ALL QUIET ON THE ISIS FRONT? British secret warfare in an information age

Emily Knowles and Abigail Watson This report has been written by Remote Control, a project of the Network for Social Change hosted by Oxford Research Group. The project examines changes in military engagement, with a focus on remote control warfare. This form of intervention takes place behind the scenes or at a distance rather than RQDWUDGLWLRQDOEDWWOHÀHOGRIWHQWKURXJKGURQHVWULNHVDQGDLUVWULNHVIURP above, with Special Forces, intelligence agencies, private contractors, and military training teams on the ground.

Emily Knowles LV5HPRWH&RQWURO·VSURMHFWPDQDJHU

Abigail Watson LVD5HVHDUFK2IÀFHUZLWK5HPRWH&RQWURO

We would like to extend our heartfelt thanks to the many people who have given up time and VKDUHGWKHLUNQRZOHGJHZLWKXVIRUWKLVUHSRUW6RPHRIWKHPRIWHQVWLOOLQVHUYLQJRURIÀFLDO positions, have preferred to remain anonymous and are not named here. None of them bear UHVSRQVLELOLW\IRUDQ\RIWKHRSLQLRQV RUHUURUV LQWKLVUHSRUWZKLFKDUHWKHDXWKRUV·RZQ

In alphabetical order:

Dapo Akande, Richard Aldrich, Malcolm Chalmers, Lindsay Clarke, Chris Cole, Rory Cormac, Ian Davis, Joseph Devanny, Anthony Dworkin, Frank Foley, Ulrike Franke, Chris Fuller, Jennifer Gibson, Anthony Glees, Michael Goodman, Jim Killock, Ewan Lawson, Peter Lee, Elizabeth Minor, Jon Moran, Michael Pryce, Julian Richards, Peter Roberts, Paul Rogers, Javier Ruiz Diaz, Paul Schulte, Namir Shabibi, Adam Svendsen, Jack Watling, Nicholas Wheeler, and Chris Woods.

We would also like to acknowledge the expertise that was shared with us by the Institute for &RQÁLFW&RRSHUDWLRQDQG6HFXULW\DWWKH8QLYHUVLW\RI%LUPLQJKDPDQGWKH8QLYHUVLW\RI2[IRUG which has been truly invaluable.

Published by Remote Control, March 2017

Remote Control Oxford Research Group Development House 56-64 Leonard Street London EC2A 4LT United Kingdom

+44 (0)207 549 0298 [email protected] http://remotecontrolproject.org

The text of this report is made available under a Creative Commons license. Photographs remain the copyright of original holders. All citations must be credited to Remote Control. This UHSRUWGRHVQRWQHFHVVDULO\UHÁHFWWKHYLHZVRIWKHH[SHUWVFRQVXOWHGDVSDUWRIWKHUHVHDUFK SURFHVVDQGDQ\PLVWDNHVWKDWUHPDLQDUHFDWHJRULFDOO\WKHDXWKRUV·RZQ

Cover image: markusspiske Pixabay/ Creative Commons Contents

Introduction 1 A golden age of remote warfare? 2 Secret warfare in an information age 4 The accountability gap 6

Case 1: the use of armed drones 8 Introduction 8 Faltering government transparency 9 Confusion over government policies 11 Conclusions 15

Case 2: the use of Special Forces 16 Introduction 16 The golden age of Special Forces 18 - Libya 19 - Somalia 19 - Yemen 20 - Afghanistan 20 - Syria 20 - Iraq 20 The blanket opacity policy 21 Lack of legislative oversight 22 Culture of no comment 24 Conclusions 27

Case 3: sharing capabilities with allies 28 Introduction 28 Providing capabilities outside areas of declared hostilities 28 - Syria 30 - Somalia 31 - Pakistan 32 - Yemen 32  7KH8.·VUROHLQDLGLQJWKH6DXGLOHGFRDOLWLRQ  Patchy government transparency 35 - Scrutiny of embedded troops 35 - Oversight of intelligence-sharing 36 - The role of the ISC 38  1HLWKHUFRQÀUPQRUGHQ\  Conclusions 39

Conclusion: greater secrecy is not always good strategy 40

Policy recommendations 41 Armed drones 41 Special Forces 41 Embedded troops 42 Intelligence-sharing 42

Endnotes 43 Introduction DUPHGGURQHÁHHWLQWHOOLJHQFHDJHQFLHV and military advisers and trainers also In May 2016, the Secretary of State for playing important roles. This is light-footprint Defence, Michael Fallon, appeared to put remote warfare, which can take place on to bed rumours of a pending British troop the front lines or with the UK in a supporting deployment to Libya1 with the statement role. Consistently, however, there is only that: “we do not intend to deploy ground DORZOHYHORIRIÀFLDOSXEOLFGLVFORVXUHRU forces in any combat role. Before engaging parliamentary scrutiny, even in the face of in any military operation in Libya, we would information leaks and media speculation. of course have to seek an invitation from 7KLVGHQLDELOLW\PD\EULQJÁH[LELOLW\ZKLFK the Libyan Government, and would also creates opportunities when it comes to 2 have to involve this Parliament.” GHDOLQJZLWKÁXLGDQGFRPSOH[VHFXULW\ Unfortunately, this came three months threats. But our research suggests that after claims had begun to surface in the this is not a simple relationship whereby British media that Special Forces were more secrecy automatically brings greater spearheading a “secret war” against ISIS strategic advantages. Indeed, in an age in Libya, with British troops operating when leaks of information are seemingly alongside their US and French counterparts inevitable, demand for political accountability 7 on the ground.3 It was also two months after is high, and trust in politicians and the wider 8 WKHOHDNRIDQRIÀFLDOPHPRGRFXPHQWLQJ expert community is low, WRGD\·VXQHDV\ a conversation between US lawmakers FRH[LVWHQFHRIRIÀFLDORSDFLW\DQGVSRUDGLF and King Abdullah of Jordan, which leaks of information to the media may be indicated that British Special Forces had creating a host of unintended consequences. been operating in Libya since at least the The analysis in this report will argue that 4 beginning of 2016. the prevailing tendency towards secrecy These media revelations generated is creating an accountability gap that parliamentary rumblings about secret wars,5 FKDOOHQJHVWKH8.·VGHPRFUDWLFFRQWUROV with the Chairman of the Commons Foreign over the use of force. In addition, it does Affairs Committee calling government not always appear to make strategic sense. responses to parliamentary requests ,QWRGD\·VLQIRUPDWLRQDJHRSDFLW\ERWK for more information: “so narrow as to UHVWULFWVWKHJRYHUQPHQW·VDELOLW\WRVHW be wholly and deliberately misleading its own narrative for British military action to the uninformed reader.”6 They also overseas, while potentially fuelling popular VHUYHWRLOOXVWUDWHWKHIDFWWKDWWRGD\·V feelings of distrust in government war- world of interconnectivity poses a distinct PDNLQJZKHQLQIRUPDWLRQDERXWWKH8.·V challenge to the idea of secret warfare, VHFUHWLYHLQYROYHPHQWLQWKHVHFRQÁLFWV with governments fast losing the ability to invariably surfaces. Our research shows that guarantee blanket opacity, even for the the UK is currently performing worse than special operators that are most prized for many of its allies when it comes to publicly their subtlety. commenting on its actions, or opening up its policies to scrutiny. In doing so, the While this is just one example, our research government is neglecting the strategic suggests that this is indicative of a rising advantages that greater transparency can trend in British defence and security policy – bring, in favour of narrowly looking at greater secretive yet growing military commitments access to information as a security concern. in areas where the UK is not generally considered to be at war, but where the There is of course a balance that needs to UK faces threats from groups like ISIS be struck between the need for secrecy to in Iraq, Syria and Libya, al-Shabaab in provide security and the need to open up Somalia, or AQAP (al-Qaeda in the Arabian the choices of government to the scrutiny Peninsula) in Yemen. Instead of deploying and debate that is so pivotal for a healthy regular British troops to the front lines, democracy. However, those who decide increasingly it is British Special Forces who that balance need to take into account the FDQEHIRXQGRQWKHJURXQGZLWKWKH8.·V IDFWWKDWLQWRGD\·VLQIRUPDWLRQDJHEXLOGLQJ policies on the assumption of complete

1 | All quiet on the ISIS front? secrecy is increasingly untenable – and On 21st of September 2001, then-President government control over the timelines for of the United States, George W. Bush, stood increased access to information about the in front of a joint session of Congress and 8.·VVHFUHWLYHPLOLWDU\HQJDJHPHQWVLV declared that America would “direct every slipping. resource at our command – every means of diplomacy, every tool of intelligence, This creates a need for change, whether every instrument of law enforcement, every it is the lack of oversight or the lack of ÀQDQFLDOLQÁXHQFHDQGHYHU\QHFHVVDU\ control that alarms you the most. Warfare is weapon of war – to the disruption and to the changing, and the way that people access defeat of the global terror network.”10 information about warfare is changing. Government policy needs to keep pace. Declaring that “Americans should not expect one battle, but a lengthy campaign, unlike any other we have ever seen”, Bush ushered A golden age of remote warfare? in an era of war in Iraq and Afghanistan,11 “Western nations engage in which then broadened into the pursuit of “al 12 counterinsurgency for limited stakes, which 4DHGDDQGLWVDIÀOLDWHVµ in Yemen, Somalia, leads to inevitable tensions between what Libya, and now in Syria and Iraq against 13 the military thinks is required on the ground, ISIS. in terms of methods or resources, and In evidence given to a 2016 Joint Committee what the population is ready to accept back on Human Rights (JCHR) investigation, home.” 8.JRYHUQPHQWWHVWLPRQ\FRQÀUPHGWKDW - Etienne de Durand, analyst at the Britain is “not in a generalised state of 14 French Institute of International Relations9 FRQÁLFWZLWK,6,/H[FHSWLQ,UDTDQG6\ULDµ Nevertheless, mapping reports of UK military

ISIS Fighter (image credit: Voice of America/ Wikimedia Commons)

Remote Control Project | 2 action over the last three years generates against Yemen,18 and the presence of UK a list of countries and activities with striking troops embedded in the US military at Camp VLPLODULWLHVWRWKRVHWKDWWKH86KDVMXVWLÀHG Lemonnier,19 none of the events on the map under its own war on terror.15 EHORZKDYHEHHQRIÀFLDOO\DFNQRZOHGJHGRU LQGHSHQGHQWO\YHULÀHG,QWKHFDVHVZKHUH Far from limiting military engagement to the UK government has responded to these its authorised air war against ISIS in Iraq reports on UK Special Forces (often referred and Syria, the UK government appears to to in this report as SF) activity, it is only to have also signed off on military activities reinstate that “WKH02'·VORQJKHOGSROLF\ in places like Libya, Somalia, and Yemen, is not to comment on Special Forces.”20 and has been able to sidestep the lack of authorisation for boots on the ground in Syria Politics appears to be a key driver of the and Iraq by using Special Forces. Evidence development and use of remote warfare by suggests that there are far greater British the British government. The controversy military commitments across the world than surrounding the 2003 invasion of Iraq cast have been openly discussed. a “long shadow” over British foreign policy, as well as parliamentary and public trust in This war is mostly carried out covertly. With the deployment of British troops.21 Over a the exception of the UK drone strike against decade of engagement in Afghanistan has 16 Reyaad Khan, the UK-assisted drone also created a certain war-weariness among strike against Mohammed Emwazi (aka the British public, and a high level of risk- 17 Jihadi John), the presence of UK forces aversion in Parliament. The legacy of both in the operation room for Saudi air strikes campaigns loomed large in August 2013,

3 | All quiet on the ISIS front? when the government was defeated in the Secret war in an information age House of Commons on a vote proposing military action in Syria.22 “We must expect intense scrutiny of our operations by a more transparent society, It is clear that there is currently a dilemma informed by the speed and range of modern for governments wanting to confront credible global communications. Our enemies will threats to UK security against the backdrop continue to attack our physical and electronic of low popular support for the commitment of lines of communication. And the growth of %ULWLVKWURRSV$VWKH8.·V$WWRUQH\*HQHUDO communications technology will increase recently noted, the increasing terrorist RXUHQHPLHV·DELOLW\WRLQÁXHQFHQRWRQO\ threat means the “frontline has irretrievably DOOWKRVHRQWKHEDWWOHÀHOGEXWDOVRRXURZQ altered.”23 Social media allows groups across society directly. We must therefore win the the world to plan, enable and inspire groups battle for information, as well as the battle on in other countries to carry out attacks, while the ground.” individuals are connected through networks that disregard state boundaries. - Securing Britain in an Age of Uncertainty, the Strategic Defence and In 2013, a Ministry of Defence (MOD) study Security Review 201028 discussing how to maintain operations despite a “risk averse” public was leaked. The assumption that removing war from The document suggested, among other public and parliamentary debate allows things “investing in greater numbers of SF.”24 governments to counter threats regardless of This advice appears to have been followed. public opinion is prefaced on the increasingly In the 2015 National Security Strategy and outdated premise that governments can Strategic Defence and Security Review control access to information about UK (SDSR) the government pledged to double military action abroad. However, in a world investment in Special Forces and to double dominated by smart phones, social media, WKH8.·VDUPHGGURQHÁHHW25 and burgeoning access to the internet, the current policy of limited transparency may In the 2010 SDSR, the UK government end up exacerbating the low levels of public committed to “focus on areas of comparative trust in military interventions that secretive national advantage valued by key allies, warfare is assumed to avoid. especially the US, such as our intelligence capabilities and highly capable elite forces.”26 One of the major warnings to come out of This was echoed in the 2015 SDSR which the Iraq Inquiry (also known as the Chilcot stated: “our special relationship with the US UHSRUW LQWR%ULWDLQ·VLQYROYHPHQWLQWKH remains essential to our national security. ZDULQ,UDTZDVWKDWWKHJRYHUQPHQW·V It is founded on shared values, and our misrepresentation of the facts had done exceptionally close defence, diplomatic, long-term damage to public trust in politics.29 security and intelligence cooperation.”27 When information surfaces in the media Secretive remote warfare in support of British that appears to contradict government allies appears to be set as a rising trend for statements about where it does and does many years to come. not have a military presence, it could serve to undermine public and parliamentary trust However, opting for greater secrecy in further. response to greater risk aversion is not without its drawbacks. The argument that Indeed, The Times, The Daily Mail, The this may be tempting the government into Daily Telegraph, The Daily Mirror, The Daily sending the wrong sort of force to escape Express, The Sun, The Guardian, The scrutiny is part of a broader debate about Observer, The Daily Star Sunday, and The the effectiveness of remote warfare that is Sunday Mirror each ran stories on UK plans 30 too large for this report. Nonetheless, the to deploy troops to help stabilise Libya long ULVNWKDWWKLVVWUDWHJ\PD\EDFNÀUHZKHQ before the eventual proposal to send 1000 information is leaked or interviewees choose troops on a potential training mission was to talk candidly to journalists about UK announced (and then subsequently dropped) 31 support on the ground is real, and deserves in April 2016. further discussion.

