OXCT1 antibody - middle region (ARP48481_P050) Data Sheet

Product Number ARP48481_P050 Product Name OXCT1 antibody - middle region (ARP48481_P050) Size 50ug Gene Symbol OXCT1 Alias Symbols OXCT; SCOT Nucleotide Accession# NM_000436 Protein Size (# AA) 520 amino acids Molecular Weight 52kDa Product Format Lyophilized powder NCBI Gene Id 5019 Host Rabbit Clonality Polyclonal Official Gene Full Name 3-oxoacid CoA transferase 1 This is a rabbit polyclonal antibody against OXCT1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN Target Reference Fukao,T., (2007) Mol. Genet. Metab. 92 (3), 216-221 CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.This gene encodes a member of the 3-oxoacid CoA- transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central Description of Target role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl- CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency.This gene encodes a member of the 3-oxoacid CoA-transferase gene family. The encoded protein is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate. Mutations in this gene are associated with succinyl CoA:3-oxoacid CoA transferase deficiency. Reconstitution and Add 50 ul of distilled water. Final anti-OXCT1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-OXCT1 antibody is Catalog # AAP48481 (Previous Catalog # AAPY01422) Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1 Swissprot Id P55809 Protein Name Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Protein Accession # NP_000427 Purification Affinity Purified Species Reactivity Yeast, Rat, Human, Rabbit, Guinea pig, Bovine, Mouse, Zebrafish, Dog, Horse Application WB Predicted Homology Based on Immunogen Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Zebrafish: 92% Sequence

Human HepG2 WB Suggested Anti-OXCT1 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate

Image 1

Rat kidney

OXCT1 antibody - middle region Image 2 (ARP48481_P050) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.