 0 S K T B3 abottt ivhat we should call ourselves. Guys my "You have to take ri^ts; chey don'c give been broadcasdng re-runs of che show every *60s v^ith Joan Bacz and Janis Ian, and soul ried Constance lioyd as a nise to gain social j^^foeaX^^ chem to you." Moodi^naght at lO/Why is blue-collar Buffalo. Wikto continued firom p* Bl M^th che legenckM^' Glad>'s Kaighc and che acceptance in 1884. llie lesuhwaaiii initiaBy awate^oaeiaiHB aJnUt' whji(& you> wjooU diiiak ts k»s gay-fintocSy than eternal Tina Turner, to the hardest of rock actor Stephen Fr>'—a dead-ringer for the real tranquil marriage of convenience dutprotduced that siMft tnan %cise hie» ao4% hiitt^iove yoo. I^ Rbidlester, ^kilcig what WXXI in Kochester with jTanis jof^in. Grade Slick and (I would be Wilde—embues his diaracter with a complex two sons. In ITSUr, Co^acance ia skillfully teal* privfli^ of ^dte 'Bust dteirgasket about otfaers littcEk anything dse under heaven really mat­ seems afraid co do? I wotdd hope chac peole here remiss co leave out) the Queen of Soul Aretha blend of excess, gendeness, masochism, and ized by Jennifer Ehlc* Hiov^ EhlcV presence perity* fairies or qucer^ because for ters?" will not only wacch ic buc also make it a prioric)^ Franklin. Along the way there were die groups enigma. Wilde once quipped that one must is intentionally dwarfied by Law's, she cKmethe- Ihe final acenar were pejoradve labels. Bttt I say, -Jamea Baldwin, Wdter to support this program, which is che only na­ LaBellc (who gave many of us our first French ^•.^ *•?"•'•-•••• - •***";• "• ••" ••--.•• ^^ •• •••• -I ~ •'-• ,r- 'treat all trivial things seriously and all serious less manages CO portray Wikfe's meek wife with funous vii«er every man call himself what he donal gay TV newsmagazine." lesson) and Fanny (who sang the virtues of things widi scudied triviabty." Throughout genuine sympathy and accurate understacemenc ReadioglSM^ iieedom to choose our idendty, The show ulrimately ht^>es co go monthly', if "Butterboy" in the 70s). ' WiHe^ we see a man straggling co live up to his Similarly, Vanessa Redgrave gives a thorou^y onerCJ^' aio«yi|^^label —if at all — is really whac it receives eitough stepport from individuals IfKace Bush was the Godmotiier of ^('omen's own words. The studied indaflEerence widi convincing (albeit brief) perfbcmance as Wilde's undcrwHti&s *^ln the he was aod the evt qSiilc iJBto fig^cing for, wasn*^ it?^ across die country. For informadon call 1 -800- music, then thc brilliant Paula Cole is the \diich Wilde defied bland and often oppres­ suffbcacingty enchusiascic mocher. who Oiice -WjMtittJi igj>, Busineaaman Life" newsmagazine 626-ONTV, or concacc wwwinchclifetv.org. Granddatighcer. The 1998 Grammy wiimer sive social convendons is amply displayed Much as been written and debaced abouc icy now eefieet* leave che hetero wodd because Phi! NOsesko, owner ofthe Pride Connection, for Best New Artist was bom and raised in diroughout the film. Nonetheless, Fty*s Wilde whether or not Wilde actually was a mart]^ for tunes. people fike yometEl It's leafy a so well. Then we come inco thc is die only local onderwnter of thc N.V.C.- Rockport, Mass., the '*Bechlchcm" chat she docsn't'mucatc inco a polidcal mouthpiece for the homosexual cause. Scholar Claude J. Sum­ "Why is it that ooeiuta to ooe'a miti?^* cause iicKfaiflg ts ever going to get done as kKig •md allow others to define who we produccdgayTV ncwsmagaaanc "In die Life," Night Music: sings of on her ground-breaking CD//t//*/^r post-Sconewall queer polices. Inscead, the ac* mers has put che matter into words succinctly: ^^Ide ^Toce in Ik Pt^imdiit hta h0fjk4BQ^ aa tPe tear each Odter t^.** ^ Don't conform; bc yourself. There shown on WXXI, che Rochescer PBS scarion, Thc former prom queen graduated frcmi thc tor allows che witty, charming, and certainly "Wilde's disastrous decision to prosecute are frorti Kate Bush to prison letter to Bosie. What makes IPS&k so <^^^pde HsA» AtftmKsy/Ma^fctOMUe are ouB^j^ianaAy flavors ofgay life." every ocher mondi. Berklee School ofMusic in Boston, where she pompous man to bc a human being, one who Queensbury for alleging that he posed w a compelling is chat it boBiamly densooatraves '^ hate chatge role models ase supposed CO -Miiiill Michael, Clinical Psychologist Misesko said, "Almosc no one was vi^atch- Paula Cole smdied jazz singii^ and improvisation. After uses language as his sole defense against igno­ sodomite was itself reacdonary rather chan be jusclike strai^pec^^ As if atraig^tpeople che probletns that occor when one's nature and i^jjiiiaii Hiking Giddb ing it, probably because ic*s bi-monthly^ and By Savannah gradauarion, she^'as a tiack-up singer for Peter rance and intolerance. defianc.Thac he did noc go inco exUe, as so weie even like diac." dictates self-deatrucdon, "Evesy dme wc kiss/ because WXXl broadcast ic at 11 ^30 or mid­ Whac people call'Vomen's music" is many chings Gabriel on his 1992-93 world tour. This would But such defenses were rendered impotent many prominent Victorians had done when -Paul Rudokk, Wxiter (fironiy#F) we coii&in the new worid coming." night, on the first Sunday of thc month. I ~ quirky, odd, arcane — but never is it dull or be the door-opener that ever\- artist needs. m the pfesence of physical beauty. Wilde had foced with the prospect of scandal and prison, fioolcievlewr ''Moscgm'saffectatdtudebecausedicythiak -BaaekHemphin, Poet made that point when I spoke co WXXI co sloppy. After breathing the polluted air tiiac arose Her songs are the voice of pain that preceeds a hankering for yt^ung men, whether they werc is a measure less of his rebelliousness chan of its atoracdve. But atdtude is /tetvr atcracdvc. "I aul oot a beginning. ask to become an undetwriter and to move from thc testosterone-driven heavy metal ghetto, redemption; they are the fire of emooons that rough trade or spoiled aristocrats, such as his his felt need to maintain his position in sodety. 425 gay men estpiain Work on your o^-n insecurides instead." I am not an end. thc air date to thc second Sundav of the Kate Bush, ^iiom many consider thc Godmother arc deeply and fiercely personal, but yet uni­ most infamous conquest Lord Alfred Dou- Even thc eloquent defense in his second trial of -Mitchell Gaynor, Gardener I am a linic in a chain. month, which should improvethe vicwcrship, of what was then an embrj'onic musical style, ^-as versal. Her guiding light is a statement by thc f^a&. By now acknowledged as che primary 'the Love thac dare not speak ics name'... is it ali to you... Tind >x)ttr voice. Whether it's deep or W^ Tlieiitet^h of which depends oti my own jusc because it allows rime for awareness of a true breath of fresh air. great poet Pablo Neruda, who said, "to explain i^entin Wilde's ruinadon, Doug^ (nicknatned shar^ undercut by the fact thac the speech, By &ia«n |ot4«t» J§hu^i$C^/,hy Ken Hanes-Three Rivers Ptess, doesn't macter, being authentic does.** contiibocions, as weH as dte contriburions of che show to percolate through che gay com­ Unlike her brothers who called ^emselvcs poetr\' is to nuUifi- the purpose of ics exist­ Bosie) is plaj'cd in Wilde by the androg}*nous latgely untrue and certainly miskadifig, was 201 RSOdiScNewYorkN.Y. 1002Z192 pp; •^ffichaei Keansa, Actor chose before and after me,.. When I am aware munity.'* "Mcgadeath" or 'Whitesnake," Kate Bush, %-ith ence." Like the powerful thoughts expressed Jude LAW. Perfecdy cast as the toxic beauty designed co deny che physical expression ofhis paper, S7.95* (To older inen): "Accept that I might want of this unity, and refiise to let my self-doubt Misesko said that "In thc Life" receives no her air of wonderment, appealed to the highest in this simple statement, she is a woman who behind the "gross indecency" scandal, Law*s homosexualic}' rather chan co defend ic." The hallmatk of the poor hook tevieu'^ is a your friendship, your advice and 5raur and lack of self-confidence interfere, it is one funding from FBS and all their funding comes common denominator. She was Rhiannon in­ answers to no one. presence is at once so sexually riveting and In light of Oscar Wilde's somewhat murky plethora of quotes, but chis particular bookie^ mentorship uidiout wanting 3'ou to fuck me. of tl^ most wonderful feelings I've ever expe­ from private donarions. "ItS a tribute ro their carnate. Her songs are like thc moming sun as it exasperaringiy selfish that any s>'mpathcac status as thc forerunnerof gay liberadon, Wtkk S^akit^ Ottt^ consists of nodiing else. Play­ And don't cake that ns an insult." rienced' Iam a necessary part of an important commitment that thcyVc survived on a shoe­ bathes rhe world wich heaJing warmth, calling viewer migjit vcry well see thc reasons behind Tin:c moved along, and women became more doesn't intend to hide its subject's h)*pocrisy. wright Ken Hanes, author of TU Cay Ctty's -John Soiberg, Label-Free search to which there is no end." string budget." ail things to iife, and because of this, we arc all Wilde's doomed fixarion. and morc the focus of popular music, in all In a surprising!)' sober courtroom scene. Fry's Gwdetol^ttnd TbeGayGtiy'sGttidei9J..i>tfe,\m% "live ttith a lesbian so }-ou team that petiiaes -Kel^ Hiring, Ardst He added thac the Buffalo PBS scarion has phases of music, from thc folk revolution ofthe better for thc experience of hearing her. Thc film accurately documents Bosie's ex­ Wilde defends his acdons in terms of'*a greac complied a coQccdon of comments firom gay don't rule." pert manipuladon of Wilde's innermost fears. affecdon of an elder for a younger man as there men famous and unknown, livir^ and dead, on -Scott Olaen, Male-Gender Lesbiao By pitting our hero against his bigoted (and was between David and Jonathan, such as Plato a x^ade variety' of topics. Reading die book is '*I hear so much quibbling and gnimbling unstable) father, Thc Marquess of Queensbury, made the very basis ofhis philosophy, and such che yoimg lad effectively introduced Wiidc to as you will find in the sonnets of Midiaekngelo Miriatn Steinberg PhD public prosecurion for sodomy. and Shakespeare... that deep, spiritual affection Ifthe central concern of Wiide is the dtama- u-hich is as pure as it is perfect." Nowhere m cizarion ofWilde's relarions with Bosie, several R%t, or in Wilde's actual writings, do we Nutrition Counselor other minor figures in che film surface with witness him endorsing man-to-man love ht- comparable success. Despite his insistence on t^'cen people of similar ages, and/or matched A haUstic approadi to natural health dismantling societal convendons, Wilde mar­ intellects. Furthermore, Wilde's ver^* cx^ana^ with optltftm f^ritUm, ,,^ bod^tmattmU immune JwKtWn^mti elevated', creatir^ hakmce and heaith. Bsrsonalized counting available for: ANTH0Ny%522 HIV/AIDS Weight coning ^22 € MAIN STREET Vegetarian diets H ome of Ca rdan'sKaraoke Prenatal / ChUdren's Nutrition ;. • www.carctanskaraoko.:Coni i::: For an appointment caU (716)442^165 winner of thc waldo salt screenwriting award •MMM ^nnw CwiBi •Mm 1998 Sundance film festival \'.;i'!^.'ii P;;)za;--.2furF:oof • •325-7310 unaayaner/ine.".G;-a^ ' R^.r:or I ally sheedy ladhamitdidl Entertain high art With 3 For 2 Mondav-^ rsria V off Olir bacics starts July 101 a film by lisa cholodenko f..:>' ; o new idf a$ WW \V ] i\ •]'>il)i V 0\1/I 1 ! i I 1 fezninistJoxipfLeOism r H fc A I H E s 'Unaays' A^i .Dny f-: wr.y' onoif G^^"i-y- a'.J "Jo v-^ News • •A'e'iUnok-.-" Hecdth Conferefices^ sofas & chairs •CV-iL/J-l &> VETERINARY HOSPITAL rridnys Pa Ity With D.J. Jimmy Ch^^':Ai Sabseribe Today!f 720 Pittsfbrd-Victor Rd. '??tr:-^^;> ;^..v| Pittsford, New York 14534

••«»^. :- ";*:-:!;•'^"r '•*. ^•?-'f *-*#* ^•f"^*"* ' '---^ (716) 248-9590 •.- •- ••". ."tr'^ •• •..• -LS- -'•• •'•••a ;.i IIWM ^i[i«ijii]jl!j1 ^iii"iiDi''jpn.iin'"• iZ-'

' ,nnr,i\ 0;ji \/:v;.',/n,- »•<' :^^

•.••4-;\- ANDY FLEMING, 3454:riWtNTOII f»lX€E .ftflCMiSVEIf, MV U623 " -,•• v., t- • DVM MAf(E OUR BAR VOUU BAR , 716.427.7620 • FAX 716.427.7613 •t'' G mm^m^mm i» •! ••• JJ!..*!'!!"!'^... tStXtOsa.:HmSSTt A "''Ti'T'faJTif^^^*'*'"*I "'i""^ y-S^'- •i 1 1(1 !U>.r*3. " '^" ^1™*T*