Remote Control Project | 4 ,Q-XO\WKH02'FRQÀUPHGWKDW It would be better to address government “a small number of embedded UK pilots policy before any such crisis point is have carried out airstrikes in Syria against reached. The information age works both ISIL targets”32 while operating under US ways – connecting people to a wider range command, even though Parliament had of ideas and sources of information, while refused to authorise British military action also creating a more powerful platform for in the country. As Ross Hawkins, BBC people to communicate with each other. FRUUHVSRQGHQWQRWHG´:K\ZHUHQ·WZHWROG" Shaping and projecting narratives have 7KDW·VWKHTXHVWLRQWURXEOLQJPDQ\03V DOZD\VEHHQLPSRUWDQWIRUSDUWLHVWRFRQÁLFW not all of them on opposition benches.”33 but the growing interconnectedness that the information age brings has catapulted the In a climate when the government already importance of this soft power and information feels like military options abroad are being shaping to prominence in military and constrained by risk aversion, the proposition political debates. that minimising the disclosure of these operations may serve to exacerbate those The 2010 SDSR made this point very clear, constraints deserves careful consideration. speaking of the need to “win the battle for One major scandal could result in huge information, as well as the battle on the UHVWULFWLRQVEHLQJSODFHGRQWKH8.·V ground” and acknowledging that “a more engagement abroad, as could a steady drip transparent society” aided by “the speed and of media information that raises suspicions range of modern global communications” and fuels accusations of government would submit British operations to intense deception. scrutiny.34

Protestors outside Westminster on the day of the parliamentary vote authorising strikes in Syria (image credit: Alisdare Hickson/ Flickr Creative Commons)

5 | All quiet on the ISIS front? Refusing to comment on UK military 6LQFHPLOLWDU\DFWLRQZDVÀUVWVXEMHFWWR DFWLRQVHYHQRQFHDVLJQLÀFDQWDPRXQWRI parliamentary vote in 2003,37 successive information is available in the public domain governments have supported the move away means that the government ends up handing from what they called an “outdated” model of over the narrative of UK military engagement intervention where the decision to go to war to others. This puts direct constraints on the sits with the Prime Minister and the Cabinet JRYHUQPHQW·VDELOLW\WRSXWDFURVVLWVRZQ alone, arguing that a move towards greater counter-narratives in the face of uncontrolled transparency and accountability was pivotal leaks and media speculation. Forfeiting for a 21st century democracy.38 the ability to discuss, justify, or disprove accounts that appear in the public domain is Over the last few years, a convention of DVLJQLÀFDQWKDQGLFDSDQGPD\DOVRVHUYH seeking Parliamentary approval before to erode the legitimacy or credibility of UK the deployment of troops abroad has military action abroad. developed – also known as the War Powers Convention. This was arguably present Again, there is a balance that needs to be from as early as 2011, when Parliament struck between the need for secrecy to approved UK military action in Libya.39 provide security and the need to open up However, the August 2013 vote when the the choices of government to scrutiny and government failed to get parliamentary debate. However, existing policies do not support for intervening in Syria (and then appear to take into account the fact that, in UHVSHFWHG3DUOLDPHQW·VGHFLVLRQ LVJHQHUDOO\ WRGD\·VLQIRUPDWLRQDJHEXLOGLQJSROLFLHV considered to be the moment that the on the assumption of complete secrecy is FRQYHQWLRQZDVFRQÀUPHG40 This gained increasingly untenable – and the government further credence when the government is not necessarily in control of the timelines sought approval in September 2014 for its for increased access to information about the operations in Iraq against ISIS.41 8.·VVHFUHWLYHPLOLWDU\HQJDJHPHQWV The opacity of remote warfare stands against this convention and the wider commitment The accountability gap to subject UK military actions abroad to parliamentary oversight. While deploying Aside from the fact that secret warfare is troops would usually trigger a parliamentary becoming increasingly unsustainable with vote,42 this commitment does not capture the such high levels of access to information many elements of remote warfare, which are across the world, developing oversight RIWHQFRQVLGHUHG¶QRQFRPEDW·VXSSRUWLQJ mechanisms so that they keep pace with or assisting roles.43 changes in warfare is also, arguably, a fundamental part of maintaining the health of However, the lethal strike against UK citizen British democracy. Reyaad Khan shows that what starts out as a non-combat intelligence mission can In the US, there is talk of “a longstanding TXLFNO\OHDGWRDOHWKDOVWULNHZKHQ\RX·YH trend: a growing disconnect between got capabilities like armed drones that can American society and the armed forces that do both. On top of this is the fact that Special 35 claim to represent it,” which has grown Forces have a blanket exemption from worse throughout the war on terror. In an parliamentary oversight or public disclosure, interview with Dan Sullivan, a Republican whether they are advising, assisting, or RQWKH6HQDWH·V$UPHG6HUYLFHV&RPPLWWHH ÀJKWLQJRQWKHIURQWOLQHV5HPRWHZDUIDUH KHVDLGWKDW´WKHOHVVRQWKDWZH·YHOHDUQHG stands as testament to how far modern now in this country is that you have to level ZDUÀJKWLQJPHWKRGVKDYHRXWSDFHGWKH ZLWKWKH$PHULFDQSHRSOHDERXWZKDW\RX·UH evolution of mechanisms to monitor and GRLQJZKDWWKHJRYHUQPHQW·VGRLQJZKDW scrutinise them. our military forces are doing… Because WKDW·VMXVWWKHULJKWWKLQJWRGRDQGWKDW·VWKH External scrutiny is a necessary partner of best way to get American support.”36 internal oversight, particularly to prevent the sorts of group-think and political dominance criticised in the Chilcot report.44 Civil liberties lawyer Ben Jaffey reported that, in his

Remote Control Project | 6 experience, when one judge is in charge 2. Where the UK carries out operations with of saying “yes” or “no” to an operation Special Forces rather than with regular but is dependent on the government for troops, parliamentary authorisation or their access to information, which often QRWLÀFDWLRQLVQRWUHTXLUHG7KLVDOORZV lacks a satisfactory challenging argument, them to operate in combat roles in they may be unable to fully consider their countries where Parliament has not judgements.45 voted on military action,47 as well as in places where the relevant authorisations UK policy is not currently keeping pace with VSHFLÀFDOO\SUHFOXGHWKHGHSOR\PHQW changes in the way that wars are being of UK troops in ground combat waged. This has created an accountability operations.48 In addition, scrutiny is gap that allows remote warfare to take place VHYHUHO\UHVWULFWHGE\WKH02'·VORQJ largely unscrutinised and with only limited held policy not to comment on Special public disclosure. This report covers three Forces49 and the weakness of the areas of UK engagement abroad in which Defence Advisory Notice System,a which this transparency and accountability gap are DOORZVWKHPWRGHÁHFWDQ\HYLGHQFHWKDW particularly clear and problematic: surfaces in the media about their use.

1. Where the UK is using armed drones 3. Where the UK provides capabilities to to conduct intelligence, surveillance, allies rather than taking an active lead and reconnaissance missions over in operations, it does not necessarily areas where it is not considered party need to report them to Parliament. For WRDFRQÁLFWWKHVHGHSOR\PHQWVDUHQRW example, in 2015 it was revealed that disclosed or voted on in Parliament. a small number of UK pilots embedded This is in line with the treatment of other with the US military had carried out ¶QRQFRPEDW·PLVVLRQVZKLFKGRQRW airstrikes in Syria against ISIS targets fall under the War Powers Convention. before parliamentary authorisation was However, there is now also a precedent given.50 This allows the government for the UK to use these armed drones to have troops involved in combat to carry out targeted strikes, such as without having to declare a UK role in the one that killed Reyaad Khan in offensive missions, and without having Syria, when parliamentary authorisation to bring their engagement to a vote in had not been given for British military Parliament. engagement in the country.46 This raises questions about the policy governing these decisions, as well as whether the existing War Powers Convention is strong enough to cover the increasing ÁXLGLW\EHWZHHQQRQFRPEDWDQGFRPEDW missions.

a The Defence Advisory Notice System is the non- legally-binding system that the UK government uses to advise the media about whether publishing material they receive about SF might be harmful to national security. In addition to Special Forces, the system covers information on military operations, nuclear and non-nuclear weapons and equipment, ciphers and secure communications, sensitive installations and home addresses, and UK Security and Intelligence Services. (http://www.dnotice.org.uk/danotices/ index.htm)

7 | All quiet on the ISIS front? Case 1: the use of appears to treat them on the same basis as other manned aircraft. Indeed, in a letter armed drones dated 6th October 2016, the government FRQÀUPHGWKDWWKHGHSOR\PHQWRIGURQHV Introduction would be covered by the War Powers Convention.51 2QHRIWKHKLJKHVWSURÀOHZD\VLQZKLFK the use of force is changing at the moment +RZHYHUWKH8.·VVWULNHDJDLQVW5H\DDG is the use of drones for targeted killing. In .KDQD8.FLWL]HQÀJKWLQJIRU,6,6ZKRZDV areas where the UK currently considers killed in Syria before parliamentary approval LWVHOISDUW\WRDFRQÁLFWVXFKDV,UDTDQG for UK operations was secured, shows that (after parliamentary approval in December there are differences in approach between 2015) Syria, the UK government is relatively the use of drones and the use of manned transparent about its use of drones, and aircraft when it comes to targeted killing (see box below).

What is Targeted Killing?

7DUJHWHGNLOOLQJKDVEHFRPHDNH\FRPSRQHQWLQWKHÀJKWDJDLQVWWHUURULVP7KHWHUPZDVGHÀQHG by Philip Alston, the Special Rapporteur on extrajudicial, summary or arbitrary executions, as: “the intentional, premeditated and deliberate use of lethal force, by States or their agents acting under FRORXURIODZRUE\DQRUJDQL]HGDUPHGJURXSLQDUPHGFRQÁLFWDJDLQVWDVSHFLÀFLQGLYLGXDOZKRLV not in the physical custody of the perpetrator.”52

%H\RQGWKLVGHÀQLWLRQ´WDUJHWHGNLOOLQJµLVKDUGWRGHÀQH$OVWRQDUJXHVWKDWWKHPDLQGLIIHUHQFH between targeted killing and “extrajudicial execution”, “summary execution”, and “assassination” is that while “in most circumstances targeted killings violate the right to life, in the exceptional FLUFXPVWDQFHRIDUPHGFRQÁLFWWKH\PD\EHOHJDOµ²XQOLNHWKHVHRWKHUWHUPVZKLFK´DUHE\ GHÀQLWLRQLOOHJDOµ53

The term does not appear in international law and was popularised by Israel who made a public policy of “targeted killings” of alleged terrorists in Occupied Palestinian Territory after the Second Intifada in September 2000.54 This policy was publicly criticised by many countries, including the US. When discussing WDUJHWHGNLOOLQJDVDSDUWRI,VUDHO·VFRXQWHUWHUURULVW strategy in July 2001, the US Ambassador to Israel warned “The United States government is very clearly on record as against targeted assassinations. …They are extrajudicial killings.”55

However, now the US is one of the biggest conductors The national security team monitoring the of “targeted killing.”56 Since the 9/11 attacks and the progress of Operation Neptune Spear, the Special Forces mission against Osama bin beginning of the war on terror, the US has targeted Laden (image credit: Pete Souza, Wikimedia DO4DHGDDQGLWVDIÀOLDWHVWKURXJKWKHXVHRI6SHFLDO Commons) Forces in kill or capture missions and the use of drones in lethal strikes against such individuals.57 The Navy SEAL raid in May 2011 against Osama bin Laden and the drone strike against the American- born Yemeni cleric, Anwar al-Awlaki, are probably two of the most well-known examples of this policy in practice.58

It also appears that the UK is using these techniques. In 2013, it was reported that “British Special Forces have been in the forefront of targeted killing campaigns in Afghanistan and Iraq, and British ¶GURQHV·DUHQRZGHSOR\HGLQ$IJKDQLVWDQWRWKHVDPHHQGµ59 There are also reports of UK forces WDNLQJSDUWLQWDUJHWHGNLOOLQJRXWVLGHRIDUHDVLWFRQVLGHUVLWVHOISDUW\WRDFRQÁLFWVXFKDV6\ULD before parliamentary authorisation.60/LWWOHLVNQRZQDERXWWKH8.·VUROHLQWKHVHRSHUDWLRQVRULIWKLV dominant counter-terrorism tactic is working.

