Anti-GABRE Monoclonal Antibody, Clone 2H22 (DCABH-11655) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-GABRE monoclonal antibody, clone 2H22 (DCABH-11655) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description The product of this gene belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants have been identified, but only one is thought to encode a protein.

Immunogen GABRE (AAH59376.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG2a

Source/Host Mouse

Species Reactivity Human

Clone 2H22

Conjugate Unconjugated

Applications Western Blot (Recombinant protein); ELISA

Sequence Similarities MLSKVLPVFLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRV GKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVE

Size 1 ea

Buffer In 1x PBS, pH 7.4

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

GENE INFORMATION

Gene Name GABRE gamma-aminobutyric acid (GABA) A receptor, epsilon [ Homo sapiens ]

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Synonyms GABRE; gamma-aminobutyric acid (GABA) A receptor, epsilon; gamma-aminobutyric acid receptor subunit epsilon; GABA(A) receptor; epsilon; GABA(A) receptor, epsilon; GABA(A) receptor subunit epsilon;

Entrez Gene ID 2564

Protein Refseq NP_004952

UniProt ID P78334

Chromosome Location Xq28

Pathway GABAergic synapse, organism-specific biosystem; GABAergic synapse, conserved biosystem; Morphine addiction, organism-specific biosystem; Morphine addiction, conserved biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand- receptor interaction, conserved biosystem; Nicotine addiction, organism-specific biosystem;

Function GABA-A receptor activity; chloride channel activity; extracellular ligand-gated ion channel activity; ion channel activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]