*^- ^ -* % If K B M> T Y C t O S K T B5 Think of it as a summer re-run; Growing Up "I found a file or\g/sytorontoicot^t Almost a year ago. Liked it, saved ic. Good thing too, because by Eric Btllmami it's not there anv more. It's called The Ruks For Being Htttftan, I don'c know who wrote it, or if it's copyrighted. If anyone knou-s, e-mailme. Fd Make over "Uke to credit the author. It's posted elsewhere Xi^SJ S|Mpag.f-11>ft nme for new bcginnk^. Steve, in my site. Check it out," The Law Office of Lawrence KriMer, Attomey, wbbtait £ke ft loc» has matecializcd after sev "Fve resisted ediring the original, buc se\-eral congratulates OUA^G.V. on 25 years of PHde serving tatki^ iocmnaiuaicado. Steve has agreed to of those rules, edited and taken togedier, are pnjs^ke a hocne repaif that no one else un- quice powerfiil. Fortunately, I have a forum the community. We can all be proud of woridng deaHRficis or is willing to tackle. He is even- where I can post thc tmcha$tged origfmily and together to make Rochester increasingly a city where tetnpeiecl and confident. He wants to wait until paraphrase here; tiie ^pldng rains stf^ befbre he digs around the You will leam lessons, Ifjott don't leant lessons, they .C^ all people, regardless of sexual orientation or gender mdatOfmy house in what he assuiies me will be gtt harder A lesson is ttpeatrd and ptesented toy ott in expression, are treated with dignity and respect for the final remedy for a basement leak. variousfttrtNS ttntilyon Intm it. Thenyou cangp on to Steve is so agreeable, so reassuring and so tbe next lesson. Yon will know yon'I'e leamed a lesson their legal rights. ijuatve that I dunk I will ensnare him with an when your atf ions change. Fkmdd Planning. 8 indoor ptoject, sort of a pre-task bonust let*s Bifty person or incident is the L ^nirwrsal Teacher. rep^ce ^te shower stall Once work com­ ^ The Authentic Self.-*,.*.—**—8 There atr tso mistakes, only lessons. Then an no '^ ^^/ Have a great Pride Weekend mences, it becomes cU^ to me that thc floor victifus, onfy students. "Failttn** is as mttch apart of coutd be replaced, too. Finally I stsk Steve to the process as "sttccess'*. FAMILY ATTORNEY- FULL SERVICE LAW PRACTICE repakit. ! want evcr>Tliing g^stening white. in America do you see men in their 40s? They're bercd an old John Wayne mo\ae (sorr}); **The "It's funnv how 1 knew all thar. Somewhere, Thc four-day job stretches out to 10. Thc on some level. But reading the words is what • Non-Traditional Fannily issues • Debt Relief / Bankruptcy buried in suburbia. Not only are thc men big High and The Mighty." It was about a maybc- protracted birth pains cause me to love my and healthy and sexy, they have gteat hair. The gonna-happen plane crash. All thc passengers made it real for mc." • Wills specifically for Gay Couples • Real Estate / House Closings new badhroom all thc morc. Many of life's lessons we must leam for • Small Business / Incorporation haircuts are what do it. Tlic hottest men, their have breakdowns. Some get drunk. Been there, • Divorce / Separation I rc^gard my pristine bathroom with affec­ hair a mixture of black and grey and white, done that. Claire Trevor throws her fur coat ourseh'cs. Although the wisdom ofcxp»crience • Child Custody & Visitation • Civil Suits in State & Federal Courts tion and pride. One small issue troubles me. favor a blunt short cut; thcy look like sexy out the window. Or was that Talullah Bankhcad is offered to us by others, wc have to make the • Child Support & Modification •TrafficTickets / O.W.I. For some tinte, beginning quite prematurely 1 badgers. I resolve, staring in the hotel mirror, in **Lifeboat?" Sitting halfwt'ay back, depressed mistakes, leam the lessons, for ourselves. • Criminal Defense • Auto Accidents / Property Damage assure you, I have colored my hair. Sometimes to hang ^^nch my natural hair. and tearful, was Jan Steriing. A skilled B-movie It Starrs carlv in life. Evcnonc has leamed • Legal Nanrte Change • Serious Personal Injury the result looks great^ Sometimes thc phone Three days back in America tny knees arc actress vinth eyes chat were slighdy crossed, Jan this lesson for themselves, and has seen little rings and I end up looking like Freddy Munscer, shaking; my confidence gone. I look horrible. Sterling was a tough gal and ver%', verj' plati­ kids insist upon learning it for themselves. Tr)' disconcertingly raven. Each dme I stand in the The Angel reappears. "Stop by on Saturday, num. Knowing the end could be near, she as thev might, evcr\' parent has suffered along Attorney at La^ shower stall waiting for the water to rinse clear, 111 see what I can do. I think yovi should go all hoists herSamsonite make-up bag onto her lap \^ith their child as thcy leamed the meaning of I wonder again if my scalp will stain. Chums white." Well, it'll be a match for thc crappcr. and methodically removes her sluttish make­ "hot." "Don't touch thc stove! It's hot?" And now know if they see me wearing a baseball cap The Wilder Building Saturday arrives. The world traveler who up, a fallen woman preparing to meet her as soon as thcv can get awa\' with it, the IVc let Miss Clairol overstay her time. 1 East Main St, Suite #^ can bravely dimb aboard a bus heading to an maker in her natural state, an honest woman at youngsters touch thc stove and get burned. Rochiester, NY 14614 Contem^^ting the small per fectwhite room, uncertain desnnadon trembles in thc dooru-ay, the end. She didn't do a damn thing to change Tile mistake made, thc lesson learned. I wonder could Nimibcr 518, Warm Dark one last deep breath before entering the salon. her hair. I think a lot of life's lessons arc like that. We Brown, bc a contributing factor in thc gradual Why hasn't some genius uTittcn a sitcoin Neither will I. Let thc fiin times begin. have to experience thc pain, physical or emo­ N«nrtb«r ot TOLL PKEE OUT OF AREA discoloration ofthe old shower stall? I splashed about a hair salon? Thc pep, the chaos, the tions!, for ourselves. Make the mistake, and • Lambda L^af Defense a drop ofthe magic goo on the Hoor once and repartee. Angelo, the smiling wet*drcam. take thc lesson. And for some of us hardheads, *NewYoric State Bar (716) ic resisted all my ckiuiing wizardry. And diat's Dormy, an elf with a bolt through his tongue repeat as ncccssan*. Still it doesn't stop us from • District of CokvnNa Bar 1(800)719-3260 sag^k^Something. I make a silent vow never to • Monroe & Erie County Ban and hair swirled Hke a Dairy Queen special. The Scenic Route trving to help others Icam whnt we've leamed -AnrMfirtcan Bar Association AiX INQUIRIES SnUCTLY CONFIDENTIAL Fax: aio 325-1946 dye again in the bathroom. I'll exile myself to Tammv. sleek and \i4se. AU circle thc wizard. I By Bruce Wilbur through oviT experience. Ulumately, I guess all the basement^ the cold, damp, badly lit base- xfc am ofter unyonc \^ Y'^rmpectivc, eitVicx V>c- an) entranced. 1 »n also slammed into a chair. Lessorts in Love nH^.llMr sokition eb site. It's the plate active. Go out, live and Icam! said beauty. Instead, thc mere thought ex­ wimps. It's a corrosive Syc, dear. Of course it where I sbarr tftyselfand ftty life with the u^orid throtigh An\-\vay, \ihat precipitated my re-reading hausts me. bums. But it won't bum morc. Don't moan! Sit wyj0umaL the site was a few recent entries in I^ny*s Well, there's no dme to implement thc new over there.'* Which I do, for 50 minutes. I Icallfttysite "Tke S^^tnc Route", inpart because Jot/mal. He's gomg through a rough patch right protocol. Vtn leaving for a month. And at this engage in gay chatter with a landscaper hunk. I tend to uvifider around a bit ott the way to nty point, now. Death in thc family, his mother's not juncture of problem and circumstances, the Does hc even raster Tm wearing a transpar­ if J happen to bare one tbat day. And frankly Jt*s mon well, PC troubles, and I think his job is getting charismatic and powerful Angel, Lady ent shower cap? ftin to tell a st&ty that way. Stick with ttte and Til get to him too. But whar bothers him most right Sdssothands, enters my orbit. •"Tammy, Angelo, check chis out. Think it yon thete, etmtttaity. now are issues in his relationship. I was touched "Leave your goddamn hair alone. For once took?" They arc inspecting my head, I love thc Yoti're ttftlcot/te to stop by for a visit at http:// by thc parallels between his relationship with DecoraHng and this cencury let's sec what it looks like. Jtist ict attention. Swiah, soap, rinse, towd. My hair www.brucew.com. ICim, and mine with Vincc-thc-ex. I shared Liquor Store ic grow out. Ma)4>e I can do something with ixH" feds Hke dynel; Fve been wamed about che SfttutdAy May 9,1998 Noon some of mv thoughts with him. First by phone, Don*t you just love the confi^nt, audioriu- Barbie factor. Coarser texture also means Ahhh. Another cloudy damp weekend in R- and later by e-mail. Ill sharc some of what 1 nve vcflce of the professional? I do. With not thicker hair. I like the tradeoff. Voilal town. Yesterday was much the same. 11 couldn't Parly Supplies \iTote him a bit funher dovin the page. another tltoi^i;, I depart for the Czedi Re­ Oy vcy, voila my food I may be transformed decide if it wanted to dri2/Je or noc We had public and Germany. ^ but I am not ready. Lady Sdssoihands, Angelo drizzly raindrops, but not enough of them to VC'cdncsda\' the weather here ^-as absolutely IWewiMemd Travd is my passion. Cafes, niuseums, patks. and Tammy are beaming. Tlus must bc a suc­ even spot thc windshidd, let alone get anj'- faaabulous! .Mosdy clear, high in thc mid 80s. Best of all pbccs to waUc. eve^^bcee lots of cess. In the mirror 1 see Susan Powter. thing wet. Sort of like an anemic plant mister. l^nce-fbe-ex and 1 agreed that we'd go out to .s^"^ deooraNoiu pedestrian actkit)^P^lguciaus<^^fiknclly,g^ Anj'^i^ay, today seems like just the day for a dinner sometime this week, and Wednesday I am shq^ped on che back and shoved out the from sround •>*;-.^i:-.«>.S>? \*'as perfect for it. My favorite restaurant in jEbr wa&tng, the moat beaudfitTEuropean dty door. **detpt Afrfiy ttttmttittg'* journal entr>'. I haven't ^^3 forevery cown is also the closest. Oi\K a block away to Ita world Pve ever seen. The *TVaguers"Acmschrcs arc So how do I look? Have I bec(Mne Lana really done many of these. I checked Wednes­ the Ave., and a few yards down. .#. a tad remote, coo many years of Communist day night. I stayed up until ahnost 3:30 (1 get up •^m Turner? Monroe, Hadow tneant noching co ^^i* We got a table out front on thc sidewalk, and m op[wesstoaIstf)posc^?1»eyser^t^thediim ixie. My frame of reference ira gcneratioo or for work at 5i30f) reading the cnrirc journal, '^^ * QflRosi invMaHons a pint each of dark ale. Thc weather ^'as per­ Itngawit^noamyea^tear the dcket stubs in half tvo oot of whack. Peopie like the new look backwards. I started ar this ix*eck, and u'orked fect, and as usual on thc Ave., the "scener>-" * DMttraNnB Wen with a itanote gaze-Thcy lefiise to smile. What however. I kiod of foiget about it. Every tkne ail the xvay back co when 1 surted it in January'. U'asgorgcous.Afrcrdinncr,wc walked back to * Ami much, mudi moit tbcbcy^ dtefattiUic^ 4« gorgeous, encniatcd I waSc into a fioniliar settii^ I get to assess It's the first time Fd done that. I don'c go mrmOnt my place arnl I gave him some tips on thc finer wifkwexf sctt^itafc no Qot else seen» to no- people's reactiOfks.Atwork people go blind, so back and read d»e entries after thc>''re posted. points of searching the Cdnow site. Later, he WMfMenHNingi •Iifei«i4piiii tte«. I fiiBin bv^widi Alphonse Mocha, drink feacfid they arc of making a comment thac Two reasons. Fiiat, the editing urge is ver)* BttMmmm headed olf to che bar, and I checked in on all Jottpfoo&e. For a bonus, Fi^^ is swamped tni^t be construed as sesoial haraasment. My scrong and it*s hard fbr me to resist die temp­ M .1 my onHne firiends. Since we had spoken earlier with limiam on hcJiday* £nei««ii« and noisy. nrcnkish fidends stare SA the flooe. I bet some tation to "fix" things. To do so would violate in the day, I saved Larr\-'s site for last. SMta pMid to llnea* Sni YMk.' cheftniiven tiie sqbftces. the bdcb^ firiends ate jeatous of die freeclbm my behavior my "post it and it stag's posted" rule. Thc unmiaKipa Vhs^ I fftpe at tlteeas gieen bai^ tufts of in^fiee. Optiuon be damned. 1 Hke it. I fed second reason I don't go back and read old It's funny how you leam littic bits and pieces ONVENIENTLY LOCATED BoiSe^ Esshkm bcBvado. I mak^ two.forays eiitpo«ered. Socneoae aemiiids me blotides postings, is that I don't ^'ant how I felt when I of rdated things, but it takes an extemal event WmU iac^M(Skmiany.fimtob^^ hsfc more fen. Lec^s fee. wroce them to color my fedings as I write new to instanth- pull it all together in an "Aha.f" Lr' ':?-^'^ moment. I read of Larry's pain, and thinking of CcorgKhnwi PtBi, 1050 Ent RHgk RoKi ID ^ niy fittnay^ahottke^Hie n a week later a Half a * now standy, my mind wxnt "Ahal" and pulled it all Caitor Skeer ext is air Route 104 fj>Tm Geimmt ene dac b^qrs dds* I can*^ witt to hsfve a few dttt my wincer dqifesaiesi has broken. And I TAKENOrE •*»* together. I fired off an e-mail to Larr%' contain- |haftwuMv»gen»o»SeS90NBndiJfctJii«WiKi. found that even thoi]^ my fecUngs don't if^ my ""AbaT Afterwattb, 1 knew that Fd hit ta^^fbtaG^fHai^tt \ always cone ibfoa|^ on-screen, 1 could re* i^a i4 IMk Vk Madooaa; she bea UtA on something 1 had to share oo my site. C-tjtfA*/'/ '•^tttf nerves. Hief tiik IDo IOVHL member how I feh when I wrote each one of lOUSE or BACCHUS We^fi^. professional BAl ;s6ots» toOv Fd rsdier dnnk aboot Damd Day tietr: Smtr tbrtt Prtgitttru snrb oretti-belmii^pesitirt d»em. Still, there were a few surprises, but |Wj|£ M|f|M end Ciddlw staff anvoys ovoi kible to Lc#ts in "^ Bemxdiul Laonderette.** I si^ re^ettse f the pes/it^ / kttrw I had te share it itt r, evety thifd pefsoau iR<«t«ig that's not wtiere Fm heading. For ll your pose I could knagiae mysdf as Sting or Bruce prtttt.' lf?imaSiSSi cheerfully serve you. icmlbn^l^lives aregood An^ WiBif ^^ as some terrorist. h seems fike a good time to repeat some- 3WM70 ofMgnicoin their 40s, look vcTf good. Whete It's been my good fortune to have had three W7ieiew«39o p^.ggg., |B8»aillAIL;BACCHU ejiST But 1 am who * ^m and eventuaB}'I remenw thif^ from one of my first week's entries.

mm/mmiaimii HULjOnWiKljJM mfmmrf^zsrtuiz !^.* V '^^asrsi,^ ?te.-'^?cw;ra'iiiSMiw. • .• ,,'i". ,'•,',!;'