Remote Control Project | 8 The difference lies in the dual-use of armed UK Reaper missions have been conducted GURQHVIRU¶FRPEDW·DQG¶QRQFRPEDW· in Syria other than for surveillance purposes. operations – which can change from one No authority has been granted for the to the other very quickly, and without prior discharge of weapons from UK Reaper parliamentary approval. Drones provide aircraft operating in Syrian airspace.”67 the UK government with the ability to conduct intelligence, surveillance, and During the debate on the use of force in th reconnaissance missions for prolonged Iraq on 26 September the previous year, periods over suspected targets in areas the then-Prime Minister, David Cameron, ZKHUHLWLVQRWFRQVLGHUHGSDUW\WRDFRQÁLFW reserved the right to strike within Syrian As with other “non-combat” deployments, national territory “if there were a critical these missions do not fall under the War British national interest at stake or there Powers Convention or require recourse to were a need to act to prevent a humanitarian Parliament. catastrophe.” In those circumstances, he said he would “act immediately and explain However, the strike against Khan showed to the House of Commons afterwards. I am that a precedent has now been set for the being very frank about this because I do not UK to use these armed drones to carry out want to mislead anybody.”68 targeted strikes in these same areas, even without a prior vote in Parliament. This raises As promised, Cameron announced to LPSRUWDQWTXHVWLRQVDERXWKRZZHOOWKH8.·V the House of Commons at the earliest systems of oversight are able to keep up opportunity that the UK had undertaken a ZLWKWKHÁXLGDQGUDSLGO\FKDQJLQJQDWXUHRI lethal strike in Syria against Khan during drone operations in areas the UK does not 3DUOLDPHQW·VVXPPHUUHFHVV&DPHURQVDLG FRQVLGHULWVHOIDSDUW\WRDFRQÁLFW that the strike represented a “new departure” IRU8.SROLF\DQGWKHÀUVWWLPH´D%ULWLVK asset has been used to conduct a strike Faltering government in a country where we are not involved in transparency a war.”69 This was welcome transparency, and showed a willingness to voluntarily On 21st August 2015, Khan was killed by disclose information about a policy that many D+HOOÀUHPLVVLOHÀUHGIURPD8.5HDSHU commentators would go on to call “extremely drone,61 possibly with targeting assistance alarming.”70 from UK Special Forces.62 The strike also killed Ruhul Amin, another UK national, and However, after the initial announcement, very Abu Ayman al-Belgiki, a Belgian national.63 little additional information was given about Khan had been threatening to attack UK the strike. In response, the JCHR launched targets;64 however, the strike was particularly DQLQTXLU\RQWKH8.·VSROLF\RQWDUJHWHG controversial because it occurred months killing, but the Prime Minister and Attorney before parliamentary approval for the use of General, Jeremy Wright Q.C., refused to military force in Syria, which was not given give evidence. Instead, a somewhat vague until December 2015. memorandum,71 and evidence from the Defence Secretary, Michael Fallon, had to In September 2014 the House of Commons VXIÀFH)DOORQUHIXVHGWRDQVZHUDQXPEHU had approved the use of force in Iraq but of questions, including fundamental things explicitly stated: such as the types of people targeted by the UK, the similarities and differences of the UK “this motion does not endorse UK air strikes and US policy and the people involved in the in Syria as part of this campaign and any decision to kill Khan, stating: “I am not able proposal to do so would be subject to a to discuss intelligence matters.”72 separate vote in Parliament.”65 In October 2016, the government responded A month later, the MOD announced it would WRWKH-&+5·VLQTXLU\EXWUHIXVHGWRDQVZHU send drones for surveillance missions over PDQ\RIWKHFRPPLWWHH·VTXHVWLRQV)RU Syria but said that, as these were not in example, it would not disclose “the grounds an offensive capacity, they did not require on which the government considers the parliamentary approval.66 The MOD said “no

9 | All quiet on the ISIS front? An RAF Reaper drone (Defence Images/ Flickr Creative Commons)

Law of War to apply to a use of lethal force Harriet Harman MP argued that it was RXWVLGHDUPHGFRQÁLFWµEHFDXVHLWFODLPHG “unacceptable” that the Prime Minister had “this is a hypothetical question.73 given the “impression …that he is allowing the ISC to scrutinise the targeted killing of Since then, the government has opened up Reyaad Khan” when in fact “he is clearly the Khan strike to scrutiny by the Intelligence frustrating the scrutiny work of the ISC and Security Committee (ISC), but there are who he appointed and who are all security- reports that it has not been given enough cleared.”76 information to do a proper investigation.74 When questioned by the Liaison Committee, At the time of print, it appears that ISC Cameron admitted that, although the ISC has still not been provided with enough has been allowed to examine the intelligence information to make these judgements. In that prompted the strike, “ministers February 2017, it was reported by The Times would retain the right to withhold some WKDWWKH,6&KDGFODLPHGLWZDV´GLVVDWLVÀHGµ intelligence.” Andrew Tyrie MP, chair of the with the information it had been provided on Liaison Committee, stated: the attack in its report to 10 Downing Street. The ISC felt it was not provided enough ´2QWKHEDVLVRIWRGD\·VHYLGHQFHWKH information to make a judgement, especially Intelligence and Security Committee will on how well the government had assessed not be able to do a thorough job. The Prime the potential for “collateral damage” or how Minister should reconsider his decision to “imminent” the threat posed by Khan was.77 prevent the ISC from looking at information on the military aspects of the drone strikes. A big turnaround for government Unless he permits this, the ISC will be transparency occurred on 11th January 2017, incapable of providing reassurance to when UK Attorney General Wright made Parliament and the public that the strikes a speech at the International Institute for were both necessary and proportionate.”75 Strategic Studies (IISS) outlining when the

Remote Control Project | 10 UK believes “it is lawful to use force in self- over what their policy surrounding targeted defence.”78 Previously, the government had killing is. This gives rise to speculation about UHIXVHGWRGLVFORVHWKH$WWRUQH\*HQHUDO·V whether or not the government has properly legal advice completely.79 understood their responsibilities under International Humanitarian Law (IHL) and Nevertheless, a lot remains unknown. For International Human Rights Law (IHRL), with example, Wright maintained that he would potentially damaging consequences for its QRWFRPPHQWRQVSHFLÀFFDVHV7KLVLVKLJKO\ international legitimacy. problematic, as it leaves outsiders with only a hypothetical understanding of how the In his announcement of the Khan strike, law is being applied, rather than evidence Cameron claimed to be “exercising the provided from cases. A number of experts 8.·VLQKHUHQWULJKWWRVHOIGHIHQFHµ commented that greater information about adding that there “was clear evidence of the evidence that informed lethal strikes the individuals in question planning and would reassure the public and provide the directing armed attacks against the UK.”86 means for more effective accountability.80 However, this announcement differed from WKH8.·VVWDWHPHQWWRWKH81ZKHUHWKH8. The government has also maintained high Permanent Representative also invoked the levels of secrecy over UK drone operations defence of Iraq – stating that the strike was outside declared warzones. Before done in the “exercise of the inherent right of parliamentary approval of strikes against individual and collective self-defence” and ISIS in Syria, Tom Watson MP asked “how adding “ISIL is engaged in an ongoing armed many of the remaining UK Reapers in attack against Iraq, and therefore action Afghanistan will be redeployed to support the against ISIL in Syria is lawful in the collective coalition mission against the Islamic State of self-defence of Iraq.”877KHJRYHUQPHQW·V 81 Iraq and ISIL.” The government refused to memorandum to the JCHR also invoked both answer citing reasons of security – however, MXVWLÀFDWLRQVVWDWLQJ´7KLVZDVWKHUHIRUH it was willing to give similar details for its a lawful use of force in the individual self- 82 operations in Iraq. defence of the United Kingdom and the collective self-defence of Iraq.”88 In February 2016, Catherine West MP asked “how many operations UK Reaper drones :KLOHWKHVHWZRMXVWLÀFDWLRQVDUHQRW have undertaken in Libyan airspace this necessarily irreconcilable – and it is year”; to which the government replied that it possible that “an armed attack may be “has a long-standing policy not to comment directed against a State and its allies 83 on intelligence matters.” In September simultaneously”89 – they draw attention to 2016, Richard Burden MP asked “whether SRWHQWLDOFRQIXVLRQLQWKH8.·VSROLF\)RUPHU the UK is currently using armed Reaper Director of the Government Communications drones outside of Iraq and Syria.” Mike Headquarters (GCHQ), Sir David Omand, Penning MP, Minister of Defence, replied agreed with the UK government position but saying: “I am unable to provide further VDLGKH´KDGWRUHDGWKH3ULPH0LQLVWHU·V information on the deployment of Reaper statement several times” to try to square as its disclosure would, or would be likely &DPHURQ·VFRPPHQWVWRWKH+RXVHDQGWKH to, prejudice the capability, effectiveness or MXVWLÀFDWLRQJLYHQWRWKH8190 security of the Armed Forces.”84 As Jennifer Gibson, Staff Attorney at legal charity The distinction matters because if the UK Reprieve, notes, the UK government “has was acting in collective defence of Iraq never admitted to where it is taking strikes. and itself as part of its war with ISIS then Nor has it acknowledged how many strikes it the strike would be considered part of a has taken.”85 QRQLQWHUQDWLRQDODUPHGFRQÁLFWEHWZHHQ a state and non-state group. This would mean that IHL would apply, which allows the Confusion over government use of lethal force against “combatants” or, policies civilians performing “a continuous combatant function” by playing a sustained role in 7KH8.JRYHUQPHQWZRXOGEHQHÀWIURP hostilities, as part of the normal laws of war.91 adopting better transparency measures, as WKHUHLVVLJQLÀFDQWFRQIXVLRQDWWKHPRPHQW

11 | All quiet on the ISIS front? However, if the strike was taken in self- one Reaper strike in Syria mentioned above defence – outside of Iraq where it was a [the Reyaad Khan strike]. This is the only SDUW\WRWKHFRQÁLFW²LWZRXOGQRWEHSDUWRI weapon release to have occurred in Syria DQDUPHGFRQÁLFWDQG,+5/ZRXOGEHWKH and was not part of Operation SHADER.”97 primary body of law governing UK action.92 7KHVHODZVDUHFRGLÀHGLQWUHDWLHVVXFKDV ,QWKH$WWRUQH\*HQHUDO·VVSHHFKDW,,66 the European Convention on Human Rights he noted that he had given legal advice “in and the International Covenant on Civil and relation to a strike against Reyaad Khan, Political Rights. Central to IHRL is the right to the British national who was a member of protect against the “arbitrary” deprivation of Daesh, and who was killed by UK forces life and WKH6WDWH·VGXW\WRSURWHFWWKLV basic because of the threat that he posed to the 98 right.93 UK.”

$PRQWKDIWHU&DPHURQ·VDQQRXQFHGWKH ,WLVGLIÀFXOWWRVHHWKHQKRZ,+/FRXOG strike, a letter from the Government Legal have applied, and in fact many experts who Department asserted that the strike in Syria submitted evidence to the JCHR said it did 99 ZDVSDUWRIDQDUPHGFRQÁLFW not. For example, Alex Batesmith, Barrister and Lecturer in Law at the University ´$QDUPHGFRQÁLFWLVWDNLQJSODFHLQ,UDT of Liverpool, stated “in the particular and crossing over into Syria, at present. The circumstances of this case it would be very United Kingdom is not currently participating GLIÀFXOWIRUWKH8.*RYHUQPHQWWRVXVWDLQ in coalition air strikes within Syria (but is an argument that the 21 August strike was GRLQJVRLQ,UDT 7KHPLOLWDU\DFWLRQWDNHQ undertaken in the context of an armed in Syria by the RAF on 21 August 2015 was FRQÁLFWµ100 Caroline Lucas MP also argues: DLPHGDWDVSHFLÀF,6,/WDUJHWWKDWSUHVHQWHG “It is now said that the strike took place in DFOHDUFUHGLEOHDQGVSHFLÀFWKUHDWRI WKHFRQWH[WRIDQDUPHGFRQÁLFW²EXWLWLV armed attack on the United Kingdom in XQFOHDUZKDWDUPHGFRQÁLFWLVUHOLHGXSRQµ101 WKHFRQWH[WRIDQDFWLYHDUPHGFRQÁLFWLQ ZKLFKWKHWKUHH,6,/ÀJKWHUVNLOOHGLQWKH The lack of a public, coherent policy on attack were participants. The fact that the targeted killing may be problematic if the United Kingdom had not up to that point government undertakes more strikes outside conducted any air strikes on Syrian territory GHFODUHGDUHDVRIFRQÁLFW:KHQDVNHGLIKH provides no basis for the assertion that this would repeat the strike, Cameron replied: action took place outside the context of “if it is necessary to safeguard the United DQDUPHGFRQÁLFW7KH5DTTDVWULNHZDVD Kingdom and to act in self-defence, and military operation which was consistent with there are no other ways of doing that, then 102 th international humanitarian law.”94 yes.” On 8 September 2015, Fallon was FOHDUKH´ZRXOGQ·WKHVLWDWHWRGRLWDJDLQµLI However, in the aftermath of the strike, he knew an armed attack was “likely”.103 He both Cameron and Fallon argued that the repeated this in his evidence to the JCHR: VWULNH´ZDVWKHÀUVWWLPHWKDWZHKDGDFWHG in an area in which we were not previously “There are other terrorists involved in other LQYROYHGLQDQDUPHGFRQÁLFWµ95 Cameron plots that may come to fruition over the next also said the strike was not part of coalition IHZZHHNVDQGPRQWKVDQGZHZRXOGQ·W military action against ISIL in Syria but a hesitate to take similar action again. [ …] target strike “to deal with a clear, credible our job to keep us safe, with the security DQGVSHFLÀFWHUURULVWWKUHDWWRRXUFRXQWU\DW DJHQFLHVLVWRÀQGRXWZKRWKH\DUHWRWUDFN home.”96 them down and, if there is no other way of preventing these attacks, then yes we will The MOD said in response to a Freedom authorise strikes like we did.”104 of Information (FOI) request from Drone Wars UK that the strike was not part of $VD3DUOLDPHQWDU\%ULHÀQJSDSHUQRWHG Operation SHADER (the codename for the the implications are this are profound, given 8.·VPLVVLRQDJDLQVW,6,6LQ,UDT²DQG “large numbers of people are allegedly 105 now in Iraq and Syria). It stated, after listing planning attacks against the UK.” What WKH8.·VVWULNHVLQ,UDTDQG6\ULDVLQFH is more, this lack of clarity is not the case in parliamentary approval for the use of military the two other states most usually associated force in Syria that “[t]his does not include the with targeted killing – the US and Israel (see boxes on following pages).

Remote Control Project | 12 The US transparency framework

At the end of 2016, the Obama administration released the “Report on the Legal and Policy )UDPHZRUNV*XLGLQJWKH8QLWHG6WDWHV·XVHRI0LOLWDU\)RUFHDQG5HODWHG1DWLRQDO6HFXULW\ Operations.”106 This 60-page Framework Report, among other things, brought together “explanations the Obama Administration has provided” on its use of force “in more than 40 earlier speeches, releases, EULHIVPHPRUDQGDHWFSXEOLVKHG>IURP@WKH3UHVLGHQW·VWKLUGGD\LQRIÀFHµ107

These explanations have provided the public with a much better understanding of, for example, who is targeted, the process by which they are targeted, the internal and external oversight of the strike or capture mission and the legal understandings they are based on.

)RUH[DPSOHWKH86*RYHUQPHQWKDVRXWOLQHGWKHVSHFLÀFJURXSVLWWDUJHWVRXWVLGHDUHDVRIDFWLYH hostilities: al-Qaeda (including individuals who are part of al-Qaeda in Libya and al-Qaeda in Syria); WKH7DOLEDQ´FHUWDLQRWKHUWHUURULVWRULQVXUJHQWJURXSVDIÀOLDWHGZLWK>DO4DHGD@RUWKH7DOLEDQLQ Afghanistan”; al-Qaeda in the Arabian Peninsula (AQAP); ISIS; and, now, al-Shabaab. It also outlines that a High Value Target is an individual posing a “continuing, imminent threat to US persons.”108

In addition, the US government has explained the process by which these individuals are targeted and WKHQWKHZD\WKHVHGHFLVLRQVDUHRYHUVHHQ)RUH[DPSOHWKH3UHVLGHQWLDO3ROLF\*XLGDQFHFRQÀUPV that “operating agencies”, such as the CIA and Defense Department, can formally nominate an individual to be targeted.109 They must then submit plans to the National Security Staff (NSS) and lawyers across different security agencies.

