WBP2 Monoclonal Antibody (M02), Clone 3B1

WBP2 monoclonal antibody (M02), clone 3B1

Catalog # : H00023558-M02 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a full-length recombinant Western Blot (Transfected lysate) Description: WBP2.

Immunogen: WBP2 (AAH10616, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTV YLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA GGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSY enlarge MPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQ Western Blot (Recombinant PPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMP protein) TSQPPPPPYYPPEDKKTQ Immunofluorescence Host: Mouse

Reactivity: Human

Isotype: IgG2a Kappa

Quality Control Antibody Reactive Against Recombinant Protein. enlarge Testing: ELISA

Western Blot detection against Immunogen (54.45 KDa) .

Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Publication Reference 1. Tyrosine phosphorylation of transcriptional coactivator WW-domain binding protein 2 regulates estrogen receptor α function in breast cancer via the Wnt pathway. Lim SK, Orhant-Prioux M, Toy W, Tan KY, Lim YP.FASEB J. 2011 Sep;25(9):3004-18. Epub 2011 Jun 3. 2. WW domain-mediated interaction with Wbp2 is important for the oncogenic property of TAZ. Chan SW, Lim CJ, Huang C, Chong YF, Gunaratne HJ, Hogue KA, Blackstock WP, Page 1 of 3 2016/5/23 Harvey KF, Hong W.Oncogene. 2010 Oct 25. [Epub ahead of print]

Applications Western Blot (Transfected lysate)

Western Blot analysis of WBP2 expression in transfected 293T cell line by WBP2 monoclonal antibody (M02), clone 3B1.

Lane 1: WBP2 transfected lysate (Predicted MW: 28.1 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Immunofluorescence

enlarge this image Immunofluorescence of monoclonal antibody to WBP2 on HeLa cell . [antibody concentration 10 ug/ml] Protocol Download

ELISA

Gene Information

Entrez GeneID: 23558

GeneBank BC010616 Accession#:

Protein AAH10616 Accession#:

Gene Name: WBP2

Gene Alias: MGC18269,WBP-2

Gene WW domain binding protein 2 Description:

Omim ID: 606962 Page 2 of 3 2016/5/23 Gene Ontology: Hyperlink

Gene Summary: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein, which binds to the WW domain of Yes kinase-associated protein by its PY motifs. The function of this protein has not been determined. [provided by RefSeq

Other - Designations:

Page 3 of 3 2016/5/23