•ii?;.i«^'i:''fl-i>.:--v;-. •'•:•*•• >• " :• " C L o s u T B7 On Your Side 4) What can I do in my Hfe to change the ried couple. It is quick to point out economic real lelatiooships in my life. Ranging in length reaBy talked fer die first time injwan « remember a thing tbat I had said, ^igfooce it hare n6 b^&rif^ o«^ 6r Acttfing diings diat I don*t Hke? Womanspirit differences, suggesring chatsingle parencs tend feom six mondis to 15 years. By the standard Our breakup had been rety lowT and, ttery cociaplefdy* oc wouil cdte die ilimdng SA tte en|^. By * Chtiatine 5)'Acn I makix^ a d^Gerence in this wtxId? CO have poorer quaHri' housing and less money measure, since Fm singie again, each of them pidilic At least witbin the flea market sNaene, it tatacs oppcHdisi> TtSk^dbom ^usmtii^ . you something lO dc> '^disn Sifflona 6} Am I ghru^ too much«o others and not By Dr. Paula available chan dud-pnrene families. Another has "feiled." Buc I've taken the lessons from was a jRlCseap epene, so^ we weieg^vttn'A t^nde 'Xfody « fe#«M»ba 1^ I zealiaed t^ %bt} Hx tbe drird entity ~ diei to mysdf? etc.. DeChelly comparison is around sin^e mothers having each and applied them to the next. Perhaps berth by both our vendors and die ebSUHxieifs used die wiM^ibes^'dt^Gi&retitfy. I wouU use And oow^ simevycsBte Independence Day For me» I can honesdy say I exri much hap­ less time available for chemselves and thcsr pier in my life dian I was on^ year ago. The Fve come fer enough that next rime, "LIK" aMkcBssentiaPy, everyone Within 4Q tt>5 0 feet tt meaning to dmk axid understand what is problem, but fivm different sideik fM can Hiert are many traditions that peof^ may have Healthy self-image children than families ^xnth t\i-o parents. These beikig said^ Not ntreaasfily to agtee, but to heaviness ofmy grief and mourning has less­ won't stand fbr Long-Tctm Relationship, but deared out. I dunk diey wece ei|>ecttf^ die make cfuick wodt of ic Afenr aB^ a burden ^4ien it comes to July 4di. There are barbecues, The mosc valuable lessons in my Hfe have come are some of thc factors thac lead co concern couple the act i>f hearitig words with duidcing ened and I want to Hve again! Thank thc starsl fbr Life-Time Reladonship. I won't know fbr shoot-out at the OK Corral. Or at least some shared... beachparties;femilygatherings,panie5atbacs, from being a single parent. It has been a long over hou- well single mothers can parcnc on dKMit daeir meatung. He took the word to I love my work and the pec^ple I come into sure until I gee chere. fireworics at the East Avon Flea. It was, after ^t sitt^dy beconies a matter of drrv^smg 1^ fireworks and lots of food. Whatever way in joumey ^ich many hills to cHmb and Iocs of their own. mean obey, as tn ihe sentence, listen to your contact with. My rdationships widi friends I spent 15 years with Vince. Fve really not all, thc Fourth of July. the workload. "Wdl Fm not so hot as this,:do whkh you cefebrate (or don't celebrate) July rock>' cerrain along the way. Because this expe- My experience challenges this old view of mcythcr. When Mom says that,^ we all know die and family are reaHy good, but... I still tee\ like written much about him and me on the site. Anyhow, Fd wanted co keep it feirly shcwi, you dunk yoti can Iwdp ine with diisjp««i^ 4th, I hcjpc you will bc safe and serenel rience has been so powerful in my growth as a single parenting. Even chough I am aware of tcaXty mems, obey your mother. '*I see yovi^ havii^ trouble with tlKat|Ntt^ can I need to find more time forme ! Pardy because I know he reads every word and and I thiok Vince did too. It was such an Wben I diink of July 4di, I dtiink of a day off woman, an adult, a person — I want to pause thc stigma society- has about single mothers, '*Somediftng so simple as diat caused us so I hatidte diat one fer yQ%n^ YourVe.probaialy With a busy work and home life, I grab what I don't want co re-open any wounds, and pardy emotionally charged meeting and it was X9 &oin work and time thac I will spend with my and reflect about it. these attitudes conflict viith my own kno\i'l- much trouble. I was asking to be understood. been doing that fbr yean with reglsrd to the I can to fet^^ that irKkpendence that I need and because you'd gee only one side of the stor)^ draining. And with the whole place abuKZ, &mily. This year we arc staying in Rochester. One of the biggest challenges to single edgc that I am a devoted and capable parent. He thought t ^I'as d^aandir^ obedience. No mundane stuff, like household chores, or re­ crave. little things can make a big difference, After my "Ahal", 1 went over to the bar to talk there wasn't much buying or selling going on. In previous j^ears, my £imily has dwa}^ gone to parenting is the stigmatizing aetieudes chat so­ Being a singic mom has given me positive wonder he would do d:ie exact opposite, or decorating. such as*, taking a walk, eating a med out by with him about it. After a half-hour or so, I got to saying what Fd Chautauqua. I am starting to think of July 4di ciety, the church and even the psychologicd feeHngs of confidence, self-esteem, pride and ignore me endrdy. Just like a kid reaccs co "Fve become iquitc comfbrtabic with this m3^elf, reading, cooking w^hile Hstening to I must have really frightened his friends come to say. I don't remember the exact word­ not only as a holiday to cddbrate my nation's community have about it. From dieir point of achievement. From this experience, I have mom. vicv(*^and find it completely liberatkig." music, visiting the Hbrary, going to the titde when I burst through the door and pulled him ing, but chis is the gist ofic independence, but a day to diink about how to view, singje parent famiHes are "arjpicd." gained independence, strength, self-reHance Theater, and taking a drive to somewhere I aside saying excitedly *''Fve gotu talk to you *'We*vc both been mean, nastj' and hurtful "Was it any wonder that hc soi^t out the Fve heard or read somediing like that some­ renew my commitment to mysdf to take care Singic motherhood may have occured throug and decisiveness. have never been to before (even in Monroe right now!" They eyed me suspiciously thc to each other for far too many j'ears. It takes company of (somerimes disobedient) kids? where, and did my besc co appl)* it when diings of me! My own independence! Does that sound divorce, separation, being widowed, adoption, These characteristics, which arc usuaUy as­ County!). These are small wa>'s I tr)^ to main­ whole dme. But then again thcy always do that. two CO tango, and I take full responsibility^ of Was it any wonder tliat I fdt misunderstood started tuming for my most recenc ex and I. too sd&sh? or never being married. But these institutions sociated \^'ith the male role, have developed Ultimatdy, it was pan of thc relationship be­ tain my own independence in a vcry busy They're waiting for the other shoe to drop. my half. Fd Ukc to say, Fm sorry for my half. and abandoned?" I know wc typically chink about making tT}^ to distance themselves by excluding single steadily in my life from being a singic mom. tween us that we couldn't fix. And when we world. After all, Fm the one who walked out, well no> And I'd like to say, 1 forgive you "for your half." In our next exchange, Lan-y and I agreed changes around Jan. 1. Maybe it's good to have parenting from their restricted modd of moth­ Learning to manage my time, money and en- broke up, things went so much better. Maybe this year you too need to stop your­ more like exploded out, ofthe relationship cw^o Beyond Thank You, T don't remember what that there werc some real similarities in certain two isxrsies^^ of year that wc stop ourselves and erhood. erg\' resources has been invaluable to me and aspects ofour relationships. I guess that's what True, there w*as the sadness and grief associ­ self and ask the questions that are burning in and a half years ago. hc said after that. Wc cried a licde, hugged and reflect on: 1) Am I h^>py? When J'OU read the statistics of the great positive modcHng for my son. made me forget my jxile about unsolicited ated with any breakup, but because we reaiistcd your heart. Bc prepared to Hsten to the an* I explained to him what Fd written tp Larr}' I left." 25 Do I like whac I am doing wich my life? number of children in this country who live As nevi' evidence of successful and positive advice in my next note to him. It said, in part: thc problem wasn't wirh one another, but with swers. and why, and asked ifhe minded my tuming it At some point in our past, \^'e had stopped 3) Am I spending enough time with me? with one parcnc, it becomes clear that wc must single parenting emerges, society* will hope- "1 know this is a prett>^ abstract concept, and che relationship, we never becatne mean and into a posting. And 1 invited him to sharc his talking and listening to each other and drifted re-examine contemporary society' and adjust fuH\' begin to recognize thc manv women and it cakes some getting used to. So let's start viith hateful of each other. And so, we avoided comments on it too. He said, no, he didn't apan. As the years passed, all the stewing pent- our attitudes uich consideration to the differ­ men who are making this journev vi^ith their something fatniiiar. hurting each other. In fact^ wc were almost mind, and yes, maybe he'd offer a comment or up emotions and frustrations turned into an­ ing family circumstances that currendy exist. children. Encoumgcmcnt and support need to gracious. Within six weeks we werc prctt)' two. (Authot's note: The day after this was posted he ger and hate. "It's easy to assign blame or feel guilt when It is important to recognize singic parenthood replace doubts and judgemental, outdated atti­ much over it and bar-friends ins.tead of boy­ ditL 2 posted his comments on the site that day J Larr)''s been frustrated lately in his 25-ycar you hir a bad patch. It's all \'Our fault, or it's all as a legitimace family form. tudes. relationship with Kim. i just wanted to fire a my fault. Or how about this one? You know, friends. . Afcer a while, talk tumed from our mutual Sodeey keeps its highese regard only for Paula de Chelfy, PhD., is a psychotherapist and warning shot off his bow, based on my past. I you've got a real problem. Which is usually So whar are ehe points Fm er\'ing to make past to our present and future. We're in agree­ mothers who arc pare of a heteroscxud mar­ edticator who specialities in nvttten's issttes. ment that we've never feit doser than wc do utlcd the note "Listening" and here's what I foUowed by a response like, I don't have a here? now. Neither one of us can quite articulate it, UTOte, in part: problem. You're the one with che problem. Well, first, that given thc right perspective, but there's a vcr\' special bond between us "Fm here to listen, 1 only give advice ifyou How many times have wc all had that fight? you tan^work things out. Sometimes, all it takes now. It's not like friends, best friends, or lov­ ask for it. But I uill tell the occasional story, "Begin here instead. Make sure you both is a different mind-set. And second, failing ers. I certainly don't have the words for it. He (like now) and you can take from it as much as understand that there isn't a problem with ei­ that, 3'ou can end it M-ithout turning into spitefiil doesn't seem to either. or as litde as you like ther one of you. Guess what? Neither of you vicious queens. And finalh', forgiveness, ^r// so Karen A. Miller,csw.,c^.c. Anj'M'ay, we also agree there's no "relation­ "I can relate to how you feel. Ukc Kim, is a bad person. You don*t really have a prob­ gpod^ to both the forgivcr and the fbi^given, ship" in our fumre. I mean, why screw up a Vince was al\n'ays ve*^' chattj' and outgoing lem u*ith Iiim, and hc doesn't rcaUy have a I offer my experience as pcrspccrive, not a good thing with sex and cohabitation? Been until I was around. Then he'd get quiet and problem with you. And best ofall, you still love les.son. Because these arc some of life's lessons PSYCHOTHERAPIST SPECIALIZING IN there, done that, got ehe t-shirt. It shrank. Aiid unthdrawn, almost sullen. I felt like I had to each other, wc all must experience to learn for ourselves. individual • Relationships • Group tViai's the part that people teally doo*t get. Ho\k' carry on both sides of any conversation. "So if the problem isn't with cither of you, Careful, that stove is hot! did that happen? Why aren't we angry and "For the last few years ofour relationship, it where is it? The problem is with a third entit>' Alternative Lifestyles spitefiil like evcr\'one dsc? This is what I think felt like we were rwo strangers sharing the between you. The reladonship. Blame and guilt causes Vince's friends to eye me suspiciously. same address. He*d just park himself in front Well, it was like that for the first year and a of a TV. (We had seven sets, all on cable, and half after we broke up. But it turned for me three VCRs, in a two-bedroom bungalow vk'ith when I just couldn't take it any more. I was expansion attic.) I don't care for TV, so Fd tired of being consumed with hate, tired of either read or get on the PC. being angr^', tired of the hurt. I just wanted to "I carrt read and hear words at thc same put it ali behind me. So last summer on the time. It confuses me. Apparendy my brain fourth of July weekend, I went out to the flea only has a single language processing channel market specifically to, as they say, seek closure. available, and I don't have the ability' to screen (716)436-6897 ^nn' • Therapy for individuals, 7 N. Goodman St • Rm 3 Both phj'sicallv and conversationally, we out the speech. So generally, Fd go in thc other couples. cNldren. drclcd each other tentatively, our "fi^r or room lo read. Thc computer was in yet another RAD! ANT Rochester, NY 14607 (716)244-1330 fL'ght" responses tumed up to the MAX. After room. WELLNESS goy ond lesbian famiiies we each assured ourselves that the other one "He felt like a computer widow. I felt like a ASSOCIATES • Parent/chHd conflict wasn't going to gitttge ottr eyes out or cause yet sitcom orphan, • Se)ajai ofsuse recovery lyn Pezzulo Ms. Ed ANOTHER big hissy fit scene^ we sat down and * When we did actually talk, hc either woddn't LolGfh Ehresman, MS. Ed. • Chronic physicai and Psychotherapy and emotional pain Counselor for all Theropeutk: • Resoiution of conflicts emotional concerns Splrft/Mind/Bodywofk • Anxiety and depfessk>n Third Presbyterian rhurch WHEN STRESS BECOMES Individual and couple therapy Fimd yomr »9tttt poke, redUmjmmr htmer power, kttrtt mfmm^mjt^mr mam kmM, TOOMUCIi^ Sliding Scale 594-51 coNstogRjrp||.yAiuUg OF For appointment, CC* 482^4396 rfAUMlb

.pSiT-!' •• ••'- *

• -. :>••-.:, • f-- ; -- « MDMMlBikliJi'^ -'''^ • pamiiiii • ADOflLCSClNTS

£mnt4€fim^ Sewiise4 • rAMEKflNG CONCnUSS ^mdMdufU, ^ta^JM St 0mitt HJemtif PaiMilSy FtaMoi Mri FMtRdi of LtiMin wA Qiys A Mora Light ChuKh rrr=:Roche»ter^ NY Where Gay, lesbian and bisexual persons ^n w^comml as partners in nunistfy. 3iS'5m'S9er (7f4)33f-flS0 tTTTPt^Lddl^MU We let the laat Sunday of the month at the Frtends Meeting Houae. Sunday 10:30 AM Worship KT'- 41 Vtfeetmlnialer Road (near the comer or Eaat Avenue) FOrMemiaifen ceih 71S-2344HM Monday IstandSrd 7:30 PM Gay/Lesbian/Bfieiaial Support Group .^%. •**^--: • "ly'^'Ji'^'-.a^i'-l &"

Child cara-Wfieelchatr accessible - Ui>ped for fhe hearing ImpafrM •'-^j^

:.;'" •U''*:^

"' . -V..-. •••f.--- •"Af^.:.,.-.v:,.,. ' *H, - ''

^ -.•-4. i-^^^-^ST* - 'i'* >S,3- • ;,*• '*4 ^ 5 .* ;' v wapjv- Kiiji' «i^>%m. Ksmm K^.L'OZXStSSiiX.&'StUSSiSSlSf^PiE^X.^JS^^ '.-J- jaac^t^^g^V^TT-' ' :^!tK^Ur.^'VJ. "J'q—•'^ ••"