The Deputies Committee then debates the information and weighs up the feasibility and necessity of lethal force. A unanimous agreement will decide whether a strike is undertaken, and in the absence of one the President decides. Within 48 hours of the strike the operating agency must Obama at the National Defense University, provide information, including a description of the operation Washington DC, outlining the US policy and an assessment of whether it achieved its objectives, to of targeted killing (image credit: National the NSS and “appropriate Members of Congress” must also Defense University/ Wikimedia Commons) EHQRWLÀHG

The criteria that must be met before a strike takes place include:

- The United States will use lethal force against only a terrorist target that poses “a continuing, imminent threat to U.S. persons,” underscoring that it is simply not the case that all terrorists overseas pose such a threat;

- Before lethal action may be taken, the United States must have “near certainty” that the terrorist target is present and that non-combatants will not be injured or killed;

- There must be an assessment that the capture of the target is not feasible at the time of the operation and that no other reasonable alternatives exist to address the threat to U.S. persons effectively; and

- /HWKDODFWLRQUHTXLUHVDQDVVHVVPHQWWKDWUHOHYDQWJRYHUQPHQWDODXWKRULWLHVLQWKHFRXQWU\ZKHUH the action is contemplated either cannot or will not effectively address the threat to U.S. persons.110

As Obama notes in the Framework Report, the US has not provided an “exhaustive discussion of how the United States wages war” and does not release some information “consistent with national security.” However, as a result of these explanations we know far more about the US policy than, arguably, any other country in the world.111

13 | All quiet on the ISIS front? Israeli policy on targeted killing

,VUDHOZDVWKHÀUVWFRXQWU\WRRIÀFLDOO\DQQRXQFHDSXEOLFSROLF\RIWDUJHWHGNLOOLQJLQZKLFKZDV greeted with widespread criticism. Nevertheless, Israel has been relatively open about its targeting policies and has formalised oversight mechanisms.

In February 2002 Menachem Finkelstein, the judge advocate general of the Israeli Defense Forces (IDF), issued three conditions under which targeted killing can take place. Before suspected terrorists are killed:

- 7KH3DOHVWLQLDQ$XWKRULW\PXVWÀUVWLJQRUHDSSHDOVIRUWKHLUDUUHVW

- The Israelis must conclude that they would be unable to arrest the individuals themselves

- And the killing must be done to prevent an imminent or future terrorist attack—not for revenge or retribution.112

The Israeli High Court supported these conditions in a strongly worded statement on 29th January 2002, rejecting petitions calling for an end to targeted killing. Provided these conditions are followed, targeted killing is judged to be consistent with Israeli law.113

Israel also hands a list of arrest warrants for militants to the Palestinian Authority before proceeding.114 Many militants handed themselves in to the Palestinian Authority when informed that the choice was arrest, being killed or going on the run.115

In 2005, the Israeli Supreme Court verdict on the legality of targeted killings found the tactic to be legal, but insisted on regulating the processes surrounding it.116 The court insisted that targeted killing must be a highly selective operation and that the selection of the target must be transparent, the justice of the killing immediately apparent and that a full and open investigation should be carried out immediately after the operation to ensure it was conducted appropriately.

These criteria appear to have been largely followed. Professor Shlomo Shpiro, a specialist in the study of intelligence services in Israel and Europe, argues that “decisions over targeted killing” are:

“…not taken only within the secret corridors of intelligence. They also involve legal advice, court supervision and parliamentary oversight. While not a fool proof guarantee against mistakes, these H[WHUQDOPHFKDQLVPVGRH[HUWDVWURQJLQÁXHQFHZLWKLQWKHVHUYLFHVHQVXULQJWKDWLQPRVWFDVHV LOOHJDODFWLYLWLHVEUHDFKLQJFLYLOOLEHUWLHVZLOOQRWEHSURSRVHGLQWKHÀUVWSODFHµ117

Nathalie Van Raemdonck, Project Manager at the Centre for Cyber Security Belgium, also states: “Israeli targeted killing operations are far more exposed to public scrutiny and democratic approval than the US ones, as each case is individually authorised by public servants and even requires a preliminary attempt to capture the targeted individual.”118

Remote Control Project | 14 Conclusions

In its report, the JCHR concluded that However, the UK government does target “although the Government says that it does individuals abroad and in doing so it opens not have a “targeted killing” policy, it is clear itself up to a number of accusations and that it does have a policy to use lethal force legal challenges that may damage the DEURDGRXWVLGHDUPHGFRQÁLFWIRUFRXQWHU legitimacy of UK military action. Greater terrorism purposes.”119 transparency can be used as a tool to ensure that strikes are, and are seen to be, There is a stigma attached to targeted killing legitimate. – especially given its controversial use by US during the war on terror. It is therefore Moreover, international examples show unsurprising that no politician would like to that greater transparency is possible, and put their name to such a public “targeted does not automatically restrict the ability of killing” policy. Add this to the fact that the governments to act. While the Israeli and US legality of such actions has been questioned policies of targeted killing have received a lot by a number of human rights groups and of criticism they are at least far more open LQWHUQDWLRQDODFWRUVDQGWKHJRYHUQPHQW·V about their strikes, including why and how reticence to release more information is they are undertaking them. understandable.

15 | All quiet on the ISIS front? Case 2: the use of media is that UKSF are some kind of super soldier: capable of withstanding hostile Special Forces climates, hostile forces, and improbable odds.

Introduction However, in a recent document put This chapter analyses the contemporary use WRJHWKHUWRLQÁXHQFHWKHXVHRI866SHFLDO b of UK Special Forces (SF), comparing the Operations Forces (SOF) by the then- blanket opacity that surrounds them to the incoming Donald Trump presidency, SOF V\VWHPVRSHUDWHGE\WKH8.·VFORVHVWDOOLHV interviewees highlighted the fact that they and exploring some of the consequences WHQGWREHFROORTXLDOO\GHÀQHGDV´IRUFHV RIFXUUHQWZHDNQHVVHVLQWKH8.·VSROLFLHV that do missions that no one else can 126 This is a particularly crucial question as do.” They emphasised the fact that some their share of combat operations is set to missions SOF are currently conducting may grow,120 with investment climbing,121 and be better suited to regular forces, and that no immediate end in sight to the complex reassigning those missions would free up an threats that face UK security. over-strained and heavily committed SOF force to better prioritise their activities.127 In a The British government has long cultivated similar vein, a 2010 study that drew heavily the cloak of secrecy surrounding its SF units on US SOF engagement highlighted the fact like the Special Air Service (better known that “simply because SOF can do just about by its acronym, the SAS). Originally formed anything does not mean they should do during but disbanded after the Second World everything.”128 War, it was not long before the government once again came to recognise the utility of There is no publicly-available, modern small, secretive, and highly adaptable units. description of what UKSF tasks, strategies, In 1947, against the backdrop of spiralling attributes, or responsibilities are. Instead, violence in Palestine, records state that it we have an outdated memo from the 1969 became clear to the government that “some Ireland campaign, when the MOD reported type of special force was necessary, but to that likely tasks of the SAS were as follows: EHXVHIXOLWKDGDOVRWREH¶H[SHQGDEOH· This would enable the government DQGWKHFRPPDQGHUWRSOHDG¶SODXVLEOH GHQLDELOLW\·µ122 That same year, a reserve SAS unit (the 21st) was created. By 1959, the SAS had added a permanent unit (the b nd rd 7KH86PDNHVDGLVWLQFWLRQEHWZHHQLWV¶FRUH·6SHFLDO 22 ) and another reserve unit (the 23 ) to its )RUFHVZKLFKLWEUHDNVLQWRWZR¶WLHUV· 7LHU'HOWD 123 ranks. Force and SEAL Team 6/the US Naval Special Warfare Development Group, Tier 2: the rest of the Navy SEALS Opacity has helped a myth of invincibility to and the Green Berets), and a broader descriptor of grow around the SAS which, while useful Special Operations Forces, which includes regular for generating fear and respect, may not be units who support SF (predominantly the Rangers). In the US, this distinction is important, as different roles, the most reliable yardstick against which to responsibilities, and levels of oversight apply depending measure what the force is actually capable on who you are talking about within the SF or the wider of. Following the Iranian Embassy Siege 62)FRPPXQLW\+RZHYHUWKLVÀWVRQO\DZNZDUGO\ZLWK in 1980, the rest of the decade went on to the UK experience. Mostly, the UK is considered not to have multiple tiers of Special Forces, with its SAS and become an important period for cementing 6%6WHDPVIXOÀOOLQJWDVNVWKDWZRXOGVLWZLWKERWK7LHU WKH%ULWLVKSXEOLF·VIDVFLQDWLRQZLWKWKHVH 1 and Tier 2 SF in the American system. It is unclear seemingly invincible military units.124 A ZKHWKHUEXGJHWDU\LQFUHDVHVWKDWSHUWDLQWR8.¶6SHFLDO public fascination with the idea of Special )RUFHV·DOVRFRYHUHOHPHQWVVXFKDVWKH6SHFLDO Forces Support Group, as blanket opacity appears to Forces appears to continue to this day, with EHDSSOLHGWRDOOSDUWVRIWKH8.·VZLGHU6SHFLDO)RUFHV television shows like “SAS: Who Dares network, and there is not a British tradition of using the Wins”125 where former members of the wider term SOF. For this reason, we use the term SF to UKSF community put members of the public refer to the UK context, and only use SOF when talking about the American system, to make it clear when through gruelling SAS-style training. The the statistics and information that we cite apply to the message that is constantly reinforced in the broader US SOF community.

Remote Control Project | 16 role is echoed in NATO doctrine, which states that “special operations may complement—but must not compete with, nor be a substitute for— conventional operations.”132 However, in recent years, we have seen UKSF acting as the sole UK boots on the ground, suggesting that we can only currently see a small part of the strategic picture surrounding the use of SF.

The SAS and the Special Boat Service (SBS) themselves are small, with a few hundred personnel.133 This might seem to make their opacity a small problem for the 8.·VXVHRIDUPHGIRUFH+RZHYHUEHFDXVH DQ\RSHUDWLRQWKDWLVGHVLJQDWHGDV¶VSHFLDO· appears to fall under the blanket opacity policy, there is a wider network of forces whose actions may also be obscured when they are working with SF, regardless of the VHQVLWLYLW\RIWKHUROHVWKDWWKH\DUHIXOÀOOLQJ or whether they themselves are Special Forces.

)RUH[DPSOHWKH8.·V6SHFLDO)RUFHV Support Group (SFSG) – set up in 2006 - LQFOXGHV¶UHJXODU· DOEHLWHOLWH XQLWVOLNHWKH Iranian Embassy after SAS raid (image credit: Paras (The Parachute Regiment) and the Steve White/ Wikimedia Commons) Royal Marines. These units train separately, EXWZRUNWRVXSSRUWWKH¶FRUH·RI8.6) They have been reported as working on the ground alongside the SBS in places like Sirte, Libya in 2016, in connection with a. The collection of information on the strikes against ISIS, but when pressed the location and movement of insurgent government refused to comment on the 134 forces story. b. The ambush and harassment of 7KH8.JRYHUQPHQWUHFHQWO\FRQÀUPHGWKDW insurgents the SFSG is often subject to the same no c. ,QÀOWUDWLRQRIVDERWDJHDVVDVVLQDWLRQ comment policy as UKSF. Fallon stated: and demolition parties into insurgent “When under the operational command held areas of the Director of Special Forces, units of d. Border surveillance the Armed Forces attached to the Special e. Limited community relations Forces Support Group are subject to the f. Liaison with, and organisation, training same disclosure policy as other elements of and control of, friendly guerrilla forces the Special Forces.”135 This raises interesting operating against the common enemy129 questions as to how expansive the UK The wording of these tasks is very much government considers its no comment policy focussed on the operations of the day and to be. is most likely of limited applicability to their For example, if the no comment policy can current usage. For example when it comes be extended to cover regular units under to counter-insurgency, leaked UK guidance SFSG when they are on special operations, emphasises the fact that SF “should be can it be extended to the use of armed used to complement rather than replace drones in support of special operations? Or conventional units,”130 and should “only be to the activities of the Specialised Infantry employed on high value counterinsurgency tasks.”1317KLVHPSKDVLVRQ6)·VVXSSRUWLQJ

17 | All quiet on the ISIS front? Battalions, the new arrivals that have been £2 billion of new investment in the capability SLWFKHGDVDVRUWRI¶VHPLVSHFLDO·UHFUXLWLQJ of UKSF, according to the 2015 Spending pool for other parts of the Special Forces, Review.140 and which are in early stages of set-up at the beginning of 2017? In fact, the Government In the US, where more statistics are has recently indicated that there will be available, the picture is even starker. From certain operations under which these units 2001 to 2011, funding for their SOF more would also fall under the same no comment than doubled, from roughly 3.8 billion dollars policy, as would any regular unit falling under to more than 9.8 billion dollars. Over the the command of the Director of Special VDPHQLQH\HDUSHULRG62&20·V 6SHFLDO Forces.136 Operations Command) manpower increased by more than 28%, growing from 45,655 to In the US, levels of scrutiny and oversight for 58,657 individuals. The command and its 62)DUHODUJHO\GHOLQHDWHGE\ZKDW¶WLHU·RI components were projected to add more 62)\RXDUHWDONLQJDERXWDQGWKRVH¶WLHUV· WKDQDGGLWLRQDOSHRSOHDÀJXUHWKDW are arranged by the roles and responsibilities was achieved by March 2015 when troop of the units (see footnote b). However, numbers stood at 69,000.141 This means that in the UK the same SF units (or regular there has been a roughly 50% increase in units working alongside SF units) can be SOCOM manpower over a 14-year period. responsible for highly sensitive counter-terror strikes one day, and training and advising 'XULQJÀVFDO\HDUWKHDYHUDJHQXPEHU local allies the next. Treating all of these of US SOF personnel deployed overseas things as equally sensitive and therefore was 2,886. As of mid-May 2010, these equally deniable does not seem logical, and numbers had roughly quadrupled, with having an expansive policy of no comment the average number of US SOF deployed 142 that can cover any unit working to support overseas rising to 12,560. In March 2015, SF would create a loophole that could allow US SOF were reportedly deployed to over 80 143 the government to obscure a whole host of countries. SOF were recently described as actions that would normally be declared. WKH2EDPDDGPLQLVWUDWLRQ·V´PLOLWDU\WRRORI choice.” They have certainly been insulated This is of particular concern in an age from the hundreds of billions of dollars that where UKSF, and special operations, are ZHUHFXWIURPWKH86PLOLWDU\·VVSHQGLQJ LQFUHDVLQJO\PRYLQJIURPD¶TXLFNLQTXLFN plans,144 and new plans seem to suggest that RXW·WHPSRWRHQGXULQJFRPPLWPHQWVDQG DVLJQLÀFDQWQXPEHURI6SHFLDO2SHUDWLRQV rolling deployments in countries where the Forces — projected at 12,000 — will remain UK does not have authorisation for regular deployed around the world.145 boots on the ground. The UK appears to have looked to the US as a guide for where to direct funds for its The golden age of Special Forces own military. In the 2010 SDSR, the UK government committed to “focus on areas “We will more than double our current of comparative national advantage valued planned investment in Special Forces by key allies, especially the US, such as equipment to enhance their ability to operate our intelligence capabilities and highly and strike globally in the most hostile capable elite forces.”146 In 2015 this was environments on their own or with our echoed: “our special relationship with the US closest allies, and in particular to enhance remains essential to our national security. their counter-terrorism capabilities.” It is founded on shared values, and our - National Security Strategy and Strategic exceptionally close defence, diplomatic, 147 Defence and Security Review 2015137 security and intelligence cooperation.”