^*^#-** :.I>"-:^T:''^ •••c I- o s n TJ B9

ing in the fund over time. around the comnnuiity»oasud»isaues aa bcxfy Quia JS #e«tw^a1&nfr ahdwc31-d^sfl||Sd L/ AIDS Directorv Financial Shareholder setvicea. Here yovSAsdi a list image, compubiae sexnd behavior^ Ms^piecic G/B/r cQismunlly, thanks to d!$#i»k of RESOURCES FOR Planning of services available, such as chedc writing, Coupies (HIV poddve and negpidve), and inti­ .Tanya snd die GAGV, which I wfilndSs very tdephone exchange, automatic invesiiiig and macy between men. much. • ": • • -•'•^>Q^ WOMRNJ I als<» wish to d^mk al of iiijfa^pf:"Miil By William Glave, ochers. This section, or another ^dttedflHDw The column went throi^ its own devekip- Free testing for H^V exposure is available from New York State Department of Health: CFP to invest^" will disclose the minimum invest­ mentd process reflecting not only its leaden^* mens' grot^/^-odcahop participants tit^fStve call Rochester Area Regfonal Hotline at (716)423-8081. or I -800-962-5063 for pay phones years. You all shared so petsonaHy of your­ wenm.|OBm l565iXRochescerNY l4Ma ment required to open an account. but my tywn evolutioo. Feedback came in vari­ H^inree County Women's Hssias or calls outside Rochester. Deaf or hearing impaired people should call (716)423-8120 Breaking the mutual sdves and have been tsry teachers as weK. I 234^9709. www.moofferMiuksxom/WAVE (TDD.) Oral testing now available. Statewide information can be obtained by callirtg 1-800- If there's anything in the prospectus you ous forms: in person, voice mail, letter and e- Fte^eeraht^ 111 WestftllRd^ Rochester tahnk you all fbr your courage to show iq> and NetioMi Oryanixeiton for Wonr»en 541-AIDS. Other organizations whkh provkie AIDS-related services are as folfows: don't understand or want to know more about, mail. Readers contributed topic ideas, gave NY 14492; (7l«)274^97a Cbmprshen- ftmds prospectus code feedback and Hterally molded the column. My be seen as die wondCrfy people yon absolutely (Greater B»cheiter NOW*) PO Box contact your financid advisor or thc fund sivs IHWSSC camcer scr^snlnf servkes for AIDS Rocfiester, Inc, 1350 Unh^rslty Ave., provides education, referrals to appropriate are. My warmestwishes for continuing success 93196; (716)461-1310. E-mail: While itiilHons of Americans own shares of direcdy. It's best to not invest in a fund until aU god had been attdned: to create a community unihsurad and tmd«rinsur«d wonien. service agencies, client and ^unily services, advocacy for people facing HIV-linked discrimi- fomm and ongoing didogue on key issues we toyoualL RochNOW^aoLcom Web page: nttion, and other servkes. Including financial assistance and a public education speaker mutud funds, it's Hkdy duit not aU of them read ofyour questions about ie have been satisfac­ ^MbethWandeBrHntCOidc. 1351 aU face as gay men. Six years kcer, and having No profesdood can practice in a commu­ wwWi.mooreresult5Xom.NOW bureau. (716)442-2220 VHDD (business line) or (716)442-2200 V/TDD (hodine). Free, their prospectus befbre investing. The reason torily answered. Wt IHope Avs. 442-2190. Dr, Wende Lo- grown from the experience, I now oHer my nity widiout die ft^^port of skilled and caring CULTURAL: confidential testing and couns^ingfor women by a lesbian counselor, second Thursdays. No may be that these documents indude language Eader reading on the way. The Securities Isn-Yom^f ^ ^ all-woman staff provkie appointment needed; drop in between 5-9 pm. Free, confidential testing every Thursday find contribution to the Btvpty Ckset, coBeagues. To diis end I Mish to thank Alan Rochester Women's Community diat is difficidt eo understand. and Exchange Commission (SEQ has been ffttmmogi'Aii IS. n%ht, 5-9 pm; no appointment necessary. Outreach van testing avaHabte on weekends. I have been involved with a wonderful man Roach, Steve Oavts, Martha Howden, Barb Chorus* 924-4144. (See Oi^pinc calendar). But it is imporcant that you tmderstand che workingwith fund companies fbr severd yeats AIDS Rodiester Women** Heeith to devdop and test more rcader^Etiendly pto- in a long distance relationship fbr over a year Repaid, Mcksjo Campanaro-Cummings, Dr. Women's Commuiiity Performance Helping People with AIDS, Inc (HPA) P.O. Box 1543 Rochester NY 14603-1543 is a basics ofany fund you*re considering so you ac Oiiitf eech. HlViwwveridon*jConiict Chris- non-i>rofit, volunteer ot^pniiation. HPA raises and distributes funds to support; programs spectuses. In March 1998, the commission now. (Some of you may remember die 11/97 Bill LevL'ek, and ofcourse BiO Kdly for their Project. CMMWmmk^ AJI-f^male perfor­ least try to dedpher a prospectus* key points. line Smons, 442-22:£U>» ext 302f AIDS tfiat provide servkes to people living with HIV and AIDS. Funding is provided to agencies column on long distance rdationships. Yes, contfibution to my |tfofesstond and persond mance eroup. Sharon Jeter, artistic dkector. Tbe inrestmeat ob|ective. This section of instituted cwo changes: Rocheseer. I3S0 IMverslcy Ave. AM dso focated in the counties of rionroe, Ontarfo, Schuyfer, Seneca, Livingston, Chemung, Steuben, there were times when the columns became Ufe here in Rochester. 740 University Ave. 654-7709; the prospectus disdoses the fund's main in­ "Piaht Ei^sh"pr9jpf€fyis^TheSEC revised has other services for HIV positive women. Wayne and Yates. Hotifoe (716)987-1853. its rules eo rec^uire fund companies co make very persondl} This rdationship continues to For tho«e who are natursHy wtMideringabout SPORTS: vestmenc objective — sudi as capitd growth, Comnminteir Hf»itli Network. 7S8 Gay Ailiiance of the Geneaee Valley peer fadliutors can provide referrals to physkians not only be wonderfuUy rewarding, but also the status of die men's groups. Bill Kelly^ CSW, Women's basketbeH. Monday, Thurs­ current income, stabiHty of prindpd pr a com­ their prospectuses more dear and condse. By South Ave. 244-9000. Support group for and servke agencies. Person on duty MonTThurs. 1-9:30 p.m., Fri. 1-6 p.m. Message proves to be a vehicle for my own rdationd AASECT certified sex therapist, will be taking day nights, 7-9 pm. Downtown United Pres­ bination of objectives. By reading diis section, the end of 1999, prospectuses must have less HIV positive women» '*Maklng Connec­ machine other times. (716)244-8640. you candctcrmine if the fund's objective technicd jargon and legdese and provide "plain learning and persond growth. over the Intimacj' Betwxcn Men and Gay byterian Church. 121 S. Fitzhugh Sc Ramona, tions.'* Conoct Lyn Bbckbum. Meets first HIV/STD Coordination Project of Monroe County, 11 i Westfall Rd., run through English" disdosure ofa fund's objectives, strac- Thus I have made a dedsion to relocate Fadiers groups. Hc expects to stare each in 244*1640. matches yourown. and third Mondays. 9:3(^11 ani. Pre-inter> Monroe County Department of Health, provides information, education and training, and outside of Rochester to be with him and his September. Those intercsced are encouraged Investnoent poUdea. Here yon can leam egics, risks, perfbrmance and fees. The re­ view required. I^oms Etc** support froup GENERAL: maintains a resource hbrary. (716)274-6114 (V/TTY). two young children. (Noce: co aU che men in my to contact BiH ac his private practice, (327- thc types of securities — stocks, bonds, cash vamped prc^peccuses dso must indude a stan­ for afl female caregivers: contact Sydney Women's Resource Center. YWCA, dardized risk/reward summary, a bar chart gay fachcrs' group who werc concerned diac 2121.) 175 N. Ointon Ave. 54^7740. Conwnunity HeaMi Network (CHN). 758 South Ave. Aggressive early intervention equivalents or others — the fund holds in Metafsr, CHN has many other focus groups medical care for all aspects of HiV/AIDS care. Clinical trials, programs for women, mental having children may bc a UabiHt}' when seeking As far as the ongoing ^ixckend workshops attempting to achieve its objectives. This sec­ iUustrating thc fund's volaciHcy over 10 years, and services fbr HfV positive women and Slice off LHe Cafo* Feminist vegetarian health and social work/case management. (716)244-9000. tion also describes the t\pe of transactions and and a table comparing its performance with dating partners, let me tcH }^u, diis is an for gay men chat BiU and 1 have faciHtaced. we restaurant. 742 South Ave. 271-8010. HIV negative partners. Rochester Area Task Force on AIDS (RATFA) is a collection of agencies providk^g investment strategics the fimd manager uses. the appropriate securities market index. incredible asset as far as I am conccmcdf k's a are actually planning to continue the scries. I'm SUkwood BCK>IGE. Women's bookstore. Ateemetiws for Battered Women. a multiplicity of resources and servkes to the upstate New York community. Their ofBces Fund profile - In June 1998, fund companies wonderful oppommity to get those "good happy ^-ith this dedsion, as it 'will bc a nice 633 Monroe Ave., 473-8110, Ifyou want to know whether a fund is allowed 232-*7353. Sheher. cowtsel^. Lesbians wd­ are located through the Finger Lakes Health Systems Agency, whkh also provides •wUl be aHowed to use fund profiles during the dad" needs mec.) reason for mc to \'isic Rochester and reconnect Coalitfon for Lesbian Visibiiity. Di­ to invest in potentially volatile securities, for come. medkal literature and newspaper clippcngs. as well as demographk stnd statistkal data for example, you can find out here. selHng process. These shorter documents wiU I must let you know this dedsion to move U'ith many of \'ou. Keep your eyes open for ads verse group of women holding potiucks/ ^nctkn Resource Center of Watyne use in developing health care services. (716)461-3520. Investment risks. Understanding a fund's summarize key characteristics in a format that does not come >x*ithout the fuU range of mixed in thc Etftpty Closet and flyers in thc mail. socials «n Finger Lakes area. Second Satur­ County. Newark N.Y. Hodine 800-45^ risks before you invest may prevent sleepJess allows easy comparison to profiles of other emotions. I am excited and very happy, as this For those interested, I would absolutely days, Becky Bly, (315)539-6271. Men of Color Health Awareness Project (MOCHA). HIV prevention focus for men 1172; office (315)331-1171; lax (3150331- nights later on. "^This section discusses the par­ funds. These profiles do not replace prospec­ is a very good move for me. However, at die love to hear how you're doing. I can be con­ Women's social- Fourth Fndays. GAGV who have sex with tr^t\ (MSM) in the minority communicy. Support groups, one on one peer 1189. ticular risks involved in thc fund. A stock fund, tuses which StiH must bc provided at or before same time there arc so many good-byes thac I tacted by e-mail at T)¥tone:Ttk\i@%o\.t:om or Community Center. 170 Adantk Ave. A education, safer sex workshops, referral services, buddy testing. Rochester Center for Hsay Mefdelene House. Women's Independent Living. 758 South Ave. 442-6470. for example, might disclose that it invests in the time of sale experience a true sadness with the realization by US. mail at P.O. Box 603093, Providence propam of the GAGV. 244-8460. outreach center for HIV positive women just one industry or "sector" ~ making it The SEC's "plain English" campaign no of inherent losses with this move. It is truly an RI 02906. Chedc our momftjy ond cngoinf cotendors ^ Monroe Community CoHege maintains an AiDS Resource Library in the Leroy V. Good and women at Hsk. 29f LyeH Ave. Open potentiaUy more risky than a widely diversified doubc wiU further >*our understanding of any experience ofthe fiill range, and t have come In closing, all my best and much thanks and more groups atid events, atnl caM the GaySource Ubrary, 1000 E. Henrietta Rd. 424-5200. Mon-Fri. 6:30-9:30 pm 458-5728. fund. A bond fund should describe how vul­ funds you're considering. A knowledgeable to understand the phrase "bitter sweet." appreciation, Rochestcr. As a community and Itifbkte for referrtOs, at 244-6640, Artd $end us Monroe County Health Departnnent, at 855 W. Main Sc, offers testing and counselir^ POLITICAL: nerable its holdings are eo inceresc race, credic financial advisor can assist you as well, by A thank you is certainly in order co many that as indi\iduals, you have been ven-good to mc. ytHsr ktfitrmatkml for HIV and other sexually transmitted diseases. (716)464-5928. and other appHcable risks. helping you forge an investment plan and I will noe be able co list specificaUy, who added TTiere arc many fond memories I wiU take with Women AfAkist a Viokftnt Environ­ ment (WAVE*) Issues of vk>tence a|^nst Strong Memorial Hospital provides a complete range of H)V medkal r:)re, induding Hiatorical performance. All fund prospec­ choose fiinds that are suitable for your gods. value to my Jife in Rochestcr. I want to petson- mc ofmy time here. And whatever aspects of access to experimental treatment protocols, and H(V testing. Also provides individuat and tuses iTvust display a clnart sbo\kring several ally acknowledge my appreciation to Susan myself through my work, writing and commu­ group psychoth«^rapy. Training of health care professionals also available. Infectious aspects of the fund's performance over one, Tbe Authentic Jordan, editor of the Empty Closet, for her nicy'presentations you found helpful, feel free Disease CJfnk, (716) 275*0526. Departmentof Psychiatry. (716) 275-3379. AIDS Tralnir^g five and 10 year periods (or since inception of Self support^ critique and suggestions over thc years eo keep thatwiih you. May you aU continue to Project, (716) 275-5693, Hve in a way that feels honest, truthftil and best the ^d,if less than one, Bve or 10 years). This fbr this column.Also to Tanya SmoHnsky for AIDS Remembrance Garden. Highland Park South, Rochester. Infoline: (716)234- The recent advances in the treatnr>ent information incudes share net asset vdue at By Thomas her continued support of the work that I do, for 3'Ou. In doing so, know chat you honor j-uur 1640. Mailing address: 935 East Ave., Rochester NY 14607. the end ofeach year, ycar-by-ycar totd return, and for her creativity and leadership in her role Authentic Self. ofAIDS provide new hope and Fronczak, CSW-R, Planned Parenthood of Rochester and Genesee Valley offers testing and infonna­ armud dividend and capitd gains pajTnenes, as director ofthe GAGV Community' Center, prolonged life. CHN brings those advances tc you including; tion (716)546 2595. portfoHo turnover rate and yeariy expense ACSW Thanic you Rochesteir • HIV testing and education Threshold Youth Center provkies confidential testingfor young people ages 12-25. Fees ratio. Keep in mind, of course, that past per­ • Experimental drugs and research formance does not guaramee future results It was Augusc 1992. My vcry firsc column ran in on sliding scale, no one denied servke. Threshold Center for Aitemative Youth Servkes. • Counseling and support groups 80 St- Paul St. 454-7530. and che vdue of the renun uHll fiuceuate. che Bmpty Ckset under ehe tide "In Search of • Nutritional services to promote Feea and expenaea. This section details Sdf." Licde did I know at chac time it would tum Protect Your Home or healthy eating Finger Lakes Family Care will provide confidential or anonymous free testing in noe only any commissions or "loads" on share into a monthly columun and its topics fuel de­ • Medical care for all patients Ontario/Wayne Counties. 1-800-650*9853. eransacrions, but dso the other costs of invest­ bates thac I would be involved in or hear about regardless of ability to pay Action Front Center (Action for a Better Community.) Provides HIV prevention be considere education and case management services. Training and technkai assistance to service with provkiers. Resource library open to public. All services free and confidential. Multicultural COMMUNITY and bilingual staff. Rudy Rivera, program mar^ager. I SO N. Clinton Ave. Hours 8:30-5 pm, Monday-Frkiay. 546-6180; hx 546-5669. Free anonymous HIV testing on walk-in basis, Tyte Security, Inc HEALTH Thursdays 9 am- 4 pm. provided through NYSDOH at Action Front Center, 242 Andrews St Carmen Hau, 262-4330. Dr. Peter Piot NETWORK A Rainbow Community UnitCii Nations AIDS Program Catholic Charities AIDS Services. Provides linkage with other servke providers, tnmsponation and ftnanclal assistance for housing. Mon^y-Friday 8JO am- 4:40 pm. 1150 More Light is a national networic of inclusive Presbyteri£tfi churches BuffafoRd. 328-3210. welcoming gay, lesbian, bisexual, and transgendered persons into fuli co-ministry and life celebration within our worshipping family. Anthony Jcwdan Health Center Prevention and Primary Care Program. HIV *"" ..' counseling and testing (free If ui^nsured), community outreach. Center in-reach with strong "* -• focus on education. Comprehensive HfV care and servkes. Induding medical treatment. Two services every Sunday at 11:00 am CD4 ahd vtral teed nionfcerir^medteatiogtt(ofv^i^ - a traditional service in the Sanctuary - dental, nutrition, mental heahh and substance abuse services, case management, commuity servke rdiarrals, support groups, assiscance with medkaid and disai>lll^. 82 Holland St., - a contemporary service in Celebration Hall - Rochescer NY 14601:423-2879. - V Adult Education 9:45 am ri:y -(« • tARA RIWROW. mJ>. Caii for dates and times wtien Rev. Jane Spahr wili be worshipping with us.

Ste(e-o^0ra-j%t mstBmttfon • K '^ •-, ••»• Edith H. Bernstein, C.S.W. „;!.^.. - ' -t'' "i k^ ^ -1 -f' A WortGsr , ** v; » problem ratoluHon, <• Intrusion "t 'J • •*&_ , t, •-•^Cl^.'^-ii'iL IMH^IS ggQ^ S5.'fTiIi^ m THE DOWNTOWN UNITED PRESBYTERIAN CHURCH (Slolng Fee Scale) 121 North Fitzhugh St. Rochester. NY 14614 (716) 326-4000 Commercial • Residential >l''T'-l ''•'-' > ', : I'v,- l, — .-*!.,^^-.* ^K '••'->•• '-'II.. mmn "^^"•^(•^"•Iff W,"*"i >iii.i»»i m<., nn,'

y-'^^s^ UMP ^ y C t O S H T Bll

Celebrating over 19 years of cominitiiient to real estate clients iHPfiil4Mtiikp«i^Mi^M J^xperience in every comer of our conununity/ ® Creativity Commitiiient Love Makes a Family CABIN TO CASTLE «AM Caqientry/Masoilty ReeEstimates CHUGK CURnS (716)766-5138 4 PM- 10 PM The Cobbs HiU The Maplewood The Tk^M^n ojf The Culver/Mmn "GAY-FRIENDLY" Weighborhood Neightjorhood Neighborhood mttsn^ • CinM 1932. 3091 #«. ^ • Historical beuroqne « OfTeied at ^S^rr^KM* • Tmsty treat for yoor eyes! I Help Families Find a Home • Eaonaeae feerairt klC w/ Victorian maiusion. • Built in I9M oo cul-de-sac • E>ecorated in taste & style. •anitcd cettiiV A ri^yfittes • ExtrtwrdUtary cn^ismoKship • 4 bedroom, 2 bath. Eat-in kit Circa 1910 features & detail. iZI ERA Relocation Specialist • 4-5 bdnns, 33 balhs. hkaSer tmd dtfiaiied wood ctwvin^. •Lar^e "L" shaped • Hrdwd. flrs,, pocket doors, LZ Multiinillkn DoUar Producer RomeCeili wlfrplc, A remtHieled both. • Music A Oval receptioat rm. femulyi recreation rm, leaded dc stained glass • Poltsifted haidwood flocns. •5250 sf. 44^ bdrms.,3 baths • Ira-lionie ofIlGe« In-iav^ witidtjws. IS31 sf^ 4 bdrms IZ Top 2%ofERA Agents Nationwide >6.MTOR*-BiCter • Fmished Mi f^,wlHsyUght9 • 4 fiieplaces.Carraige Iiouse quarters our teen soite. EZ #1 ERA Agent in Amenca tSKJIUtbi • Remodeled kit plus pantry. • Landscaped yard with pondL • Rental income. Asking $ ISO's *Two car attached garage. • Landscaped yard. $44^HM for Customer Service ki 1994 HOUSE FOR RENT / SALE mmnFwak • Rome CeUii» 473-3000 3c25 • Rome Cent« 473-3eoe x25 • Rome CeUi « 473-3000 x25 473-30te Ext. 25 • Rome Cem ^ 473-3000 a25 0 Rdocaticn services available Must see to appreciate this early 1900*$ traditional Tudor home. ^ £>ata on these hcwnes & thousands mos« available over the internet wnte: r<*felll®rochga^*f^f»||frm^t ^ Nationally & htematianally City property off St Paul near Ironctequoit border Quiet tree lined street. tZ Member Gieato^ Rodiester maBC&MOfcr 3 bdrm, 2 bth. Living rm w/fireplace, dining rm. Finished hafdwood floors. Btdksr Amoaete Gay and Lesbian Business Fcmim Real Eaae Problan SoNcr New kitchen w/ ceramic tile & new appliances. TV room/den. laundry, 2 car garage w/openers. Centrally Monitored Security System. Nice yard. Convenient to shopping, bus line & expressways. 5 minutes to downtown ERA Paul Fischer, REALTORS $775/mo + utilities (may be negotiable). Owner relocating soon. Rent, 6 North Mafai street« Falrport, NY 14458 Rent to Own, or Buy. For more information or to see, call 342 • 5614. OFFICE: 71«.^38S-14ee x 4138 TOLL FREE: W0-79a-1400 X 4138 ERA FAX: Tl^^MfreSl? S£AL ESTATE E-MAIL: TOM • Interior & Exterior Paint- ing • WallpiVMring

f'< • Ramodaling • Qualify Worit REASONABLE RATES For Sale: 20 Woodrow Ave. E. Irrondequoit: Spotless two bedroom Cape in quiet tree lined FREE ESTTMATES neighborhood. Narrow hardwoods and gumwood trim highlight tt living and dining rooms. Warm cozy brick fireplace, fenced 4306 (]Dlver Read yard with garden, paved drive and garage. $69,000. Hugh or 729-8689 110 MUbuni Street Mary Turner at Mitchell Pierson jr. Inc, Licensed Real Estate 32M69« PAGER: 527-3«56 This wonderiui attached colonial style residence ofFers over 2100 square feet of luxurious Broker 924-5122 or 586-6622 living sqpace. Hardwood floors, tall ceilings, and moldii^ d^ails are featured throughout WearSealneiehurk *Tom fiiom Muthers" the first floor. The kitchen has been wonderfully updated and ofifers an abundance of OpeiTiesdaf-^Saia^ liMk storage. Th^e are two laige bedrooms on the second floor as well as a spacious marble bath with whirlpool tub. The skylighted third floor makes a fabulous guestroom or office. Gorgeous perennial gardens and two porches complete this property. One hundred thirty nine thousand nine hundred dollars. Steve Butler, 586.6622 ext. *119

For aU your real esiaie needs..* •Residential •Commercial •••Apartments • Private Financing • OLVER, KORTS, KORONA fk 10 Toley Village Office Park - PitUSorA, NY USS4

Mark Siwiec Call For Professional, Personal Representation for: • Purchases & Sales of Real Property • Real Property FaxttierMp Agreements • Wills & Estate Piaaning 1353 Long Pond Road • Small Business transactions • Itefbislied HanlwDOdft * Ciown Moldlasi AsfliMlte - Broker Singk Family HcHoe * New Osk Kitchen ^ 3lM»BadnM» * Lotsofltattt-iitt C Room 1800 East Ave. Rochestcr, New Ycrk M610 :-n>i>T^Ma^^j^jj^a^3aiite ' • Fiieplaoe . v 1033 Gteat for Hair Salon * Fireplace ft Suites KimUrly RusseUt 387-0500 Phone 716 244-6500 • Hon^. 716-987-84SV '^:n. Jif:. • ^liiivSiHlMMiiCMttai^ Doctor or Dentist * 3 Bdnn» I 1/2 Bath \2L AMotne/f "' OffioeorloUvcla «QA Ibr Mim Details mk v^ •.j^j**"'.".tx.'^'Vv^^ ''^••^/> .\- .:-'• , ^--^v't^/^^t) • Ma^rPbttibiltiks

.^:.,>^-;T'^. , ¥ ;• ^ / * '^^ejl^MlMa^lMtmA *Bli9iHgorSiffi^i«AMtiwdra««iy Bo eattar AUi Kodwier or tile Giy

'^v *••' •C -•'tV^'-1'".,"'-'''-"''^' -h^^^. .•<-J ^wsmmmmmmmmtmmmm g^y*!J!i''f.M'jH'"ii»ii I. ..t.ji

ii^ icin S«wd«y everting, Jul)' IB. CBTI ness and otttffBflcfa. Pfease caU the ,AftcrtheParadc,PFLAG wiU have a l^ick fo Rochester from Newr and 26 we'U be holding our first OR reach us throv^ regular mail by San Frandsco from its starting point by volunteers of die SF Club. The vkiht^tt^t^OAt^^ at die fodc City, vheie he waa ftcthre in the garage sale at 1361 Ric^peway Ave. wiidngus at Rochester Rangers, 1361 near Front Street, across to^^n to the group enjo^'cd wonderfid food and for itop-oiifist pidtTUpJkt^l -#478. \lBaiiaiS««%. W^ ^be diauibuting [.YX:. PFLAG* We are looking for- firom 9 ajEn. to 6 pan. There will be Ridgeway Ave. Rochester, N.Y. Padfic Ocean for a 7.5 mile course. entertainment. Dan*tfbfgeto>imousonJiily3|afid bur tMrochiires andPR-AG hand- to bia enthuaiasm and ei^er- lota o4 bargains f<^ you to cake ad­ 14615. Several unique chamcteriatics make Ao^. 1 fbrthesale. >ut». Btmipfef stkkers, buttons, and vantage of and well be sdltng sodas Thousands of nmncrs, inchiding We'd like to thank ever>'one who this race unlike any other, including die Frontnmners/Ffpntwalkers con­ We need YOU if yBfiia*«««a^ri- «u^gneta\Ktfl be anra^^ AtonrA^guat meeting Sgt. Chet^rl to evefy^me rade, and on Sunday \iill dis^y diem tradidoiis, and vviconieaa tcilxiaae» unteets. A spedal thanks goes out to and walkers. Costumes were as outlandish as gay '.•^*oc^n|irents» . -^'V^-v; -• people in tfae world and I had has finishechheir spring deaningand at the GAGV Picnic at Genesee regatdless of yanX e^^ons l^tfia- Scritiy Sale for die donation ofa safe The weekend began on Friday Halloween, and included the "Tow.-er of Pat- about hate crimes. Now Sgc. has a loc of dungs lying aroand that Valley Park. tion (or kck of ooe). W^avh^n^th fic^ our grand prize raffle. evening, with a welcoming reception of Pizza" (use ^•our imagination), a I Franks will pcovide nps to ua and our they don't know what to do widi us Sundap ar 5 p.m. in St. Lllke-S^ witlaa a piorftctiveand pn^cessivc Last but noc least, we*d like to centipede of spawning salmon that In between, the club has planned 'g^y cnttavcn. for all thc out-of-town Frontrunners Simon the Cyrene church, 17 S. £ai4i comaiuaity, we ^«kEo«t!d eiijoy -ana md G^ IMIS satiicibnced that anymore. Conoder donating daem congratulate Chip and Shari, our two an exciting variety of social events and local members. Hosted in thc actually ran in the opposite direction Fitzhugh St, across from die Mon­ the {^^porsumtjrto discuta the possi* Kirst0i IGngdbii haa^ itie^oHBe the M are wekxMxie, Come and leam to die Rangers for the gvtage sale. To newest members, on the arrival of induding a pool party, barbcquc, rc­ home ofthe dub's president and his firom the finish to the starting line, a roe Count)' OflBce buildif^ After bi&taes for yqtur pkyji%Melaney* Deiaaney joins her brother cepdon and picnicv partner, it was a great ice breaker that thatched PoK-nesian Kon-llki hut services each weck,^pe iodalMte at a in% senfi^. 11iia.poncioitvd0t8iwvc ch^^^AunSr trnt^nj^jm^ An ath what yoa already kno^. Our meet* treasurer Paul at 647-6356 and he Chfistiopher at home. Both mother People's choice ballots distributed set thc mood for the entire weekend. on wheels that scr^xd peculiar tropi­ coffee hour, where >'OU *re wekcwhe compensiMmi baaed v^tfm -experi­ ings are on the laat Sunday of the wiU make arrangements for pickup* and dau^tter arc doii% wdl* Wd­ at the GAGV Picnic will determine Saturday moming began with a cal drinks along the way, and of to join us! ence. Foranoie tnfonnaooii« call us. lawjsiiiieaftilt^^^A^ moofMtfhCf ^sitnds MeetinsHowa^ August is sneaking up soon and as come to die Rangers, Dekney! thc ^i-inncrs of awards, induding best popular San Frandsco Frontrunner course, the obligators* naked "dare at 271-8478. Kingdon b a mot)=ier and gtand- 41 ^^stsmnste^ Rd. near East Ave. always, well be hosting our annual Hardtop, Best Convertible and the Hiis month we won't have a pot See you over the summer, keep tradidon, the Balloon run across the to go bare" runners (althou^ some We invite anyone to join us en mother viMo has been active in the htsim 2;30 - 5 p.m. See you there. Carmval on Aug. 16 at Tara Cocktail coveted Best of Shou'. luck dinner in deference to the Pride your eye on die Rangers and as al­ Golden Gate Bridge. This year ^-e cle^'c^ bare runners had tromp I'oeil Sundays for worship at 10:30 a.m* Washington. D.C. PFLAG chapter. Ix>unge on Liberty Pole Way* Well Anyone who owns a pre-1984 ve­ Picnic — see j'ou there! For genetal ways, remember, **You help as help celebrated San Frandsco's anniver­ Speedos painted across their bare (Traditional Liturgical Service) and She sap: "I ^xtM like PFJAG's Rochester be oflfering many of thc same games hide is invited to partidpate—dub queries about Dignit>'/Inti^^ty, uae others-" sary as the oldest Frontrxmncr chap­ middle). What a sight! Somehow, thc 6:30 p.jn. (Woxship and Praise Ser­ . voice to be so stronft rfiat whenever you have come to love over the years, membership is not required. For die D/IInfo^liae a^^2-2170, ter in the U.S., conveyed b)' the mes­ dt5''s clothing ordinances werc sus­ Butch-Fennme vice) at 175 Nocria Dfivc in che com­ *£amily values' are mcnuorici^ j»opfc Rangers the delidous food prepared by Al, as Frontrunners/ morc information, contact Rob 225- sage on our shirts, **TM*^:mty-five years pended for the day. Anyone interested in die fDrma- OpenArm^ munity of Cobbs HiU Park. For more think of us... We, and our gay and ihwin wrote, "Summertime, and well as last year's extremely popular 0769. of Rimnitig Queer." The group met Official Frontrunner events ended don of a Rochester Butch-Fenune information i^tout our ministries, call lesbian loved ones, arc truly an living is easy." Well summer's Flush'Em! We offer you the chance Frontwailcers at a paik adjacent to the Golden ^i-ith a picnic in*Golden Gate State Society? Wc know you're out dicrc, MCC us at (716)271-8478. American family voice." Kingdon and the Rangers aren't taking it to soak your most or least favorite The largest race in thc United States Gate Bridge where helium balloons Park, although many out of towners somewhere. Dignity-Integrity open Arms Metropolitan Commu­ has a gay son. iy. Well bc busy as ever this sum- bartender again. Tliis event U'as very this year Included a Rochestcr in rainbow colors were tied to the enjoyed Sunday evening in the Our communit)' needs a safe space Many queer folk arc surprised to leam nit)' church is gearing up for a grand "We're very pleased to have ler uith many events for you to take popular and the bartenders them­ Frontrunner who venmred actoss thc arms, hats, and shirts of all partici­ Castro, and participated in thc An­ akin to the N.Y.C. BFS in which to that homosexuality and religious he- opportunity. Wc would Ukc to give Kirsten Kingdon as executive direc­ in and opportunities for yosx to selves had a blast participating. We'll country for thc Bay to Breakers Race By Maxine McDonald pants, it then took off en masse nual Candle Light March to com­ proudly celebrate our uniqueness, licf and practice arc not mutually in­ everyone a chance to ^ back in the tor," PFLAG President Nancy leet us and find out wfaat we're aU also be offering our famous Margarita in San Francisco. More than just a closet for a significant event. It is our This is a busy season for the gay across thc Bridge, balloons bounc­ memorate AIDS \ncrims who arc no discuss our culture, issues, and his­ compatible. Certainly, unfortunate ^icDonald said. "She brings a ^-calth It. Bar. So join as on Aug. 16 on Tara's race, this was a long weekend of fim hope that you will go back in the chset community, as it is for parents and ing wildly in the wind. It was truly longer M-ith us. tory, and end oppressive isolation experiences we have had Vinth certain of knowledge of thc issues that im­ Look for thc Rangers on July 18, patio for an afternoon of fun. and adventure starting May 15 and and dean it out- families. As I am ^Titing this, we are one of the most memorable runs A contrast of emotions, but all in through socials/discussion oppor- "rdigious" people and congregations pact the lives ofgay. iesbian, bisexual larching in Rochester's Gay Pride Dofl*t forget to check out our ending May 18. Many thanks go out Open Arms MCC is seeking your getting ready to sell refreshments at we've ever experienced: a cr^-stal clear all, a hcart\varming and exhilarating mnirics. Serious replies only; contact have hdped foster this misconcep­ and transgender childrcn, and has ^aradc, and stick around afterwards award winning website formorcinfo to San Francisco Front Runners who predous donations for our upcom- the Rochestcr Gay Men's Chorus moming i*ith the San Francisco sky­ weekend of fun and fellowship. Out Kerry at (716)865-6761, or drop by tion. If you would like to continue (or demonstrated strong administrative it thc Cultxiral Festival at Village and upcoming events, pictures of hosted, guided and housed out of ingChurch Rummage Sale. ITiis year concert on June 20. By the rime }x>u line on one side, and the Pacific Pali­ thanks again to San Francisco thc Unbroken Threads social group start!) your spiriroal journey with an skills in her previous employment." »te Square where we'll be available our members, and past events: http:/ town guests for this ver\' special e\'ent. it •will bc held at a member's home on arc reading this, it ^ill have taken sades on thc other. Frontnmners for making it all hap­ tabic at thc GAGV Picnic July 19! accepting religious community, why Praising Kingdmi as a '*team bulkier," talk to you about the group and /fang2.com/"-rangers. If you would Nationally known, the Bay to s July 31 and Aug, 1 at 65 S. Winton place. I'm sure-^ve wiO have had an On Saturday evening, wc enjoyed pen and their gracious hospitality. not attend a Dignit>'-Integrity ser­ McDonald said PFLAG eageriy It we're about and how you can like more information about the Brcakci-s Race is not so much a race Rd. from 9 a.m. to 6 p.m. Picase give cnjo}'ab!c and cntertaitiing evening a pasta feed at the Han'cv Milk (Parts of this article nrre reprinted from Car Club vice? looks forward to her leadership. xome part ofour organization. Rangers you can email us at as it is a happening — more like a consideration to making a tax de­ and put some money into our trea­ School, coordinated and prepared Atlanta Frontmnners newsletter.) The Lambda Car Qub's Classic Car DI is a living faith community of Our Rochester chapter is pleased [email protected] moving Mardi Gras that traverses ductible contribution of items for us sury to support our mission. Then on die weekend of July 25 Show is an integral part ofRochcstcr's ga^'S, lesbians, bisexuals, transgender to welcome our national vice presi­ to sdl during this event. Donations Our next project is the Gay Pride Gay Pride Weekend, July 18 and 19. people and friends who worship dent to Rochester, Sv Zivan has Om Saturday, July \ft, participants openly »fitVi each otVict. Wc celebrate arc already conung forth to help raise festivities Injuly. We ^"111 be march- ^1 : *•, ^ **Uo8rbekttt,neCi99M*' ric red! ble iN I 11\ Vr t.^\V t A CowTTTH FOR OAY L£JMAN AM> DISCXUAL CONCBIM and dig out al) your treasures! Rummage CoRDIyM^LY (NVITES YOU TO JoiN \Js Geri Stanton FOa 5UM>AY VoaJMW* EACH VffiK AT I0:30AM, COFFH MOi* TO FOLLOV SaSe! As A NtMJCH or TME LWTAIUAN U^-tlUALlST AiSOOATlCN Ve CO\/tNAW TO AFFRM AM> PHOMDTE Mdmf ik imtmedmf TME r•^ERENT VORTM ANO DKMTY Of EVtRY POSON S$l9i Jmtf9ti,ttmttMtt Flll5T UNIVEI15ALI5T CHUIICH W'*O^n Out Gsy Men^s Group Isme UO 5. CUNTON AT ComiT 34 Relationships, Sq)aration, r(i. t" ^I i ira Hofrt* Drfv« (mar CoM» HW Pmk) Self-Esteem, Abuse, and Uoilu «BKeily,C$W (Roman Cathoiic-Episcopai) Sexual Orientation TDD (716) 533-2041 71ft.327-2121 Mr [email protected] Wob SiK www.9Boc«B».comArtle8, Grotqw "f^Msldip: l Lancuaee^IVoBcient years (716)385-4735 p pur com^iumtxL '^flm^'mmmmmmmmmmmmtmimmmtlim ^*" .^''*. •.* .-.fi^-f-"-*.. mmuti 'I'r '•••m'Mfmmm