The war on terror has been dubbed “the Nevertheless, testament to the fact that golden age of Special Forces”.138 In the UK, keeping a lid on covert operations is the government pledged to more than double EHFRPLQJHYHUPRUHGLIÀFXOWLQWRGD\·V investment in SF equipment in its latest information age, our research shows that it national security strategy.139 This amounts to

Remote Control Project | 18 is possible to knit together a picture of UKSF In March 2016, the then-British Secretary of deployments to places like Iraq, Syria, Libya, State for Foreign and Commonwealth Affairs, Yemen and Somalia from open sources. 3KLOLS+DPPRQGFRQÀUPHGWKDW¶PLOLWDU\ DGYLVHUV·ZKRVHQXPEHUVDUHXQNQRZQ Sometimes this takes place on the front had been deployed to Libya, but would not lines, sometimes the UK plays a supporting comment on what they were doing.151 This role. Consistently, however, the UK has coincided with the release of a leaked memo shown a tendency to be less transparent between Jordan and the US that revealed 148 about its use of SF than its allies. that UK SAS troops have been on the Worryingly, the UK government has also ground in Libya since at least the beginning not articulated a strategy that might knit of the year.152 these engagements together into a coherent response to the threat of terrorism. In May 20168.6)UHSRUWHGO\ÀUHGRQDQG destroyed, an ISIS suicide-truck heading for Libya Misrata.153 This was followed by reports that British Special Forces had been ambushed In February 2016, UKSF were reported to E\,6,6ÀJKWHUVZKLOHLQFRQYR\ZLWK,WDOLDQ be working alongside their counterparts in Special Forces, while heading from Misrata the city of Misrata,149 as other claims began in the direction of Sirte. The same report to surface that UKSF were escorting MI6 cited SBS and SFSG plans to join allies in an WHDPVWRPHHWRIÀFLDOVWRGLVFXVVVXSSO\LQJ assault on Sirte.154 ZHDSRQVDQGWUDLQLQJWRWKHUHJLPH·VDUP\ 150 and militias. By July 2016, recordings of British, French and US forces coordinating air strikes from a base near Benghazi were released,155 followed by reports that UKSF had attacked IS suicide vehicles, directed assaults and provided life-saving equipment to Libyan troops in Sirte.156 In one gun battle near Sirte, members of the SBS reportedly killed WKUHH%ULWLVKERUQPHQÀJKWLQJIRU,6,6157

This was backed up in August 2016 with reports that UKSF had reportedly helped /LE\DQÀJKWHUVÁXVK,6,6RXWRI6LUWH158 topped off by interviews with elite US personnel that suggested British troops were operating alongside them in the city.159

In October 2016, a report suggested that the UK is supporting Coalition air strikes against ISIS in Sirte,160 and in February 2017 this was backed up when an interview ZLWKDVHQLRU86RIÀFLDOIROORZLQJD-DQXDU\ airstrike that reportedly killed more than 80 members of ISIS in Southern Libya referenced the involvement of UKSF in gathering intelligence after the strike. For example, collecting computer data, documents, and potentially even facilitating WKHLQWHUURJDWLRQRIVXUYLYLQJ,6,6ÀJKWHUVE\ local Libyan forces.161

Somalia

US investment in their Special Forces has In June 2007 it was reported that a joint dramatically increased (image credit: US Navy/ US/UKSF mission had been launched Wikimedia Commons) in Somalia to try and track down foreign

19 | All quiet on the ISIS front? terrorists. DNA samples of those killed in AQAP,169 suggesting that the UK had at least the raids were apparently collected and been directly involved in the country, if not analysed, with the hope of disrupting terror VSHFLÀFDOO\DVSDUWRIWKH&RDOLWLRQ cells back in the UK.162 Afghanistan In March 2012 the former chairman of the Commons Counter Terrorism Sub- In August 2015, reports suggested that Committee announced that “Somalia is members of the SAS and SBS had been FOHDUO\WKHVLWHRI%ULWDLQ·VQH[WRYHUVHDV sent back to Afghanistan to help US SOF engagement… there have been a series of to lead counter-terror strike operations incursions into Somalia by British troops… against the Taliban and members of the ISIS Our Special Forces wield a considerable splinter group that had established itself in amount of power in the region. There is no Afghan territory. This was reported to be a doubt we are involved in the war against al- step up from their previous mission to train Shabaab.”163 ORFDO6SHFLDO)RUFHVXQLWVDIWHUWKHRIÀFLDO withdrawal of British troops in 2014.170 In October 2013, an assault took place in the coastal town of Barawe, a location linked Syria to the leadership of al-Shabaab. Al-Shabaab In June 2016, reports began to emerge that claimed that British and Turkish SF carried 8.6)ZHUHÀJKWLQJRQWKH6\ULDQIURQWOLQH RXWWKHUDLGDQGWKDWRQH6$6RIÀFHUZDV from al-Tanf.171 A commander of the New killed. An MOD spokesman said that “no UK 6\ULDQ$UP\FRQÀUPHGLQDQLQWHUYLHZWKDW forces at all” were involved.164 British troops crossed over from Jordan after a wave of ISIS assaults, claiming that In March 2016, the same leaked memo “they helped us with logistics, like building that implicated UKSF in Libya also placed defences to make the bunkers safe.”172 the spotlight on Somalia, with King Abdullah stating that his troops were ready with Britain This was backed up by reports in July 2016 and Kenya to go “over the border” to attack of a Russian attack on the al-Tanf base a 165 al-Shabaab in Somalia. month before, apparently only a day after UKSF had crossed back into Jordan.173 In In April 2016, a report emerged that UKSF August 2016, the BBC published images of KDGEHHQWUDLQLQJORFDOVROGLHUVKRZWRÀJKW what it says are UK SOF at al-Tanf back in al-Shabaab from a camp just north of the June, securing the perimeter.174 capital Mogadishu. The team was also cited as having a mission “to disrupt and stop al- A spokesman for the New Syrian Army 166 6KDEDDE·VRSHUDWLRQVµ refused to comment on the pictures of UKSF, but said: “We are receiving special In February 2017, a report on US special forces training from our British and American RSHUDWLRQVLQ.HQ\D·V%RQL1DWLRQDO5HVHUYH SDUWQHUV:H·UHDOVRJHWWLQJZHDSRQVDQG on the border with Somalia claimed that equipment from the Pentagon as well as there had been British (and other allied) complete air support.”175 intelligence and SF support.167 In August 2016, UKSF reportedly captured Yemen a senior ISIS commander after a battle near In January 2016 the MOD admitted that al-Tanf in support of the New Syrian Army.176 British forces were present in the operation It was also reported that Royal Marines room in Riyadh for the Saudi air strikes would join SAS in training elements of the against Yemen, but without having an New Syrian Army in Jordan.177 operational role.168 Iraq However, a report released in April 2016 In August 2016, reports of UKSF on the referenced interviews with British, Saudi and ground began to surface despite the fact that

Remote Control Project | 20 State commanders before a major assault the authorisation for the use of force that on Mosul (May 2016),179 and that a UK SAS ZDVDSSURYHGE\3DUOLDPHQWVSHFLÀFDOO\ sniper had reportedly killed an ISIS suicide precluded the deployment of ground troops: bomber in a village just north of Baghdad (Aug 2016).180 “[Parliament] notes the Government will not deploy UK troops in ground combat In October 2016, reports suggested that operations… and accordingly supports some 250 UK troops had been deployed to +HU0DMHVW\·V*RYHUQPHQWLQWDNLQJ assist the retaking of Mosul, and a further PLOLWDU\DFWLRQVSHFLÀFDOO\DLUVWULNHV 250 had been deployed to assist the Joint exclusively against ISIL in Syria; and offers Force training the Kurdish forces in Erbil.181 LWVZKROHKHDUWHGVXSSRUWWR+HU0DMHVW\·V Armed Forces.”186 In November 2016, it was reported that British SAS forces had been given a hit list of Similarly, there has been no authorisation of UK terrorist targets in Iraq.182 military deployments to Libya despite large numbers of reports of UKSF action on the In February 2017, reports began to emerge ground.187 In a recent report from the Foreign that UKSF who were supposed to have been $IIDLUV&RPPLWWHHRQWKH8.·VUROHLQWKH HPEHGGHGZLWK,UDTLDQG.XUGLVKÀJKWHUVDV FRQÁLFWLQ/LE\DWKHZULWHUVDFNQRZOHGJHG advisers have been dragged into the battle reports of UKSF operating in combat roles in for Mosul, spearheading attacks alongside the country, noting that: US and local allies from the west of the city.183 ´LWLVGLIÀFXOWWRVTXDUHUHSRUWVRI%ULWLVK Special Forces participating in combat with the comment by the Secretary of State for The blanket opacity policy Defence in May 2016 that:

´$GHÀQLQJFKDUDFWHULVWLFRIDGHPRFUDWLF we do not intend to deploy ground forces society is our trust in our institutions and in any combat role. Before engaging in democratic oversight by parliamentarians any military operation in Libya, we would of those who work so hard to keep us safe. of course have to seek an invitation from We have that oversight with our police and the Libyan Government, and would also 188 with our security services, but we do not yet have to involve this Parliament.” have it with UK Special Forces under the Neither of these conditions were met. The Intelligence and Security Committee or the internationally recognised Government Defence Committee.” of National Accord (GNA) has not invited – Angus Robertson MP, member of the the UK to play a combat role, and the ISC184 UK Parliament has not been involved in GHOLEHUDWLRQV,QGHHGLQDQHDUOLHUEULHÀQJ “If they are classic Special Forces operations called “We need greater transparency – sharply in, and sharply out – then you on UK military operations in Libya”, our would need to maintain their secrecy. If they analysis charted the full list of contradictory are part of a strategy you would expect that and confusing statements given by the strategy to be overseen.” government in denying the existence of plans to commit troops to Libya.189 – Crispin Blunt MP, Chair of the Foreign Nevertheless, the British system as it stands 185 Affairs Committee allows the government to deny the presence of UK troops in a combat role in Libya, even Lack of legislative oversight when it has a SF presence on the ground, regardless of the scale, duration, or nature of It is an interesting quirk of British procedure their role. that SF are automatically omitted from parliamentary discussions and authorisations While a convention now exists that of the deployment of UK ground forces. For parliamentary approval will be sought once example, despite the presence of UKSF certain thresholds have been reached in places like al-Tanf in southern Syria, (including that the possibility of premeditated military action exists, and military forces are

21 | All quiet on the ISIS front? to be deployed in an offensive capacity)190 Committee in respect of the intelligence D3DUOLDPHQWDU\%ULHÀQJRQWKHLVVXH services”, Michael Fallon, Defence argued that Special Forces are an “obvious Secretary, simply replied “No”.197 exception.”191 ,Q2FWREHUZHÀQDOO\VDZZULWWHQ In contrast to the lack of legislative oversight FRQÀUPDWLRQWKDWWKHDFWLYLWLHVDQGEXGJHWRI of UKSF, the actions of the intelligence UKSF are overseen by government ministers services have been brought under increasing and the National Security Council (NSC).198 oversight since the start of the war on However, it is unclear what scrutiny is terror. The 2013 Justice and Security Act afforded in the case of UKSF commitments strengthened the ISC, giving Parliament outside of areas of declared hostilities – greater powers to scrutinise the operational like those currently taking place under the activities and wider intelligence activities of banner of counter-terrorism. the government.192 Bodies such as the NSC operate by holding As well as MI5, MI6 (also known as the VHVVLRQVRQVSHFLÀFPLOLWDU\RSHUDWLRQV Secret Intelligence Service, or SIS), and VXFKDVWKH¶QRÁ\]RQH·WKDWZDV GCHQ, the ISC examines the intelligence- implemented over Libya during Operation UHODWHGZRUNRIWKH&DELQHW2IÀFHLQFOXGLQJ Ellamy.199 It is unclear what role it has played the Joint Intelligence Committee (JIC); the in scrutinising UK strategy or activities in the Assessments Staff; and the National Security FRXQWU\VLQFHWKHQ*UHDWHURIÀFLDOFODULW\RQ Secretariat. The Committee also provides the ministerial oversight of UKSF would also oversight of Defence Intelligence in the MOD be hugely helpful. DQGWKH2IÀFHIRU6HFXULW\DQG&RXQWHU 7HUURULVPLQWKH+RPH2IÀFH193 An additional layer of scrutiny has emerged now that MI5, 0,DQG*&+4HDFKKDYHSUHVVRIÀFHUV authorised to speak to the media.194

There is no parallel parliamentary system to oversee the actions of UKSF. As their operations contain sensitive intelligence and security information, the Defence Committee of Parliament does not have the clearances needed to monitor them. The ISC, as the only Committee of Parliament composed of members with security clearance, does have the relevant permissions, but does not have the mandate, nor the resources. The Foreign Affairs Committee, although it reports on UK interventions abroad, does not have the clearances or the remit to include any information about UKSF outside of public media reports of their actions. In addition, LQIRUPDWLRQDERXW8.6)LVVSHFLÀFDOO\ exempt from the Freedom of Information Act,195 and any stories that are leaked DUHRSHQWRSURVHFXWLRQXQGHUWKH2IÀFLDO Secrets Acts.196

In response to a parliamentary question from Yasmin Qureshi MP in July 2016 on whether the government would “assess the potential merits of appointing a committee of parliamentarians to oversee the operations and budget of special forces, similar to the functions of the Intelligence and Security

Remote Control Project | 22 The US approach

It is not the case in other countries that the actions of Special Forces are exempt from legislative scrutiny. For example, in the US, SOF are formally overseen by the Armed Services Committees RIWKH6HQDWHDQG+RXVHRI5HSUHVHQWDWLYHVVSHFLÀFDOO\E\WKH6XEFRPPLWWHHVRQ(PHUJLQJ Threats and Capabilities.200 The Subcommittees have often held hearings covering SOF strategy and policy in public, with SOF commanders giving testimony. For example, in 2014 Admiral William McRaven, Commander of the US Special Operations Command, gave wide-ranging testimony before the Senate Subcommittee, including details of SOF operational activity, analysis of the threat environment, force composition and deployment, and strategic approach.201