;^>^i^: morc informadcMi, call Kerry, fadit-* 234-3381 to find out this week's Sheraton. More on dMt in August. PLAGAL BIS tator, at (716)-S65-6761 and leave a The CKofua has hmda ticw office Unbroken movie. AU are wdcome to join us. PLAGAL (Pfo-LifeAIBanccofGays, message, or send e-mail to Kerry at tnanagcr tc3K hancMe the day to ' at 442- Empire Bears otdcfft .fog: •giitth;.^dMta. Ibrvami .....^ •••/': •^.;' Pride! This July, celebrate that crafty 6399. PO Box 10035, Rochester NY The Empire Bears have begliti an^ yeaf^-tMet'CEhs^Tira^^ ^jaam-'fi sfHrit and come one, come all to thc Rochestir Oi^ ^s t4«0 or FLAGAL National office. other busy sununer. Thc end of June tnottcfr &td pm iiibft^ two July meetings of UnBroken Men's Civftrus FQ Box 33292; Washington, DC. Thrcadsl featured our camping weekend in the events tat Ae atavt of jtlieM^al^iAtr- next aeason. Mew ntcmfoeis are al­ 20W3; (202) 223-6697. If jrou love arts and crafts or wilds of Orleans County, just west of THANK YOU to all o£ our Jo^ ways wekfMne. We warit ytwrf needleart projects, want to make your die dvilized Monroe countryside. Hot fims. A sellout crowd saw die Roch­ Hi^spitai visiting i... ; sweetie a ninbow bow tie, have some showers, warm pool, barbecue, cold estcr Gay Men's Chorus and Rodies­ Wevtstt pe<^>le at Monxoe Conmnu- rainbow fabric you're just dying to drinks, and hot men. ^liat a wcek^ ter Women's Community Chorus nlty Hospita] ar vaning times. We end* host Singing Out: die G^ and Les­ Latino ^fission la a gay and ksbtan make a flag wich^ or want a safe space grot^^fbr Hispanics, aldiou^ ever)*- meet awesome people ^rtio love visi­ Injuly, we look forward to more bian Chorus ofToronto, on June 20 in which your group can fimously one is welcome to foin us. (Wc hate tors and need friends* This is a great camping. Empire Bears have a site at School of the Arts. paint, glue, and tape together diis discrimination!) way, as a gay and lesbian community, year's winning Pride Parade float, reserved for thc second Bear Week­ Some beautiful music \(.*as made to bring happiness and joy into oth­ end of '98 at Hillside Campground. on stage that night. Each chorus per­ The grotip meets on die second UnBroken Threads is thc g^toup for and fburthThursda}'Sof each month ers' ttves and bring crecbbility to our you! These Bear weekends are sellouts at formed some favorites to an appre­ communiiy. Call Marie at 442-6399 the camp, with chousands ofgay men ciative cztTwd. RGMC brought back at the GAGV Communit)^ Center, Our regular membership is com­ 179 Adandc Ave*, from 7 to 9 p.m. fbr morc info. posed of both men and women and in attendance. We have a great time, thc dance routine "Pansies" to an­ other ovation. Cookies and |Hmch Our goals include socializing^ Women's hiking consists of nccdlccraftcrs and arts & and welcome new tnembers who -<••>• learning about different issues of Join thc Women's Hiking Group on crafts fanatics... We again need more would like to join us. Bears II at werc shared in the lobby after thc common interest, and making fdends our bi-monthly hikes. We have a great people to enrich our repertoire! Ev­ Hillside will bc July 17-19. Wc aiso performance. Thanks for your sup­ in a supportive atmosphere. bunch of fun women who love thc eryone, regardless of skill level, is plan to go to Darien Lake onjuly 25. port. If you want further information, outdoors. (We love children too, so encouraged to bring a current or new Meet at the main gate at 4 p.m. Rain RGMC has finally completed re­ write to Latino Mission, P.O. Box bring them!). project and all needed supplies. date Aug. 15, cording all the trades for our pte- 20510, Rochester N.Y 14602-0510, Wc explore various pAtks and have This year, wc arc proud to an­ As in past years, we've canceled miere CD. Now, ic's up co our direc­ or just show up at our next meeting. a great time. Wc ahx*a5"s look forward nounce that wc will have a table at our July meeting. We're also taking a tor, Nick Williams, and thc sound wc win be glad to sec you and say to new women joining the group, the Pride Picnic July 19 at Genesee couple of months off firom Second engineers at WTQCI to edit the nu* "Bienvenido atnigo" to you- call Donna at 442-6399. Valley Park. A Sit & Stitch section Saturday Foraging at thc Forum. But merous recordings, to pick and splice will be available throughout the look for us at thc GAGV Commu­ and play until it's as good as it gets. afternoon's festivities! If youVc ever nity Center on the first Wednesday We hope to have thc CD ready for been interested in learning the fim- of August, the Sth, at 7:30 p.m. Also sale in November, but each step takes damentals of basic counted cross in August, wc hope to go to the a lot oftime, and schedules are tight. stitch, please stop by, watch, and Renaissance Fesrival in Sterling on You can order your CD at presalc learn (and yes, you can even prac­ Aug. 9. Park Avenue Fest is a must prices by calling 423-0650. Or, look r, tteuABtJEr tice.*)- Information on thc group will on thc second. A concert ac the State for our booth at the Park Avenue MFFOROABU also bc available for those interested Fair is in thc plans, as well as attend­ Fest, the Gay Picnic, and Cornhill Fest. tmmoH t Mxmaoti MEET ROCHESTER MENI in learning morc about who we are/ ing Redwing arid Rhino games. There COMMERCIAL/ is another camping weekend, also. Injuly, RGMC will perform at thc what wc do. RESIDENflAL ..,ox\ MasterDate. Kochester© original way to have fun on the Call the Beariine at 234-3381 to get union of twoof our members Jason Our regular July meetings will be rovir B9 Oktd rou CoUmd updates or leave a message. and Matt. It promises to bc a glori­ phone! Browee. chat, match and even meet hundreds of Great held on July 6, and July 20 at the Vok* 2S8-4S21 ous ceremony at Sonnenburg Gar­ JPa««- S25-073A Guys right here in the Rocester area! Private, discreet and tons of GAGV Community' Center, 179 At­ Our Monday evening Bears at the dens with a reception ac Four Points '^ lantic Ave., from 7 p.m. to 9pjn. For Movies continues to bc popular. Call fun! Hey, we even offer a feature that will confidentially call your .' ^'~.. home if someone wants to chat. Call /*-36-e2B3 today for your ^olfffUfoojr FREE Trial MMtf^rehip. OViOe youVe %wer\ us a try. ifyou like the system {md ^jou will!), give us a caH at 464-0000 to become a member Vs^cV.aqe prices start at just 27* per minute. Fantasy AX\d Ihe Door Doclor fun are just a phone call away..... CELEBRATlNa OVER 45 YEARS IN BUSINESS Use Free CMte: 9M9 2867 •»-^^^^ 668 BIOSSOM na (CORNER OF WINTON &BLOSS0M)

SIX MOMTMS SAMBAS CASH PINANCINO SN ALL *«.. INSTALLED CLOaAY OARAOB DOORS ANU QPENBRS (••iV

TOIIKnttEOUfKr II i: •t Voice PcrsinuuMs for a Rodiester relatiotiship call23S»IIIIfree! Rochester's newest, most exciting dateline. The fun way. to Mary M. Smith, R.N. meet somone new locaiiy. It's free to listen to other people's ads and even to record yours! Choose firom thousands of local Psychotherapist peraooia ads to finil the person who's right for you. It's •'ii*r'". ..•• .. privale...you can taice tlie time to get to know someone firom Specializing in Individual and Gouple Therapy thc jMrivacy of your own home!

•^•^ To makektttg lasting friettds caUfree... YOUR HOME PETCARE Over 15 years e3- », » • Ul 253 Alexatider Street ; (716)fi52-^5l70 RQchcjsterJNfavJXork ^uiiiuz. Scale Fee (••- >•••- '«Giift«KMMi

•^^-m^^ '' '•»- < . ••?• •ft J ^4- •^Hi^H.tfUnvMtfMM"*'^'-'rrV'. tW. ~j4 --ni<«A--~< vwtvHT fj- f iP.«i." #jiwiHiirnw