There are signs that Obama attempted to institutionalise greater accountability for SOF deployments GXULQJKLVSUHVLGHQF\8QGHU3UHVLGHQW*HRUJH:%XVK-RLQW6SHFLDO2SHUDWLRQV&RPPDQG·V (JSOC) operations were rarely briefed to Congress in advance — and usually not afterwards — because government lawyers considered them to be “traditional military activities” not requiring such QRWLÀFDWLRQ3UHVLGHQW2EDPDWRRNWKHVDPHOHJDOYLHZEXWLQVLVWHGWKDW-62&·VVHQVLWLYHPLVVLRQV be briefed to select congressional leaders.202

It may even be the case that this increasing congressional oversight means that UKSF activities that are carried out alongside their US allies are overseen and scrutinised by Congress, even while they are not overseen by Parliament. For example, the new US National Defense Authorization Act IRU)LVFDO86@DUPHGIRUFHVWKDWWDUJHWVDVSHFLÀF individual or individuals.”203

This increased oversight occurred whilst a major expansion of SOF activity took place,204 and has seemingly not prevented JSOC, SOCOM and the CIA acting as powerful forces with a global reach.205

The Norwegian approach

Norway has gone one step further and adopted an approach whereby parliamentary authorisation is required before the deployment of Special Forces. For example, in May 2016 the Norwegian government announced that it would consult with Parliament about whether or not Norwegian Special Forces would be required to enter Syrian territory, and the authorisation came through in June 2016.206

7KHGHFLVLRQZDVDFFRPSDQLHGE\DQRIÀFLDOVWDWHPHQWE\WKH'HIHQFH0LQLVWHUSURYLGLQJWKH rationale behind the deployment as the need to provide more support to local anti-ISIS forces, who were reportedly making better progress than previously expected.207

In December 2008, a similar vote went the other way, when then-President of the Parliament requested that the government be able to send Norwegian Special Forces to Afghanistan if NATO asked for them. On the grounds that the Norwegian contribution to Afghanistan was already one of the highest when compared to population size, the motion was rejected.208

23 | All quiet on the ISIS front? Culture of no comment and the blanket Uncharacteristically, the government broke opacity policy slightly with its usual no comment in its response: It has long been accepted that “WKH02'·V long-held policy is not to comment on “While it is a longstanding Government policy Special Forces.”209 This means that the not to comment on Special Forces activity a JRYHUQPHQWFDQGHÁHFWTXHVWLRQVRQDQ\ )RUHLJQ2IÀFHVSRNHVSHUVRQVDLG aspect of UKSF, including information about ZKHUHWKH\·UHEHLQJXVHGKRZWKH\ÀWLQWR We have previously provided counter- 8.GHIHQFHVWUDWHJ\DQGZKDWUROHVWKH\·UH terrorism capacity building support to the playing on the ground. Yemeni Security Services to increase their ability to disrupt, detain and prosecute This blanket opacity policy effectively suspected terrorists in line with Yemeni quashes informed parliamentary and public rule of law and international human rights debate, and it has been used repeatedly standards. Following the suspension over the last year to mask what appears to RI(PEDVV\RSHUDWLRQVLQ6DQD·DLQ be a growing UK military response to ISIS: February 2015 we suspended this activity. We continue to work with regional and ‡ In February 2016, claims surfaced that international partners to tackle the threat UKSF were spearheading a “secret war” posed by terrorist organisations including against ISIS in Libya, including covert AQAP and Daesh-Yemen and to build discussions about supplying weapons regional capacity on counter terrorism. For and training armies and militias. The operational reasons we cannot comment in MOD responded that it is a “long-held detail on this activity.”216 policy… not to comment on Special Forces.”210 $VWKH8.·VUHVSRQVHVWRJOREDOLQVHFXULW\ increasingly rely on UKSF and other covert ‡ In March 2016, when a leaked memo means of engaging in warfare, the release FRQÀUPHGWKDW8.6)KDGEHHQRSHUDWLQJ RIPRUHXQFODVVLÀHGRIÀFLDOVWDWHPHQWVRQ in Libya since at least the beginning of SF activity would help ensure that public 2016, this was repeated: “It is our long- debate and parliamentary scrutiny of UK VWDQGLQJSROLF\WKDWZHGRQ·WFRPPHQW military action overseas is not unreasonably 211 on Special Forces operations.” restricted. Unfortunately, it is more often that we see the government cracking down on ‡ In May 2016, a story began to circulate the release of this information than providing WKDW8.6)KDGÀUHGRQDQGGHVWUR\HG it. an ISIS suicide-truck heading for 0LVUDWD7KHRIÀFLDOVWDWHPHQW´7KH In 2013, an ex-SAS serviceman opened a Ministry of Defence does not comment case against the London Metropolitan Police 212 on Special Forces.” When a report for unlawful arrest after he was accused later that month suggested that the RIEUHDFKLQJWKH2IÀFLDO6HFUHWV$FWDQG SFSG and the SBS may be involved in leaking information to Sky News.217 The planning an attack against ISIS in Sirte, charges were later dropped after High Court a spokesperson replied that “The MoD judges found no grounds to suspect that QHLWKHUFRQÀUPVQRUGHQLHVFODLPVDERXW information had been disclosed “which was 213 Special Forces activity.” likely to cause or to have caused damage to the security or intelligence agencies or to ‡ In June 2016, it was reported that their work.”218 8.6)ZHUHRQWKHIURQWOLQHLQWKHÀJKW against ISIS, this time in Syria. The MOD In some cases, measures to restrict the responded that “It is our longstanding appearance of stories about SF activities SROLF\WKDWZHGRQ·WFRPPHQWRQ6SHFLDO in the press seem to have been unevenly 214 Forces operations.” applied. For example, during the recent wars in Iraq and Afghanistan, a number of The only crack that we have observed in this ¶SRVLWLYH·DFFRXQWVRI6)VXFFHVVHVZHUH policy followed a report in April 2016 about reported on,219 raising suspicions that these UKSF playing a leading role in some ground OHDNVKDGWKHXQRIÀFLDOEOHVVLQJRIWKH operations in Yemen.215

Remote Control Project | 24 MOD.220 However, when it came to a story While the system insists that “public OHDNHGE\DQH[6$6VHUYLFHPDQDERXW6)·V GLVFXVVLRQRIWKH8QLWHG.LQJGRP·VGHIHQFH role in the rendition of Iraqis and Afghans to and counter-terrorist policy and overall prisons where they faced torture, the MOD strategy does not impose a threat to national swiftly obtained a court order to prevent security and is welcomed by Government,”226 further disclosures.221 a March 2015 review of the system notes that: The UK also operates a voluntary self- censorship mechanism for the media when ´6SHFLDO)RUFHV 6) DUHSUREDEO\WKHOHDVW it comes to releasing material about UKSF. willing of all the agencies to engage with The Defence Advisory Notice System (also the media (in spite of a certain amount of known as the D Notice System) is used to OHDNLQJDQGVHOISXEOLFLW\E\H[6)PHPEHUV  advise the media about whether publishing DQGWHQGWRVWLFNWRWKHIRUPXODRI¶QHLWKHU material they receive about UKSF might FRQÀUPQRUGHQ\·DQ\LQIRUPDWLRQUHODWHG be harmful to national security. In addition WR6)7KLVFDQPDNHLWTXLWHGLIÀFXOWIRU to SF, the system covers information on the media to judge the veracity of some of military operations, nuclear and non-nuclear the stories that are put to them or to weigh weapons and equipment, ciphers and secure the security implications [of publishing the communications, sensitive installations information].”227 and home addresses, and UK Security and Intelligence Services.222 Perhaps as a consequence of this lack of serious debate, when the media do pick The committee that runs the system is up stories of UKSF in action, it tends to be not subject to the Freedom of Information in hyperbolic and nonsensical language, Act 2000, or the Freedom of Information with headlines like “Hero SAS sniper kills (Scotland) Act of 2002.223 It does, however, four ISIS thugs with a SINGLE BULLET as release some limited statistics about they prepared to murder hostages using how many requests it gets for each of its DÁDPHWKURZHU·”228, “*27&+$+HUR6$6 categories. For example, the May 2015 sniper saves hundreds of lives by killing minutes note 27 requests for information ISIS suicide bomber with just one shot”229 or about stories concerning UKSF in the six recently “%ULWLVKVSHFLDORSVZDUÀJKWHUNLOOV months preceding the meeting, and noted ISIS terrorist with axe, frees sex slaves”230 that extended dialogue and negotiation had been needed to get the advice of the Rather than allowing the occasional leak of Committee accepted.224 Compliance with the 6)¶JRRGQHZV·VWRULHVLWZRXOGEHHDVLHU system does not, however, mean that editors to hold the government to account over are immune from being pursued under the LQIRUPDWLRQUHOHDVHGLQRIÀFLDOXQFODVVLÀHG 2IÀFLDO6HFUHWV$FW225 EDFNJURXQGEULHÀQJVRQ6)DFWLYLWLHV Unfortunately, in contrast to its allies, the UK has not chosen to do this (see box on following page).

25 | All quiet on the ISIS front? , 5HODWLYHWUDQVSDUHQF\IURP%ULWDLQ·VDOOLHV

, While it may seem to make sense for the SAS and other UKSF to have the right to operate outside RIWKHSXEOLFH\HRXUUHVHDUFKKDVVKRZQWKDWEODQNHWRSDFLW\LVQRWWKHQRUPDPRQJ%ULWDLQ·VDOOLHV )RUH[DPSOHLWLVQRWXQXVXDOIRURIÀFLDOVSRNHVSHRSOHIURPWKH$PHULFDQ$XVWUDOLDQDQG&DQDGLDQ administrations to publicly announce details of SOF deployments.231 This provides reporters, and the general public, with an important opportunity to question government strategy and debate the LPSOLFDWLRQVRIWKHLULQYROYHPHQWLQFRQÁLFWVRYHUVHDV

,Q2FWREHU3UHVLGHQW2EDPDDQQRXQFHGWKDWKHKDGDXWKRULVHGWKHÀUVWVXVWDLQHG deployment of Special Forces to Syria. He reported that they would number fewer than 50 personnel, and were being deployed to strengthen anti-ISIS forces. The statement came by way of DQRIÀFLDOVSRNHVSHUVRQZKRGHIHQGHGWKHPRYHDJDLQVWDFFXVDWLRQVRIPLVVLRQFUHHSIURPWKH PHGLDDXGLHQFHDQGLQVLVWHGWKDWWKLVGLGQRWPHDQWKDW2EDPD·VVWUDWHJ\WRDYRLGSXWWLQJFRPEDW troops in Syria had fundamentally changed.232

In April 2016, Obama announced that he was sending an additional 250 SOF to Syria,233 with an additional 200 announced in December 2016 to aid the campaign to retake Raqqa from ISIS control.234

In November 2015, Canadian Prime Minister Justin Trudeau gave a press conference where he GLVFXVVHGLQFUHDVLQJ&DQDGD·VFRQWLQJHQWRI62)WUDLQHUVLQ,UDT:KLOHWKH'HSDUWPHQWRI 1DWLRQDO'HIHQFHUHIXVHVWRGLVFXVVRSHUDWLRQDOGHWDLOVLWKDVFRQÀUPHGWKDW&DQDGD·V6SHFLDO Forces in Iraq are operating under a mandate that allows them to accompany Kurdish forces up to and across front lines and into battle.235

In a later statement, Trudeau estimated that only around 20% of Special Force activity in Iraq happens in forward positions close to the front lines, and that the remaining 80% consists of training ²DFRPPHQWWKDWZDVHFKRHGE\WKHKHDGRI&DQDGD·V6SHFLDO2SHUDWLRQV)RUFHV&RPPDQG Brigadier-General Michael Rouleau.236

In November 2015, then-Australian Prime Minister Tony Abbott announced that 200 Special Forces members had been cleared to deploy to Iraq, where they would begin to advise and assist local VHFXULW\IRUFHVLQWKHÀJKWDJDLQVW,6,6237 This was followed, in April 2016, by the announcement that the Australian Defence Inspector General had begun an investigation into the internal culture of the Special Forces.

The Australian Chief of Army, Lieutenant-General Angus Campbell, agreed to a wide-ranging independent review following a period of high-intensity Australian Special Forces deployments in the post-September 11 period. In particular, their deployment to Afghanistan between 2005 and 2013 has given rise to stories of unlawful behaviour and civilian casualties.238

Even France, who has a more restrictive approach to announcing SOF operations than many of the 8.·VRWKHUDOOLHVRIÀFLDOO\DQQRXQFHGDSUHVHQFHLQ/LE\DLQ-XO\IROORZLQJWKHGHDWKVRIWKUHH soldiers.239 ,Q2FWREHUD)UHQFKVSRNHVSHUVRQFRQÀUPHGWKDWDERRE\WUDSSHGGURQHKDG injured two members of its Special Forces in Erbil, Iraq.240

:KLOHQRWHYHU\GHSOR\PHQWRI62)LVDQQRXQFHGWKHSROLF\RISURYLGLQJRIÀFLDOXQFODVVLÀHG EULHÀQJVRQDQXPEHURI62)DFWLYLWLHVLVDQLQGLFDWLRQWKDWWKHUHLVQHYHUWKHOHVVWKHH[SHFWDWLRQ that the public should be kept as informed as possible, and that debate on SOF actions abroad should not be unreasonably restricted.

Remote Control Project | 26 Conclusions

UKSF are unique in their exemption from The amount of information about UKSF parliamentary oversight. Perhaps greater action that becomes available through inspiration could be drawn from the process XQRIÀFLDOVRXUFHVPDNHVWKHLGHDRIEODQNHW of improving the scrutiny of the intelligence opacity increasingly outdated, and the agencies, where there was an attitude of EHQHÀWVRIPDLQWDLQLQJVXFKDSROLF\VKRXOG acceptance that greater transparency is be critically examined in light of the more QHFHVVDU\LQWRGD\·VZRUOG'LUHFWRU*HQHUDO WUDQVSDUHQWSUDFWLFHVRI%ULWDLQ·VDOOLHV of the British Security Service (MI5) Andrew 3DUNHUUHÁHFWHGWKDW´:HUHFRJQLVHWKDWLQD changing world we have to change too. We have a responsibility to talk about our work and explain it.”241

27 | All quiet on the ISIS front? Case 3: sharing The sharing of capabilities is far broader than assisting allies who are engaged capabilities with allies LQFRQÁLFW+RZHYHUDVPDOOVXEVHWRI capabilities sharing occurs between the UK Introduction DQGSDUWQHUVZKRDUHHQJDJHGLQFRQÁLFWV that the UK is not considered to be a part 7KLVVHFWLRQZLOOORRNDWWKH8.·VSURYLVLRQRI of, which is where the lack of transparency capabilities, such as embedded troops and can begin to raise serious questions about LQWHOOLJHQFHWRFRQÁLFWDUHDVLQVXSSRUWRI government accountability. For example, allies. These are long-standing practices – it was revealed that before parliamentary the UK has been embedding troops in allied authorisation for the use of force in Syria, UK forces since the 1950s.242 It currently has troops had undertaken strikes in the country “over 250 exchange personnel in the armed while embedded in US forces and the UK forces of allies including the US, Australia, was “providing intelligence and surveillance Canada, Netherlands, Italy, France and to support coalition partners… carrying Germany”243 operating in places such as out air strikes in Syria against ISIL.”254 Afghanistan, Libya, Iraq and Syria.244 These activities were subjected to minimal parliamentary or public scrutiny. Embeds The UK also has a long history of sharing are deployed after ministerial approval, and intelligence with other countries, especially do not require authorisation or scrutiny from the US. In a range of agreements signed Cabinet or the rest of Parliament.255 between 1946 and 1954 (known as the UKUSA Agreement) the US and UK committed to sharing signals intelligence, Providing capabilities outside UHDIÀUPLQJWKHLU´YLWDO«FRRSHUDWLRQµGXULQJ areas of declared hostilities World War Two.245 The 1950 Burns-Templer Agreement oversaw military intelligence in a There is currently a lack of clear guidelines similar way.246 This is now one of the deepest or procedures for how the risks are managed and most comprehensive intelligence- when providing capabilities and assistance to sharing relationships in the world.247 The DOOLHVZKRDUHLQYROYHGLQFRQÁLFWVWRZKLFK core of this relationship is that between the the UK is not formally a party. For example, 86·V1DWLRQDO6HFXULW\$JHQF\ 16$ DQG according to the government, embedded WKH8.·V*RYHUQPHQW&RPPXQLFDWLRQV+HDG troops, or embeds, are considered part of the Quarters (GCHQ).248 force they are embedded in, following their chain of command and Rules of Engagement Capabilities sharing has a strong alliance- (ROEs); however, they must also follow UK building component. Embedding UK troops RoEs and UK law.256 allows “UK military personnel to gain direct experience of key capabilities and ROEs are orders that “delineate the equipment; make a positive contribution parameters within which force may be to our defence relationships with our used”,257 and are set at the operational closest allies; and can directly contribute to OHYHOLQUHODWLRQWRVSHFLÀFRSHUDWLRQVDQG HQKDQFLQJWKH8.·VPLOLWDU\FDSDELOLW\µ249 as LQOLQHZLWKODZVRIDUPHGFRQÁLFW258 They well as “those of our allies.”250 DUHWKHUHIRUHXQOLNHO\WRGLIIHUVLJQLÀFDQWO\ between allies. However, there is a possibility Intelligence is consistently portrayed as an WKDWDOOLHV·UXOHVPD\EHOHVVUHVWULFWLYHWKDQ area where the UK can “punch above its UK law in some circumstances. For example, weight,”251 and in the 2010 SDSR, the UK it has been reported that the UK has a zero- government committed to “focus on areas tolerance policy towards anticipated civilian of comparative national advantage valued casualties when conducting strikes, whereas by key allies, especially the United States, the US adopts more of a sliding scale of such as our intelligence capabilities and ¶SURSRUWLRQDOLW\·ZKHUHE\VRPHDQWLFLSDWHG highly capable elite forces.”252 In 2015 this civilian casualties are permitted when striking was echoed: “our special relationship with high-value targets.259 the US remains essential to our national security. It is founded on shared values, and The government has previously stated that our exceptionally close defence, diplomatic, 8.ODZDQGWKHODZVRIDUPHGFRQÁLFWWDNH security and intelligence cooperation.”253 precedent.260)RUH[DPSOH8.RIÀFHUV

Remote Control Project | 28 embedded in the International Security by a Memorandum of Understanding Assistance Force (ISAF) in Afghanistan held (MOU), although these are not made public a “red card…that they [could] use to refuse and requests to see the MOUs governing or approve a mission request.”261 However, controversial partnerships such as that particularly when embeds are involved in between the UK and Saudi Arabia have been FRQÁLFWVZKHUHWKH8.GRHVQRWKDYHD refused.265 formal role, greater clarity over how these risks are managed would be helpful. While sharing capabilities with allies is a necessary and desirable part of UK defence In a public evidence session with the ISC and security policy, a number of cases have in 2013, Sir John Sawers – the then-Chief revealed that there are problems with the low of the SIS, also known as MI6 – said that levels of transparency and accountability that in 2010 the UK worked “with over 200 currently accompany these activities when partners across the world.”262 He argued that the UK is providing capabilities to partners intelligence agencies often must work with ZKRDUHLQYROYHGLQFRQÁLFW7KHIDFWWKDW countries from where the threat to the UK the UK was providing capabilities rather is coming, which can involve working with than directly engaging (as well as the fact countries that do not share our democratic that some of these activities were provided values.263 He does, however, add that – to through the intelligence services) has ensure the UK acts within the law – they allowed the government to be involved (and seek assurances that “when we provide in some cases deeply involved) in overseas evidence it will be used lawfully.”264 Each FRQÁLFWVZLWKPLQLPDOVFUXWLQ\²DQGLQVRPH intelligence-sharing partnership is governed cases completely denying its involvement.

“The Doughnut”, the headquarters of the GCHQ (image credit: Ministry of Defence/ Wikimedia Commons)

29 | All quiet on the ISIS front? Syria to engage militarily in Syria, members of the UK military were already engaged – but In July 2015 the MOD revealed – in under the control of allied forces. response to an FOI request by Reprieve – that UK troops were embedded in allied Though their numbers may have been low, forces operating in Syria,266 and had troops were seemingly authorised to take been since Autumn 2014 (well before a kinetic role in Syria, which is not always parliamentary authorisation of UK strikes in the case with embeds. Vernon Coaker, the the country).267 Fallon admitted that: then-Shadow Secretary of State for Defence, noted UK embeds in Vietnam were not “Since the international Coalition DOORZHGWRWDNHSDUWLQWKHFRQÁLFW'XWFK commenced military operations against ISIL marines embedded with US marines in last year, up to 80 UK personnel have been Iraq in 2003 were “brought home” and US embedded with US, Canadian and French embeds in the British Army were not allowed forces. They have undertaken a range of to patrol the streets of Northern Ireland.270 UROHVLQFOXGLQJSODQQLQJWUDLQLQJDQGÁ\LQJ and supporting combat and surveillance The fact that the UK Parliament had no missions.”268 forewarning of the combat role of British embeds caused widespread criticism. It also emerged three days later that “a small John Baron MP, a senior Conservative number of embedded UK pilots have carried backbencher, claimed the Government had 269 out airstrikes in Syria against ISIL targets.” VKRZQ´LQVHQVLWLYLW\WR3DUOLDPHQW·VZLOOµE\ This meant that as the UK Government were not taking the issue to vote in the House of considering taking a vote on whether or not Commons.271

UK drone pilots (image credit: Defence Images/ Flickr Creative Commons)

Remote Control Project | 30 Edward Leigh MP argued in the House of Emwazi, or Jihadi John as he was dubbed Commons debate that, while “we should by the media. The then-Prime Minister, NHHSWKHHPEHGGLQJRIÀYHSLORWVLQ David Cameron stated that the UK had hundreds of missions in perspective… the been working “round the clock with the fact remains that we were given a solemn Americans to track him down” and insisted promise that if British service people were that the “contributions of both countries was to bomb in Syria, we would be consulted.”272 essential.”280 The Telegraph also reported Similarly, Jennifer Gibson, of Reprieve, also that the strike “was the culmination of 15 argues that the fact “UK personnel have months of intensive intelligence work by already been involved in bombing missions MI6, GCHQ and the CIA”, claiming that over Syria for some time” makes “the current Emwazi had been “located either by GCHQ debate over whether Britain should carry out or MI6” who then gave this information “to such strikes somewhat obsolete.”273 the Pentagon, enabling the operators of an armed Predator drone already in the sky Senior members on the opposition bench, above Raqqa to spot the car in which he was such as Harriet Harman, the then-acting travelling.”281 Leader of the Labour Party, and Coaker were also shocked they had not been briefed The International Business Times UK also – even when they attended the National described the intensive and sustained role Security Council earlier that week.274 8.LQWHOOLJHQFHSOD\HGLQÀQGLQJ(PZD]L stating that: “The Activity [a top secret US Before the UK Parliament gave authorisation special operations intelligence unit] was just for the UK to undertake strikes in Syria, RQHSOD\HULQWKHUDFHWRÀQG-LKDGL-RKQ )RUHLJQ2IÀFH0LQLVWHU7RELDV(OOZRRG03 7KH16$DQG%ULWDLQ·V*&+4DORQJZLWKWKH also admitted that the UK was “providing )%,DQG%ULWDLQ·V6HFXULW\6HUYLFH0,VSHQW intelligence and surveillance to support weeks trying to identify him.”282 coalition partners… carrying out air strikes in Syria against ISIL.”275 For example, the UK These two incidents not only raise concerns played a role in the US strike against British DERXWIDLOHGDWWHPSWVRQ,6,6PHPEHUV·OLYHV computer hacker Junaid Hussain. According but also about UK involvement elsewhere. to reports from The Times, Hussain revealed Gibson argues: his location by opening an internet link, which was allegedly sent by an “undercover ´+RZPXFKHOVHGRQ·WZHNQRZ"+DVWKLV agent after GCHQ and its US allies cracked cooperation extended to operations in encrypted Islamic State communications.”276 countries such as Yemen and Pakistan, US Col Patrick Ryder told the Guardian that where even US military generals are the two countries consulted “with each other FDOOLQJLWFRXQWHUSURGXFWLYH"7KH%ULWLVK regarding the targeting of Junaid Hussain”, public urgently needs answers about the adding “both governments will continue scope of UK involvement in both its own 283 to coordinate efforts to eliminate violent assassinations and those of the US.” extremist organisations.”277 Somalia Lieutenant-Colonel Nicholas Mercer, the Evidence suggests the deaths of British %ULWLVK$UP\·VFKLHIOHJDODGYLVHULQ,UDTLQ men Bilal el-Berjawi and Mohamed Sakr VDLGWKHFRQÀUPDWLRQRID%ULWLVKOLQN by separate US drone strikes in Somalia in WR-XQDLG+XVVDLQ·VGHDWKUDLVHG´GLVWXUELQJ 2012 had some level of British involvement. questions.”278 This is particularly true when The two men came and went between the you consider the fact that, while the UK has UK and Somalia for a number of years admitted involvement in this successful strike and were suspected of involvement with against Hussain, it has kept very quiet about al-Qaeda.284 The Economist claimed that whether or not it was similarly involved in after el-Berjawi was injured in a failed US WKH86·VÀUVWVWULNHDWWHPSWZKLFKPLVVHGLWV strike in Somalia, he called his wife and the target, instead killing three civilians.279 “telephone call seems to have been traced In November 2015, the UK government by British intelligence and the coordinates reported that it had worked “hand in glove” passed on to the Americans” – soon after with the US in strikes against Muhammad this, el-Berjawi was killed in a successful strike.285

31 | All quiet on the ISIS front? There have also been other, albeit weaker, He said: “I believe it to be true that our LQGLFDWLRQVRIWKH8.·VLQYROYHPHQWLQ intelligence information in certain cases has collecting and disseminating the intelligence pinpointed targets for attacks and those needed for allies to take action against the attacks do amount to extra-judicial killing.”292 two men. In an interview with CAGE before Ben Emmerson, UN special rapporteur he moved back to Somalia, el-Berjawi on counter-terrorism who has conducted claimed that, when being interrogated in a year-long investigation into the use of Kenya, the level of detail his interrogators armed drones by the US, UK and Israel, told knew about his life in London led him to a UK parliamentary meeting last year that believe the UK was feeding questions intelligence ties between the UK and US are to them.286 Nine months after el-Berjawi so closely intertwined that it is “inevitable” and Sakr moved to Somalia for the last such sharing had taken place293. He added: time in 2009 they were stripped of their “It would be absurd if it were not the case.”294 UK citizenship. The Snowden documents also reveal that around the same time The UK government has refused to admit their citizenship was revoked the US any involvement. In 2012, when asked VWDUWHGIROORZLQJHO%HUMDZL·VPRYHPHQWV DERXWWKH8.·VUROHLQ3DNLVWDQIRUPHU intently, collecting intelligence on him and Foreign Secretary William Hague MP said: intercepting communications – before “Once you comment on one case you have eventually pinpointing his location.287 to comment on many hundreds of other FDVHV,FDQ·WFRPPHQWRQZKRZHVKDUH It is unclear what role the UK played; intelligence with, and on what subjects.”295 however, as the Intercept concluded, ´%HUMDZL·VOLIHDQGGHDWKUDLVHVQHZ Yemen TXHVWLRQVDERXWWKH%ULWLVKJRYHUQPHQW·V (YLGHQFHKDVHPHUJHGDERXWWKH8.·VUROH role in the targeted assassination of its ZLWKLQWKH86·VGURQHFDPSDLJQLQ

The UK may have played a role in US drone Snowden documents also revealed how strikes in Pakistan. The Snowden documents a joint US, UK and Australian programme revealed a 2008 memo from the UK listing through Overhead, a surveillance network ´VXUYHLOODQFHRIWZRVSHFLÀFVLWHVDQGDQ “integrating satellite imagery with digital and 297 overview of satellite-phone communications telephonic communications”, supported 298 of the Federally Administered Tribal a fatal US drone strike in Yemen in 2012. Areas” (the area which has seen the They also revealed that these agencies largest share of US drone strikes in the developed their ability to track the location 299 country).290 A document from June 2009 of individuals in Yemen. In 2014, Yemeni also shows GCHQ speaking about its ability President Abdurabbo Mansour Hadi told to provide “tactical and strategic [signals Human Rights Watch that there was a “joint intelligence] support to military operations operation room” where the United States, in-theatre, notably Iraq and Afghanistan, but WKH8QLWHG.LQJGRPDQG1$72´LGHQWLÀHVLQ increasingly Pakistan.”291 advance” individuals who are “going to be targeted.”300 Leading experts have argued that it is likely the UK provided intelligence for US drone In April 2016, an article in Vice News by strikes. Michael Clarke, former director of journalists Jack Watling and Namir Shabibi the Royal United Services Institute (RUSI), UHYHDOHGKRZWKH8.·V6,6SOD\HG´DFUXFLDO said he would be “astonished” if the UK was and sustained role” in the country between 301 “not giving their US counterparts information 2001 and 2015. Britain reportedly had a to help them locate terrorist suspects.” very good “reservoir of knowledge, contacts,