ANNbUNCBMENTS plus ¥100 per day if called in for IMtaMocrferdkaEn^yc^ youR Bofccl? in need of dtsnactionMlie BM^ Cktet\m many eaKddngosks women preferred. One year mini­ CONFID to ke^ ypo iMuy and fiilfiikd (or at mum commitment. WiH cratn. CaU lease bosy). X!7^ need word pfoces- (617)524.©921. Rochester , •N pc?op!e sot* (hGcro9Qft^oEi4^,ma2icighelp- .•.••«L, • -v" •'-.• -; c£a» and tmich move. If youcao gpve ItallM 1^ IB -.«p:5^V\fC^ •%'r.~ is lookifsg Ibr heip actting Ad^iecixse^ l»rown, ea^dgw plniDfm^ *^9He^- two basics a moanh, csil Susan at ibcnts for our 6^ toagjcOut F3m WOMBN ian; ISO^e^Jpn^ phy, shoobns pool A tev- 244-S030. BIMWF 24, 5*9", 190 ing ftm; ISO G/BiP fbr (25-38) Bw JwMl lO«,lflfeC" MwSh and Vitko Fesdval in October. Well tio«Oiftflbrtfagk|fttM ^^sj^t!^.€*n. B»^ kxigblond/hazeU ISO hanging out, havtag ftm A '....,•%...-^.-^ Celt for ^ay and leabian ardets provide a list of past load wppottcn Bi/Bi-curious F (21-30) meeting new people. Age and ciaftefa. In conyuncdon with for discreet, first time en­ unimportant. #31> me how tofHOiiNvA sfefMK. and tnatetials; you distribute info, #949 die ICkh annual Baddies Summer answer quesdons, dose the deal and counter D & d free a must! WC ISO F to fulfill my emotional^ tectHv; !&0 teneii » libaifM&% busiiicss out of to^coffrtspond With and possiMy visit. #4^ WWM ISO C with husbands fantasy. Not sanae inr ftieadsbip, poa- festival, come scO your wstcs at thc receive a cotnmission for each ad your home. Local independent dis* Will send phoco. John Lawson, #315- Bi-curious, Itsiiwo, F, looking for Bisexual ea- sibleLTR, »16t4 BiWM (25-45). Mvst be Brst ann^ial Festhral of Gny and Les­ sold. Interested? Call our office at tributof, (716)367-958Z 009, PO Box 5500, Chillicothe OH mid-20's. ISO anocher Bi- counter. ^^'^^^ Thia cxtreflMl^ wIM healthy A discteet! #B21 iBtti»4>»e20rfc»iiiiMhto WM,U9^iO>,idhntoav. Price curious F for friendship & MWBiM 45, ISO ether hasr f^ fftteddMj^ A ocogo ;wei^ A well* bian Aittsts and Crafccfs^ Johnson 271-2640 and leave your name and Haa dutter got you down? I will 45601. BiF 23, 5*4", 100 Ibs^ SWC is ISO F for fiot I rhLwAt-d admire$5 tt>rthe famasy fuiritlmenl. Must timesl #1468 Bi/GM*s or Cs for oarly fiist timo compassionate SL honest Bthi>tir,huro«t»u*CISO inionnadon, call (715)881-6126 af­ not bOl fttr cJaimflQclm $(tpka$6 shon blond/hazel. ISO an­ for companionship. Must same to watch A be Bt-enrtoBB AfffWM, S0» i^tmt aipe w^ll^ for jg^#(^ «4r Jle^rt, clean, tvia- [ Body/masacie nibs. Gee rubbed you never knew >^u had. Will build that can make me as happy I M'ill try #267 atnd ttt brin^ 3d and payment other SWF to fulfill my ben/s.d&dfitt!c #485 watched. Mustbe discreet, clean, heahhy, dtsciecl, BIWPMt dih Atttwmtf limeenysijyectOBOl^: ter 5 pm and ask for Frank, or wrate thc rig^t way! My many repeat cus- shdves, do minor repairs. Insured, to make you- Randy Francis boyfriends fantasy. »1000 Bi's are always welcome. ISO same for first time greeiit lOOIbs^dAdlloe. liWM^S*l*^,|uifiry Rainbow Pride Gift Shop, 266 t(> ihc KC, 1 "9 Arkmtk Avt, F 25,5'10", 240 Ibs^ out­ totnets know the benefit of a great have references. 234-1896. #104533, WKCC B-1-4, Box 5000, Rc>chc»TerN>'i46t*T Thc Attractive BF, 30, ISO going, ISO F for new expe­ #876 French A Creek encoiua- caring, has hbnesttdttnc* cMe«» good shape; ISO SO^t^ aanae or C ftirne w tigsat your phice- t694L_ experiences. If interested, Elmwood Ave. #233, Buffalo NY hands-on experience. Discreet, deadline is the 15di ofthe atlracfive African Ameri­ rience & discreet tt^lation- Afrlean Anwrlcan GF, ter. If yo«*ie toohmg for snbmisftive CD rw new Exotic full body oil mb. In the Edd>'ville KY 42038-5000. leave message as to how 14222. Deadline is postmark July mrmrh, ft>r the f<*n<>wifig can F for discieet. fun, & ship. Leave a message in 38, shofi brown/big blown M3t,5*7*M70lha^datk/ sotnething special ia your expenences. Must be friendly, handsome, skillful GWM, complete privacy of my home, by ROOMMATES/ hot conversation. Give mc life then la's taik!#S67 chMn A jfecteet. f7S8 you can be reacbed! #241 BM ISO CD/TV Ihat's my box. #687 eyes, medium build, 145 darit. muscular, mascu­ clean, discreet, passable A !5. 5'9"^ 155 lbs., accepts appointmcn*3 fn(*nth'» istvc. Wc csmmx acall! #969 line, A auractive: ISO very experienced and good looking HOUSEMATES F 23,5'4", blond/hazd, lbs.; ISO someone to Hot*' hnlrjr ttftlten, V^ folMRtwivo, WM, OaBdhinMMgMWM,44> sexy. Let's get together A Accept ads mer che phone. Vl'c muscutsr, masculine, at­ HELPWANTED in my home or yours. Reasonable trim guy catering to you slim or well F 28, 5'6*% caramel ISO W/IiaiianSF (20-25) spend quality tinie with, SWM, 5'4", 150 Hw.. 25, eover. Often mioded, ISddilciweiMftr fantasy have some erotic passion- GWM, slim, attracdve, profes­ publiiik 6PIX suh hMffmptter*. brown skin, brown eyes. enjoys walks, movies A tractive. Mv with blond/ brown/bltte; ISO yomqrer adventttfont; ISO older. ftdffltmcnt. #tOO ale, fun. You won't bc dis- Disabled leabian activist*au« rates. Six years* experience. For the defined guys 35 and under. Surpris­ on « Bpacc-aA'ailablc b^nds: for friendship, possible light (under 30) who*s not sional looking for slim or well-de­ very caring, compassion­ relationship. #2180 woriting out. #147_ M's fbrsaCb. mutuid, fun! dontii>Bnt.OWM^KiffK- BM 21* 5*8", 125 lbs„ appoimed! #1179 thor living in Jamaica Plain (Bos­ best> call (716)235-6688 today! into bars or head games! nanaii(SO«-) fbr Htmrnf, A discteet A tiifcs in thc Buf­ ingly vcry inexpensive rates. Gtiaran- fined male 25 or under only to rent ate. St new to Rochester ISO F*a that are Articu­ measure loving PWC, #sw BiWM 39, ISO older area; ISO masculine GF's #571 strict leaoBft. rttiiHaitfity, falo area; ISO other B/H ton), Mass., seeks woman to live-in Macintosh computer tutoring tccd to meet all your expcctarions. large furnished room in three-stor\' late, into physical fitness, ISOd Ad free BiWF(30- BiBM 18. ISO phone teacbsne! friends. If you're inter- BiM with pornography, (26+) 5'7" or taller, who imelligent, mature SL dis­ 35) tfaotf's willing lo com­ Attractive, n/a, movies A a place of their to do housekeeping Mon.-Fri. mom* and aaaistance. Will provide new Available every day and evenig. CaD townhouse. Must bc open-minded aie caring, giving. & com­ eowversnaoASt possible esied give meacaH A we'll Informarion creet. Ifyou are that pei^wn plete our menage a trois MWBtM, 40.6'0\ slen­ WPM 52,6*0**, 150 His^ own for hot, oral fun!#845 ings, leatn personal care, and carry passionate^ #606 encounters. Must be (IS- ^intouch! _*49 Mac set up and internet help. Also, Kyle, (716)865-2851. and easy-going. $295 indudes utili­ please call! #2853 fantasy. #834 der, with very long brown 21), straight acting, d A d d A d ftee, classy guy who Wt unR accept i\niy Acls MBiWM 45, ISO C for beeper to provide emergency per­ QXP, Photoshop, Netscape. 525 per SBF ISO someone to hair, no facial hair, A littie free. #400 enjoys life's charms; ISO BiWM ISO BIWM for 'etsitter/houaesitter. Rcspon- ties or ver^' possible reducrion in rent acccmpanirj by a munc and SBF carly 30's, sexy, nice Hello ladies! i am a BiF. body hair; ISO soft, femi­ earty moming/eariy aflerr sonal care backup if a regular per­ spend quiet times wirh. looking: iSO Fof any age. 26, measurements 38B- Attractive MWC, she's similar M to odd spice A foot worship A discreet noon, weekday encoun- hour. Brad, 262-3966. j sible, love animals, ynU do daily visit of 5195 in retum for light clennitift phone number, Neidier wiH be who likes to sit & cool out; nine, M, for daytime fun! 39, he's 4 L ISO attractive flavoring to it! #10S6 sexual encounlere. #1647 sonal care assistant is ill. Free room pubtished, but we imitft be abk race, size for first time en­ 26-40, very pretty A open #558 tgre. #785 Super bluegreen algae. Com­ or stay at your home. Have refer­ and full body sensuous mbs. Student hoping that I coutd tnake counter! Muse be d A d minded; ISO other similar BM for fantasy fulfill­ TS ISO nrst real iioy- SGWM 21, 5*11**, 155 Mature WM, 50*s, ISO in big Victorian house with garden, tt» ocmliirm pfacemeftt. The someone happy & thcy Ibs^ brown/brown, ISO monly reported benefits: Feelings of ences. 234-1896. OK. (716)581-2282. free, pretty, clean A dis- F's who would like to have ment; #390 Mend! Very passable, 25, well-built, well equipped. llnipfy (3t»v^ is mH could make me happy dominani Bi/GM's (18- close to public transportation, resi­ creet. #2828 sofTK fun with no strings Attractive WM, ISO two 5*6", ISO lbs, smooth, A WM^s(25-50)seekingful! increased energy, vitality and Housekeeping and yard work. Housemate wanted to share teKponitft>lc tor any 6aandat also! 1 don't mind chil- attached. _J!.14J or more attractive, young long blond hair; ISO M 24) wbo like lo have a good dent parking, own entrance plus kMA cir physioil iniury ihtft ttK^ dren. #1096 F 21,1 have a boyfrimd lime A hang out for pos­ famasy body rubs. #754 stamina; improved memor>*^and con­ Will do some painting. Odds and cozy, comfortable house in N.E. dt}'. tooking, Bi-curious WM's who is cool, kind, consid­ reitutt frntti any ewttact with . but I am looking foragirl- Vcr7 attractive HF, ISO sible tttlalBottslup. No fats MBIM 29,180 Ibs^ ISO cable TV, plus $1,000/month clear. centration; a stronger immune sys- Attractive, stender, WL, friend; ISO hot lady to very feminine A aitiactive for exploration of new erate, A caring. No one same for discreet, safe, ends things that you don't have rime GM seeks responsible male or fe­ an aJvenwer. Adveitdacrs mtaat night stands! #W7 or terns ptatte. #1604 blond/blue, d & d free; ISO spice up my day life! W/HFoftly No games. C's ideas! Mustbe dean Adis- dayiime fun. Must be to do. Call Jeff at 581 -0013, or Sandy male, non-smoker, Hght/non- ujic cheir own bos mmiber, d&d free, feminine, U creet. #340 MBiWM 30, ISO #2834 Of Bi's. 1t3S0 Champaign taste? GWM straight acting A no at 663-7153. drinker. Resident feline, laundr\', Vt vice Mail tve pcndoat BiF, (28-40) for intimate, Bi-curio«KWF,5'3\ ISO Sexy BiWF, 21, long BICD 42, ISO older M^ blond/blue, ISO GWM PMBiWM who's dis­ strings attached. #tt6 PERSONALS storage, yard, private and quiet. $280 addmut/pbtHtc tMndier. discreet, times. No men lbs., blond/brown, ISO Bi/ brown/grvett: ISO B/WF (55-*) for fun times! #328 (28-35) who prefers the creel, good looking, in please. #370 finer things in life! #1569 shape, who conies to town SulMniasive, young, WM, Bi-curious F for encoun­ for exotic times. #232 Dotninakit WM. 40, ISO 25, tikes to dress up like a Swedish guy, 30, tall, slim lauper. plus. Serious calls only. 266-3443. younger, submissive, M, BiWM 26, 5*10", 165 on business A just wants to Attractive MWC, 3! & ters A three some with my AUnictlve, BI-curloM, get together on a periodi­ girl A bc tteated like ope; likes sports, swimming, music, is FOR RENT hook-up. Air conditioning, water 32, ISO other attractive husband. If this sounds WF,2l,ISOsame(2l-25) in good shape for faniasy lba,,othSetic A masculine; lSOcdderM(454^forfen' ISO BiWM (18-28) with cal basis. Must be d A d looking for friend/friends. Exchange House for rent: three bedrooms, included. Quiet neighborhood. C's forerotic. fantasy, CR- like fun give me a call! for fantasy fulfillment. fulfillment! #133 free. #1507 tasy ftilfillment. #j»4 pioration! #958 lean, hot, muscular, body #2706 Must be attractive, slim A Fill the need to know! PM 37, 5'5'*, 180 Ibs^ visit possible after a while. Reply in one bath, living room with Phone 586-0185, call for appoint­ fenumne^ #525 for fun! No fats at all BiWM 40,5*r MOO Ibs^ Very, very, pretty F, ISO Attractive, model F, 50, BiWM 5'7M42 lbs., ISO vcry discrsct; ISO bears, English, German or Dutch toTorsten woodbuming fireplace, hardwood ment. $67S/month. another spects^ F to share BIMWF ISO mmi-curi- very curious M (18-27) please. #y«»__ very clean A very discreet: 5'V,brownAwown, from cubs, daddies or older M's Lcdcr, Dc Jister.39, 9255 KM a very unique fantasy with Buffalo, loves the out­ oosF( 18-35) for fun times who would like to talk, WM 5'8", 240 lbs., ISOanotherBiWM foroc- for discgpet times. #349 Boors in updated kitchen, wall to EUison St.: Gardener wanted possibly meet. Race unim­ casionai. discreet, inti- my partner A mc; we're doors, smoker not a A friendship with her brown/hazel, into the out­ M 21,6'1M75 ttM^good Tytsjerk, The Netherlands. wall carpeting throughout, formal for nice rvro bedroom upper u-ith very clean & happy drinker: ISO F's of any mate. . #1^44 portant, students are wei- doors; ISO sotneone who's mate« encounters. #705 ^mc!_ #1594 shape, good looking A 1 The foUowingprisoners are lonely diningroom, 1.5 cargaragc, full base­ private garden to toil in. Offstreet people. We hope to meet race. #2658 SWF 22, ISO F for fun, straight acting! #1055 WTV ISO other femmic just want to check out and would appreciate hearing someone soon! #773 Attractive BiWF, 2S, ISO friendship A more! #507 MM above average, ISO GWM 38, average boUd, TV VCD's for sexy giri otherguys out there A talce ment. Nice neighborhood. Convc- . paridng, laundr\- hook-up, updated BiHF 5'8'M50 Ihs., ISO same for special friend- Attractive WC, ISO ma^ discreet, Bi relationship ISO other M's (19-35). talk A femmie dress up it fram there. Get back! from anyone who will write: nient location near thc U. of R. and kitchen with appliances, hardwood, Bi/Bi-curious. sexy. F, for with cyrv/CD's in good Call me! #1026 fun! #516 ship. possible LTR. #2466 ture BiF for explicit, inu- GM 35, medhm buUd, aM^ OpetUy gay man, 40» looking for 390. Rent is $750 plus utilities. Pieasc low utilities. Available 7/15. $425 encounters & threesome LT ISO suae, any race, tualfnn. #2044 ISO other Bi/GM*$ for in­ shape A above average! Early 30's WC, ISO two Very good £ookfai« BM^ with my boyfriend. I love ^ #1374 21, iil^ going out, danc­ WM 23, 5*9*% 170 Ibe^ a friend to write. 5M0". 175 lbs., call (716)889-2235to inquire. plus. 529-4701 evenings. (30-40)n/d. n/s. very ac­ SWFISOSFtojoin her A timate talk, possible en- older BiM's to fulfill her nice body, nice person, to watch & bc watched! tive, feminine & spiritual. her boyfriend for fun, counters. #142 Honest, steccfc, caring, fimasy! #009 ing A doing fun things; brown hair, blue eyes. Freddy Room for rent. Cuh^er Rd. Off­ Upper apartment for rent. 774- #1466 ISO M that likes the same disease free; ISO older M Must like kids. #2450 friendship. #2049 TMskGatorAldabitet GWM, 27. ISO other Vvy nttraellve BM, 30, diings. Age. laoe unimpor­ to fondle A spoil me, Schneider, #474596, Sumter Correc­ street j>arking, walk-in doset. Must 776 University Ave. (near BF 36, very sexy, ISO Attractive SWC, ISO Attention Ladica & rm6'r, 146 lbs., blood/ GWM (25-35) for fneod- ISO TS/CD for fun times maybe with pftef #715 tanL #5, ..._ tional Insritution, PO Box 667, M's/BI-curious F's (36- siender, AF( 18-3S) forfun GentieNcs! if you'ns bcown. AI got it cai»'oo! ship. companionship, A Ahototghis! #77» like cats. Cable, private phone line, Merriman St.) Two bedrooms, full 38), for nice, compassion- A fantasy fulftllmem. looking for a sexy, pro­ Givemeacall. tfjMO, whacewr life hrings oat VM Bac, BiMawritCil^ Hey g»o% !*» a i^alBiB BushncU, FLA G-2106 33513. washer and dryer. $225 plus sccuritA- kitchen, lix-ing room, and bath­ way. MinlbeditdM,tto liisJwfc,25,5'IO",lB5 gny ISO file same, 15^ ttie. fun! #1207 #2378 vocative kiod of fun, Hot BIWM, V't'*, GWM, blond, brown e>'es, 6*1", for all. 654-9713, bar scenes, ao Ihia, A no iDBi., uvuwaieiwn, imnE- BM., 33* walM, bsoaniilia^ room. Atric for storage, off street GWPF 37, active & at­ MWC 32 & 36, F is very yoo* ve found it right here. brown/fe|«e« icnjja. ' . '" w-itjyp j^-maa, A vary n^ 215 lbs.. Into body building, not too parking, cats OK. $650 plus. Avail­ tractive, ISO same for in- Bi-curious; ISO C's for #1992 Canandaigua «»& ISO hMiolMiveftniwithiMfie" Hast Rochester. Three bedroom IbokiiiJfapetoheagfcom telligent conversation, friendship A fantasies. )^ GM*s for niglit tian^eo' ISO tfmitar! «7«9 big but not too small! Need someone' apartment. Appliances and laundn- able Aug. 1.461-1198. Bl-cnriotts F,13, ISO F yoa aoon! #1471 stimulating adventures A want to pieasc you! #2360 Bi/Bi-curious for friend- counters. #1001 local Bi/GM's for night BI-cttriaiM WM, eaHy potential romantic cn- sfaip A fun. #1550 nme tdeawneat #1167 ^0% ISO older M for Saaaathing dUftrenl counters. Whntaihout you? AttTACtlre FWC, she E GWM WrvAlKk 49'a. petite A Bi. he's tall, thin MMWMpMMMeCD, #918 Stonniag, sensuous, S'SMTOiba., ESQolherht A straight: ISO attractive, donfaiaal, F, ISO attrac­ shape GWM WHtMsn v«ryM9^IK>BilWC*s iWwlaoti •Imafft'A' BMB* Hot, extremely wild, adventurous, open tive, femintne SWF wbo is (18^5). #900 into miW. kinky, famasy GBM34,5M*MS0aB^ tachei; ISO M^ (25-40) MRrtha M. Howden, CSW, CASAC WC, ISO BtF who loves to minded, M/S BiF for LT, definitely serious about fun! tftsnefested leave me (HlV-f). heahhy, into wbo need understaiKhng SBM ISO TV for iMt, A moie! #1324 rock SL roll all night and discteet relationship. being suiiniissive. #1221 sensual, ciicoowii!r»!<9<8 atBfuingr. . healthy. GM's. with siRNloriittr- Rocliester, New York DanMe tfaeftin* WC 25 A curiaus F, race unimpor- you out there? dSQB .for early oKHning/earty i1ed|j4d^ftqo.#scieet 29lSOFfarfiMtatyfulfill- lanc. For exotic adven­ GWM U^ 5*ir*, ISS afternoon, twortdny «»- A fBa'i^'aMavB, KK^ mas- 716-272*1760 Voke 716-272-S9S6 FAX meat. #2178 ture^ #979 Iba^ attractivtt. healthy, ccnmefs. fWfv nRM|8»l«>llfffejif8> cattne, well ho% M, to fun, intelUgMt, romantic 26> fipr food ttierti: No thMO |he joaraay of Hte SGF pctHe, aoaing fn on MWF ISO sexy, attrac- Pnn ioviMB^^ayoitt widi! 1296 40 pretty fast. ISO that tive, strict A dominant F spontaneous, into movies, pMHin.lSO«wie.ra>nqt head gaaKS or LtR's, jnt special F I would like for her husband. #458 music, A tfSVversntion: iooking AoroomMlinmtt anod.. adnlesona. fun! 09m3r,f*tir,2OOAa„ some directions on how to M-eurtous F, very pretty, ISOGWM (21-28). #921 or relatiomhip; Tm jnst #MMwho-« someone that's also Bi- ship A new experiences. who's similar to we. #746 clean A diaemC Pleaae »hte*i itir fvp^fn^-^^'e-mf*^ curious for encounters A Must be vcry clean A n/s. This older MBfWM U leavcf hoac nnndirr.tnB 8ndBr27j possible thrcesonte. #476 ihitBiWhf' ISO oihen (504^) Ummh WM 42, no Ciyrv for iff;S5:n^ Rriariottifcip » PawHy Pria -» Hwttfjcirtteai Work Hdiotro|ik Bmtkwoifc }-sk;. S^miaUzi^lmW0rkff'mimdMdmtasmmilFmmme»iBm9€0mti^^ •cm ^-^^^^ Ptaehig ait ftdait d ffooohrhigyoigvot e boi Isoosy1M% •Cai tn^wrr 02^ par mimilo) IkMtpsf fl*wto^ it ^. iMtftoMyfraol You never spoak to ariyorte, arid yoiu fievor moai your ichmlMy, not •Tliaaa lo WOttMi tor yoB^ (Mhowoiday) t*- ovontoiJol>biiradwil bo ptacadif^fntjlt^riewspapersarotitdthoaioaalftochavga. to foMeviyeiir 11)0808080 fcoo. .^r •, „ n •>bO€iBil8lhf«io«P#8ralero(X)rdirigs to help ontico poople to rasp^ __^, fliteta aoMiiiaa: 1} A iBCOfdhlQ for a 20 word ad that gels pubWwd in Empty Ct^ as lAtoaiaiii tMOR' rinrtaMtwaBtito OutandAiMno. Mivo . a J a) Aaowl* g«ing <»«t altows youto te i abou yoiiiirtl a^ intcaB.«Mi • 0m$m '^^ ^^^ -^f**^\ JO, ^^MJMMBily Klynmie ftith e ^^.'T, — ^v.jff^m.'l' -'-wt-**!.. ^^ jHplftnlvfiioHioAHibMbiswilh > ' wMi:G«rMZWe6ftol.cMi Mm«vli0 «f Iho flMut bwci of on •^^^^^ MMltonofehtdaput 3 n r«f«tf Dr. Joseph Canzonori, Podlatrtet rr Origiii, 20 Cairn St Bdtthatnv New York tiiftsi ilorsitl i K ••- r^, BIB ^: .:S;-;'>«?^^-.--":'<--' • '- '" HM Women** Event, Women's ••"• :•• • r'S;?*'!'

^-'•^^ •'••• IP I II i» i!tH0^iiAm-ftia^i^i,tm,^ilm ^nce party, Seneai FaUs. (315)568- F^^i^...•••••> *»*i5^ BI9 Wi'.W . 41 V364. Spot^oiea by the Coalidon lot^ Les^ati Msilnfity. SATURDAY It NGOING f^akndat I iBkm AiliHKid I'eamRdchester SUNDIkY iGceatet RocfaeaAnr Gi^ and (kdlt^o«tft|sa>ent;8»^ Suppon/sooid group, meets diiid Leabian Huiinaaa Fioaitro Lo<^ Rit^ioit. Tb reg^cer caB Leslie fMT gay^^BSffle «id Ttif^dtvy^ fwn. For locadon call Ptofcssionals' sodai g^ibup. Second Apfcqt, 482-^56. ti^ipJI^Kodieater^ 1350 Dh^ Dal^ 589*9107, or e-mail Thursdays, 5:30-7 pm, cash bar. . DLAuhacl86^K)icoih Gatlerv OriEe, Memoria! Art Gal­ iiftiiill-|ii|-.i i • 'i • GafPfitfeStOfj^dmc Ibr Young I>o#mo^ ItatedftW^ ^ • ^ ^m. 442-2220.. Chikiren. 10 am. Borders Boc^ & Oairdi, 121 Rmtadit: zn- lery, 500 Unhfersity Ave. 234-8706. 1608. Wunaeii^ CcKouiMinity Chorua Caiegif ma Support Group of firstWomen's Rights QMivetuion Music. PiuneaaanrflUeiiA ^^feret Lanes, ReheaiHia ttkdi Wednesday, 6:30-9 Imt, dttfd'ilansdua, 5:30-7 pni, 1 ()l< mi iXDII'lXDlN IMON I I 1 ()} |l IN in Seneca FaUs, thtoo^ July 19. Gay PasiiilEy Chidi^. 1-4 pm, iS»fc,2iSl-2t75. pn^ 0# fbr locttkm. 924^144. ^siscopal DkKKse House, 935 East I-filhuy Rodhftm Qmton is expected CharkMDt Beach near latge pavilion. 2s36-5fm,}?mstiiBii4!)^i^ ng others, SpCMisotcd by GAGV. House, 41 Westminster. Last Sun* Coma jDot anAPhiy* Business VaDey boaid of diwdora Meet­ Latino Miaaion THURSDAY 2 president, and Eleanor Stneal, presi­ ings second Wednesdays, 7 pm, Second and fourth Thursdays, Lilith Fair. With Sarah dent. Fund for the Feminist Majors GAGV Community Center Lambda Car Ctub Qaaalc Car day. 234-0156 memiD^iMtt Mondays^ 7 pm, COAF Montteal trip. Call Da\nd ter, D%tti«y^Itttegrity m Adamk Ave. 244-8640. GAGV Communit\' Center, 179 At­ McLachlan, Natalie Merchant, ity. Free. Open House* 7 pm., 179 Adandc Show. Inchades driving in Piide Pa­ GAGv Commniity Cento; 179 At- G«^ AlccrtMAca AnouyiBooa lantic Ave.,7 pgn, CaB Jeny, 442- S., 232-3012. Bikea^OHi 5pm, St. Luke's/St. Simon Cyxene lamk Ave.Tom M^ 454^3609. Boimie Raitt, Trac^' Bonham, I^uryn V^DNESDAYIS Ave. Hosted by GAGV Board. rade. CaH Rob, 225-0t69. 7 pm^Umcacttn Chorda. 220 Waaon 2220. FRIDAY 3 by MeCB^j^iN^. Bikit^ at 10 ^ Oiuzdi, 17 S. Fttzhu^ Sc Every BaaafcaDy Trebtemaleeta band Hill, Heather Nova and others. Fin­ Empty Closet deftdiloe. Ad BlftCkftian Th«ttter *^9ioely Sober Finger Lakea Gay-Leabian So* Club Marcella. Starring Simone and Sister G^Bt Sauce. Cammuni^ Chtirch AA group, ctbttd meetings. AIDS dal Group Canandaigua. 7 p.m. $34 lawn; $49 letters to editor^ non-camera-ready Jufy 16-26. mi^mtt ^mt^Jidy 18 down East Ave. to Goodtnan, cnd-^ Soudi Ave. opposite Highland guests Aggy Dune, Darieiuie Lake, )7S NorriB Efchre, Cobbs HiR Rochester, 135© University Ave. Fast I^kiavs and diiid Tucsdra. Cai shell. Ticket Express, Ticketmaster, ads. 244-9030. 6 pm; July 19,7^0 pm; July 24,8 pm; ing at \'il$age Gate Square fbr Cid­ HbMsttal. 527-9364. (clnmging to Pandora Boxx, Miss Gay Rochester RiytyOJOacttiwiwiBtHP, Photo- Hk36am.,6£J0pm 271-8478; We«lnesday*s injanuary). Every Wednesday, noon to 1 pm. pl5) 536^5573 and ask for Sam Finger Lakes box office. tural Festh-aL Suppott Group for Parenta Ladyjane Fairchild, Ambrosia Salad, Forum *98. National conference July 26,3 pm. Mr atfdjf^he/fj^ 17, graphs, cameta-ncady ads. 244-9030. Gay Men'a AM^ioaca Ancury^ Ametican B^Hfiata Concerrked Edwatds, or xi^rite PO Box 941, NOW 1998 Women** Rights marking 150th anniversary of 8 pm; July 19, 3 pm; July 23, 8 pm; Sara Cytron and Toahi Reagon mtimM Who Have Loat Children Geneva KV 14456. NOss Upstate New York Armani. $5 Open Arms MCC Red ^l^jog* ITiiid Mondays, 7:30 pm. Webster First, third Wcdnesda)*s, 11 am- Convention and Vision Suninut. women's rights convention. Confer­ July 25,6 ptn. Psycho Beach Part)rj}vdy in concert. 8 pm, Mj-ndersc Acad- St. Lukc's/St. Simon Cyrene House, 57 Ambrose St. 442-5486, Womena* aocial at door. 10 pm- 12:30 am. All pro­ outing. 7:15 ptn. Must siga vp by Church, 17 S. Ficdiug^Sc 8:30 12:30 pm, Thitd Presbyterian Fourth Fridays. 7-9 pm, GAGV July 10-12, Four Points Rochester 16, 8 pm; July 18, 9:30 pm; July 25, ^mn' Auditorium. 105 Troj* St., Sen­ Unbroken ThstAda ceeds to benefit AIDS Rochester. ence Day debate on issues, open to July 19 to sk inlii the gcoupl 271- pm, 232-6720. Second, fburth Sun­ Cbntoi, 4 Me^ St. Sponsored by Community Center, 179 Atlantic Riverside Hotel. Historical tours public, and BlackwcU Institute on 9:30 pm; July 26,7:30 pm. 28 Lavi-n eca Falls. Ad\'ance dckets $15; $18 at First, diird Mondays^ 7-9 pm, Geticsev Rcgkxi Home Care. Free^ SATURDAY 4 8478. days. GAGV Commumty Center, 179 Ave. 244-8640. available July 13, 14. 15. (202)331- St. $10. 454-1260. door (if available). Tickets available 325-1880. SATUROAY Open Arms MCC Cookout women's health issues, U.of Roches­ V^DNESDAYU Gift l^rabiani, Biaexual AdanticAve. 0066; or contact wwrw.now.org/ ter River Campus. Lesbian feminist FRIDAY 17 at Silkix-ood Books and The Prid^ aM lUaflMla Aaaociation I^conttunnera/Fiontwaikera Gay/Leabian Al-Anon Party. 3 pm - ? Call 271-8478 for COAJP dlnnarr ouc 7 {xn. Prank Trian^Talk* First Unitarian Church, 220 S. conference .html writer and intemational activist Char­ Break a Sweat for Pride. lO pm^ Connection, or by mall from CLV. (CHJBFA) LGBT book discussion series. Last 6 pm run/walk; meet Geotge details. D., 720-9876. Eastman House parking lot. 461- Winton Rd. 7 pm. NONDAY 12 lotte Bunch is expected to take PO Box 517, Seneca Falls NY 13148 U. ofRochester. Sunda)'^. 5 pm, Monday, Borders Book;? Sc Music, THURSDAY JULY 9 Muthers. Dance party is co-spon- FRIDAY 25 Morcy 401. 275-9379. E-maifc 4246. RocJteater Rams bar night Third part.Sessions $50; 275-8799; ($2 processing fee per order). Spon­ 7*8:30 pm. Co-sponsored by Sanuday. 8 pm-2 am. Bachelor Fo­ Indigo Gifts. 7:30 pm. Finger COAPT-shirt making. Tom M., sored by GAGV. ESPA, COAP. $3 COAP vuUeyball/iKMil paxiy. G^[email protected] GAGV. Free. Biaexual Diacuaaion grot^ 454-3609. w\i'\*'. Forum98 .org at door. sored by thc Coalition for Lesbian Rodbeater Rangeta Last Wednesdays, T-9 pm, GAGV rum, 470 Uni\xfsit>' Ave. 271-6930. Lakes Performing Arts Center, Noon, pavid U 288*8758. TUESDAY LiUc Rainbow Alliance for dbe TUESDAY 14 ARI's Gay Bingo Night. "Beach Women*a Peaccland 1998. 'The Visibilit^', (315)568-9364. monddy bu»nc$s meeting, first Rocheater Gay Men'a Cbottia Community Center, 179 Atlantic Canandaigua. $23.50 and $31.50, Rochea«n JtBngers Garage Ave. Men and women welcome. Deaf NOW rally, Seneca FaUs. 11:30 Blanket Bingo," 6 pm, Schoo! ofthe fire still bums." Open campfire. July SUNDAY 19 Sundays, 4 pm, BacfaeiA/orldwide News, the Rochester Spa and Body Club« Eastman School of Oj>cn Arms MCC, 175 Norris odivisl. poal^tt Labelling onvdopes, 2-5 pm; bulk Gay and lesbian Suf^port Men Grievii^ Men Thursdays and Monda\*s, 7-9 pm, Music bookstore. Common Ground, Che Pride Connection, the MOCHA Do\i*ntou'n United Presbnerian Drive, Second, fourth Saturda\'^, 6 mailing uit August, issue^ 6:30-800 Ckoup First, third and fiifd* (if any) Tues­ Profect, Comniunity Health Network, Slice of Life, Cheesy Eddie's, and TriangI* Talk, an lnR»«nfll discussion M^M focuslno on books Third Ptesbyteiian Churdi, 4 Mc^ days, CHN, 758 South Ave. 7-8:30 Church, 121 N. Fitzhugh St. 7-9 pm. 271-8478. many other sites arotmd town! ond Issuos of partlculorrhtorost to tho^oy, losbkin, and btownwl pm. Peafi!|^withci0s.:wbo can help St. First and diini Mondavs, 7:30-9 pm. 787-8351; 244-9000. pm, Ramona, 244-1640. Empire Bears communiiy. Is hold at Borilors tholdst Monday ol oworif moMth^ with distfShei^oa aicg^Peatiy ficcdc^ pm,271-6513. St. Mary's Connecrion Foraging ar rhc Forum. Second 244-9030. Women'a baaketball For gays and lesbians, families and Saturdax's, Bachelor Forum, 470 All ovonts aro fro*^jinjropon to thoi^vblk. friends. Third Thursdays, 7-8:30 Universitx* Ave. Beariine: 234- Open A^i|| IlllOCCaaamuaily ftloinday wi Thursday nights, 7-9 pm>Downsuwn United Presbyte­ pm, 15 St. Mary's Place (near 3381. Church tliiliill^ljii Sale. 8 nn-5 rian C^uRcK 121 N. Fitzhugh St. GEVA.) 454-4573. BORDERS- pm. 60 W^ton nt. S. Also Aug. 1. BOOKS* MUSIC'CAFE Books (716) 292-5900 Music (716) 292-0070 1000 Hylan Driva, RodiostMr

.^mJk. t

^^••!*,

V ..^.. ¥i^ *>/-• •;>v •.•^ijft;-^ :T-'-(^\V- :, ;>;:«*v«9fc5>»:^• *>'^ J V L Y 1 ' 9:--'i::;'l;:# •.^.••:S;-.i

? > ^^••••'^^••i^ .'•••

»*•:?-• i : •/ fc^~/^v^T. J•-•:>.•;f'A-- b' .^^-s IW^?^

F-'-i Vt^iia s^i SCR

/ !-: ^'':'\n\ .:*:•*•• f-:''^^:0-^':'*' ^, uii any otuer pnone )Cm?:un rnineuion' ••'^'.•'I'^.f

Ifyou call them, their prices i^oige from $L99-$3*99 per minute! -•VV/ •-•^ Ev^n worse, on most of these services the guys are not even from •". -li^J^-Jii Rocheker. ^ if money is not)bject, go on...give 'em a call and enjoy getting screwed! M:> W^: "f^ 'w. *A-- •''''****.iW..- % i^i^^;^ in pr \ il don' IL. •t^-' i^*^'^ ...fflve us a '•^? •fe^.,• '•«^i2 'j-afc^.' -- MasterMinutes CHECK O^T OUR PRICESlf I! *iO^ for 90 Minutes (12< per minute) *30**f«M" 5 hours (100 per minute) * 100^ for 2 hours a day for 30 days (4* per minute) " ...to purchase MasterMinutes call 464-0000 fmti MaskrDate...Rochester'i Orifinal Connecti

», (nc. 184-. Cw

tw KliaK»W«LFi£,THE DOS VMS ftCMJjr 69 ittlEAO JM> UK "MM nasBMBLY HeAK >- §iMit$ omuM UP. we*VE nM,-ywMi0M» meregn&wiHtFtmj lUtf AU.-I>e-HHE. ttesEti tnrms tu. wrr tM^RC VEiCY i

'-'"^."••i-^: H .N-

. « * ^ctr- w «t' 13 mm .^*: g ft oni s- •.• WO«KAf 'wMlAt MET! I, I, i... UH. J^C#^/ UHgtl c#uu» I MTA S«,ft8AU.Y. JOSr...VMeRE AH I ? 1 JIMT...rU. «•; MMfi...! 19 HMdcKSft. o ai miiii|ipn" jipL Sta«y,AMD, UH...IKAU.Y, rn vum^m Hmt* m.aii 0 eCATf AMD nt MVr CRAKYAMP 9> B-^ iVllwr SUM. BUT I iHMe -.ii; ^ t WAHK MmA Tl«, at.

^4|i*#f/ c '•BTi RY. ./V -tiMCtt SYS!

^^•i'^^^

.i4j*Jri

•••'•V

'<^.

X

mm^^^ '««*''^ •>"I«IVliill WHn'^r -** .^Tw-*f*^W »^ ' *l J

8 **'*'i^^^'SKSS^^"^^^'?^^"""^'"^""*'*'^ •••••>:-•:•>••:•:••-t--' •^3:^^

• • " '"S^j • . .-'^-C' ^^-^'^Z^^ «M11«N|

l^G^>tOtttCkt^otlt*t€$Sforihofirti30vmki ^.' mrjtttddilimtai10manbJs$UTl>td$adiimisSk»tSth tfHk mmOhfor thefoUttt^ ittottfh's isstnt, attd eOl rwqKttmvtrti far the CksSt^ srt^tott t^piy. Send or '

v SBRVICES Body/muade rtiba. Get rubbed d>c rij^ ^ay! My many repeat customers know thc ben­ efit 6f a great hands-on experience. Discreet, fnendly, handsome, skillful GWM, .^9**, 155 The tt|B» AOAM GAY VH>EO DIREC- Q>s.» accepts appointments at my hotne oryours. TOI|Ki|MrlM»t and UQOM* y^! reasonable rates, six years experience. For die best, call (716)235-6688 today. Inlaiws Tlmwifta, : HOT OIL RUB. $l5/hour, students rate Pot^f^^ai F^MHw and $12/hour. Affordable, very relaxing and scnsu- VMi^^lr^MM. TTie expanded PerffMMT Motatx to spc^light AGV19MMiK10Ry ^^^^g;JuU-body rub, dqne on on table. Many rndw»jq|^pjf favorite stars pius 1 r^>eat clients. Discietipri assured. For appoint­ a com^m Jlivarda section and ment call (716)325-7241 Monday-Thursday 10- acQoh T>bd(6s'ol the coming Ptease'send me copicg dyour 1998 ADAM n pm, year's tte ihovies, an index of GAY VIDEO DIRECTORY at $m^ each. &c(asadte$__. pchadtamoney outer piymcrt Sensuona liiil lindy deep nrnade Swedish IMrebtocf; and ttie most com-: pTOhyy»»r private toxmhouse in thet Chadotte area. Swed- portt'irtap WHt XXX-actton pho­ Address: ^i-—^— • -Ish rub has been ganing anewtcsurgence and tos. t)&ni1 miss out! Order HCTHX GJty:___^ State: Zip: respea as a definite method of facibtaung heal­ Signature: ing. It releases tension and muscle pain and I oarWy *wl I am IS l^w* ct orowwr- taign^xiMS. gready improves circuladon and reduces men­ Otft.3YJ o.e5 irik-iAi tal and physical 6irigue. Affordable rates, also student rates. Available seven davs a week from 7 am to 10 pm, In calls oniy. Discredon assured. Call Marie, (716)581-2282. Ultimate in body/muscle rub. Done by good looking male. Experience a full hour of sensous dccp-musdc fub done in your home. Reasonable rates. Confidentiality assured. For appointment page 936-8485.

ADULT VIDEO Open 24 ^:.." • m. Hours SALE HARDHUNK t.~^7j-*-f^'^ newssT ftELEAsee BEST SELLERS e/VFE $29.95 : ALWAYS OPEN! : MEBT SELECTION IN TOWN SS.*!^ 4 TO tf ML XXX->>* $19JS : HEAD HONCHO : SPBCIAL INnKBSX334M 11-800-511 HUNK- : THE BATHOUSE : : 1-900-993-8980 : • BOYS 4 BEARS ; ; i..664-4^C-3763 : ^^:>sj*:'/'-' '••'i..

- •'?,- ^^-^ ->-?•" -••J- . •• ^"•ii>i ••- •,. If-'.' •• •' 2296 • of AIDS » fc t ^ ';^.:;^M^:: 716.442.2220 TOP/BOTTOMS : glbreach@aidsn>chester.org 1-473-407-9551 :

t ' > •• ; -< ^f Have yau heard the fabulaus ^OUT Our rates are newsf YeUR AD the laweit in can reach an Empty Closet advertlsli|g SMpplement thausands af peaple manthig thraugh the EMPTY CLeSET supplement!