Remote Control Project | 32 and expertise” which formed the basis for a 7KH8.·VUROHLQDLGLQJWKH6DXGLOHG good human intelligence network. Once a coalition WDUJHWZDVLGHQWLÀHGWKH6,6DQGWKH&HQWUDO Intelligence Agency (CIA) “would collaborate 7KH8.·VSDVWUROHLQ6,6@ZKRWDJJHGKLV Emirates (UAE), Egypt, Jordan, Morocco, vehicle, allowing it to be picked up by the and Sudan) began airstrikes against the Overhead program … Saleh-Houthi rebel alliance in Yemen in March 2015.309 The Overhead program, of which GCHQ is These strikes have been a part, then informed the CIA, who sought heavily criticised and the Saudi-led coalition FRUURERUDWLRQRIWKHWDUJHW·VORFDWLRQIURP has been accused of human rights abuses by a number of groups, including the UN310 RIÀFHUVDWRory Stewart, Minister for International previously provided counter-terrorism Development stated: “We provide training capacity building support to the Yemeni and capacity support, which includes Security Services” but that operations had statements about international humanitarian now ended.307

33 | All quiet on the ISIS front? , ,

$LUVWULNHVLQ6DQD·D LPDJHFUHGLW,EUDKHP4DVLP:LNLPHGLD&RPPRQV

law, but that is not about this military KDGOLDLVRQRIÀFHUVLQWKH-&3&+4KHOSLQJ operation—that is in general for the royal to monitor the current situation in Yemen and Saudi air force.”317 facilitate communication with the coalition.322

Despite these claims, the UK appears to The US has admitted to intelligence-sharing KDYHDQDFWLYHUROHLQWKHFRQÁLFWHVSHFLDOO\ with the coalition323 – though it argues this through the Joint Combined Planning Cell has been reduced.324 (JCPC) HQ. The JCPC was set up in 2015 to arrange US support to the Saudi-led In the First Joint Report of the Business, coalition, including knowledge sharing.318 In Innovation and Skills and International June this year, Saudi foreign minister Adel Development Committees of Session 2016- DO-XEHLUFODLPHG´ZHKDYH%ULWLVKRIÀFLDOV 17, “The use of UK-manufactured arms in DQG$PHULFDQRIÀFLDOV«LQRXUFRPPDQG Yemen”, the Committee complained that: and control centre. They know what the “We were told that UK personnel are not part target list is, and they have a sense of what of the intelligence planning cells, but that it is that we are doing.”319 While he argued they are in the Joint Combined Planning Cell that neither country played a role in selecting HQ. We also heard that UK personnel are targets, it was clear they are intimately in Saudi Arabia to train, educate and teach involved.320 best practice, which includes understanding In response, the MOD admitted that British IHL and training air crews and planners how forces were present in the operation room to go about assessing targets for the future, for the Saudi air strikes against Yemen, but EXWWKDWRXUOLDLVRQRIÀFHUV¶GRQRWSURYLGH claimed they do not have an operational training, they do not provide advice on IHL role.321 Later, Ellwood explained that the UK compliance, and they have no role in the

Remote Control Project | 34 6DXGLWDUJHWLQJFKDLQ·7KLVLVDQDUHDLQ WKHSODFLQJRIHPEHGVZLWKRWKHUFRXQWULHV· which there is much confusion and greater forces”, the UK government “will always clarity is needed.”325 FRQÀUPGHWDLOVLIDQGZKHQDVNHGWRGR so.”331+HSRLQWHGWRWKHJRYHUQPHQW·V Patchy government transparency past replies to “a number of parliamentary questions asking for details of embedded Scrutiny of embedded troops forces” as proof of this.332 After it was Internal mechanisms for overseeing the discovered UK embeds were operating sharing of UK capabilities with allies do exist. in Syria, Fallon committed “to increased As Fallon explains: “Ministerial approval transparency by publishing an annual update 333 is required for UK embeds to deploy with to the House on embedded personnel.” allied forces on operations” before each 7DEOHVKRZVWKHÀUVWDQGRQO\VXFKXSGDWH new deployment.326)RUH[DPSOH)DOORQ·V it shows the number of UK personnel th 334 “predecessor gave approval for embeds embedded on 30 November 2015. A few with American forces to participate when months later, the MOD released the number they were due to be deployed” and then he of UK troops embedded on the 31st March “gave a similar approval in the autumn of last 2016 in its annual report and promised year, and … subsequent approval when the to release more later this year - however Canadian forces were deployed earlier this nothing else appears to be have been spring.”327 released so far.

Experts claim that governments “will have However, the annual update provides very negotiated in advance how pilot exchange little information, and has been criticised for 335 schemes will work in the event of a unit being “hopelessly vague.” For example it is being sent on operations.”328 It was also unclear what it means operationally if troops reported that “[t]he MoD agrees each are embedded in Coalition HQs. Moreover, deployment and continually monitors the the information represents a snapshot of permissions granted to embedded troops.”329 the number of troops embedded on one 7KH3ULPH0LQLVWHU·V6SRNHVSHUVRQDOVR day meaning it provides no insight into the FRQÀUPHGWKDW&DPHURQ´ZDVDZDUHWKDW8. continuation or trends of these operations. personnel were involved in US operations On the release of these details Fallon 330 and what they were doing.” claimed that “[f]or operational and personal In terms of transparency over these security reasons the information that can 336 operations, Fallon has said that while “it be routinely released is limited.” Jennifer has been standard practice not to publicise Gibson said: “This is a long way from

7DEOH8.JRYHUQPHQW·VDQQXDOUHSRUWRQ8.HPEHGGHGWURRSV Host nation / headquarters Embedded HQ staff (PEHGGHGH[FKDQJHRIÀFHUV Australia - 2 Canada - 2 France 3 5 New Zealand - 3 Spain - 1 United States of America 13 17 Coalition HQs 94 - EU HQs 18 - NATO HQs 9 - UN HQs 10 - Total 147 30

35 | All quiet on the ISIS front? real transparency. It is impossible to tell that are approved by their procedures and what operations or even what countries Parliaments.”343 This sentiment was repeated these personnel are active in, making this in April last year when, in a statement, Fallon information almost worthless.337 Lord Touhig, argued: “The [War Powers] Convention Shadow Spokesperson for Defence, noted does not apply to British military personnel that for the “the large majority of them, embedded in the Armed Forces of other 94, in coalition HQs” Parliament does “not nations as they operate as if they were the even know where they are, yet they are KRVWQDWLRQ·VSHUVRQQHOµ344 under the command of the power of another FRXQWU\ZKRFDQFRPPLWWKHPWRFRQÁLFWDQG Oversight of intelligence-sharing Parliament has not even been told.”338 In contrast to the continuing lack of There is also limited opportunity for transparency over embeds in combat Parliament to scrutinise potential roles, in recent years there has been some deployments. Andrew Slaughter MP asked, opening up of intelligence activities, including during a debate, whether the government the creation of the ISC, the adoption of more would halt the number of embeds “until [a] open recruiting procedures, the public-facing vote [on Syria] has taken place”, to which role of agency heads, and the publication of 345 Defence Secretary Michael Fallon answered WKHLURIÀFLDOKLVWRULHV The UK government “[s]o far as any further vote in the House is also argues that intelligence-sharing FRQFHUQHGQRZHGRQRWKDYHDVSHFLÀF activities are subject to comprehensive timetable.”339 oversight. For example, the Minister of State for Foreign Affairs, Hugh Robertson MP, Attempts to get more information about the KDVVWDWHG´WKH8.·VLQWHOOLJHQFHVKDULQJ operations of embeds have not brought with the US is undertaken within a robust many fruitful results. When asked in a legal framework, and is subject to rigorous Reprieve FOI request whether UK personnel ministerial, parliamentary and judicial had been involved in strikes, the MOD oversight.”346 said: “The UK does not hold information RQWKHVSHFLÀFORFDWLRQRUQXPEHURIDLU Ministerial oversight is provided by the strikes/ISR [intelligence, surveillance overseeing Cabinet Minister, which for the and reconnaissance] sorties conducted SIS and GCHQ is the Secretary of State for by embedded personnel.”340 In response Foreign and Commonwealth Affairs. Staff at WRD'URQH:DUV8.·V)2,LQWKH these agencies are accountable to its head, Government, stated: “I am withholding who is held accountable by the Foreign information about weapons released by UK Secretary.347 This is done through one-on- personnel embedded with the United States one meetings348 and escalating concerns and Air Force on operations in Afghanistan and approval for certain operations.349 Sawers Libya.”341 As Reprieve noted, with regards to spoke of the workings of this relationship in an FOI investigating the role of UK embeds 2010 when he said: LQ86IRUFHVRSHUDWLQJLQ3DNLVWDQ´0R'·V refusal to clarify appears at odds with “I answer directly to the Foreign Secretary… comments made by [Fallon], who has said :KHQRXURSHUDWLRQVUHTXLUHOHJDO WKDW¶LIZHDUHDVNHGWRJLYHGHWDLOV·DERXW8. authorisation or entail political risk, I seek personnel embedded with other countries WKH)RUHLJQ6HFUHWDU\·VDSSURYDOLQDGYDQFH ¶ZHRIFRXUVHGRVR·µ342 If a case is particularly complex, he can consult the Attorney General. In the end, the Fallon argued in a debate on 20th July 2015 Foreign Secretary decides what we do… “we do not publicise the embedding because Submissions for operations go to the Foreign these are operations of other countries.” Secretary all the time. He approves most, When asked why the issue of embedding but not all, and those operations he does troops in Syria was not brought before QRWDSSURYHGRQRWKDSSHQ,W·VDVVLPSOHDV Parliament, Fallon said: “There are no UK that.” 350 military strikes in Syria, but I have explained to the House that where our personnel The Joint Intelligence Committee (JIC) also are embedded with other forces, they are provides high-level oversight and advises SDUWLFLSDWLQJLQWKRVHFRXQWULHV·RSHUDWLRQV PLQLVWHUV-,&VLWVZLWKLQWKH&DELQHW2IÀFH

Remote Control Project | 36 under the authority of the Secretary of the procedures are proper and lawful.”363 The Cabinet, and its permanent members are remit of these commissioners is limited to from other governmental bodies, including legality, often meaning the bulk of decisions WKH)RUHLJQ &RPPRQZHDOWK2IÀFHWKH are granular judgements about very MOD and the intelligence agency heads.351 VSHFLÀFLVVXHV1HYHUWKHOHVVDQXPEHU The Committee advises policy makers on of commentators commended the former the “priorities for intelligence gathering”, as Intelligence Service Commissioner, Sir Mark well as “assessing the results.”352 While its :DOOHU·VZLOOLQJQHVVWRFULWLFLVH*RYHUQPHQW remit is primarily focussed on monitoring in the Supplementary to his Annual Report in and assessing potential threats to the UK, 2015.364 it does provide “oversight of the intelligence FRPPXQLW\·VDQDO\WLFDOFDSDELOLW\WKURXJK Unfortunately, the role of Intelligence Service the Professional Head of Intelligence Commissioner was abolished under the Analysis.”353 Its assessments also feed into Investigatory Powers Bill (IPB), with its the NSC.354 responsibilities being taken over by the Investigatory Powers Commissioner.365 These NSC meetings provide inter- This new position (which will be held by departmental and executive oversight. Lord Justice Fulford) will be responsible for It is chaired by the Prime Minister and is overseeing how the new powers given to the “the main forum for collective discussion law enforcement, security and intelligence RIWKHJRYHUQPHQW·VREMHFWLYHVIRUQDWLRQDO agencies are used.366 David Anderson security.”355 It works to “coordinate and Q.C, the former Independent Reviewer GHOLYHUWKHJRYHUQPHQW·VLQWHUQDWLRQDO of Terrorism Legislation, is optimistic that security agenda”, and decide upon the the new “beefed-up Investigatory Powers strategic direction of British foreign, defence Commission” (which the commissioner will and security policy.356 As Sawers said in sit at the top of) will “undoubtedly wish to a speech outlining the workings of SIS scrutinise very carefully the arrangements in 2010: “Ministers tell us what they want that are put in place for the sharing of data to know, what they want us to achieve. with overseas authorities.”367 We take our direction from the National Security Council.”357 The NSC can discuss Anderson himself has provided important even the most sensitive of operations and oversight. His position allows a high level relationships and so provides a vehicle and of access, which he claims is “impressive, 368 forum for such discussions at the top level and has few parallels in other countries.” of government, which was arguably missing With this access he has written reports and 369 before.358 recommendations on terrorism legislation; for example, he made recommendations Judicial oversight used to be provided by for the new Investigatory Powers Bill (IPB) intelligence commissioners. There are two – including on the nature of intelligence- intelligence commissioners (Intelligence sharing.370 Many of these recommendations Services Commissioner, Sir John Goldring,359 ZHUHDGRSWHGLQWRWKHÀQDO,3%+HKDV and the Interception of Communications recently been replaced by Max Hill Q.C., so Commissioner, Sir Stanley Burnton360), who time will tell how this changes the dynamics are former judges appointed by the Prime of the role.371 Minister to, among other things, “keep under review the exercise and performance Nevertheless, some improvements in of the powers and duties imposed on the transparency and accountability have felt intelligence services.”361 rather forced. For example, following public, parliamentary and media pressure after The heads of intelligence agencies have WKH8.·VLQYROYHPHQWLQWKH86UHQGLWLRQ stressed the power commissioners have. and torture programmes was revealed,372 Sir Iain Lobban former Director of GCHQ, Reprieve sued the British government to said he talked to the commissioners “about publish its “torture policy” and “under court [GCHQ] methods.”362 Sawers also argued pressure” it published the Consolidated that the commissioners “have full access *XLGDQFHWR,QWHOOLJHQFH2IÀFHUVDQG6HUYLFH WRRXUÀOHV«>DQG@«PDNHVXUHRXU Personnel on the Detention and Interviewing

37 | All quiet on the ISIS front? of Detainees Overseas, and on the Passing handpicked by the Prime Minister, members and Receipt of Intelligence Relating to must be approved by Parliament.381 The Detainees.373 budget of the ISC was doubled in the same year, to £1.3 million.382 The Consolidated Guidance itself is an excellent example of the type of However, even in the face of improving WUDQVSDUHQF\RYHUWKH8.·VLQWHOOLJHQFH RYHUVLJKWLWLVFOHDUWKDWVLJQLÀFDQWLVVXHVVWLOO operations that can be achieved – albeit remain. For example, in the Supplementary under huge pressure.374 It makes efforts to to his annual report, Waller said that when provide intelligence and military personnel investigating the death of Lee Rigby, both “with some much-needed certainty [on] the he and the ISC found that the SIS had principles which govern the interviewing “a troubling tendency to be defensive of detainees overseas and the passing and unhelpful, it provided inaccurate and and receipt of intelligence relating to incomplete information and generally sought detainees.”375 Importantly, as Waller states, to “fence” with and “close down” lines of it also clearly states that: “If ministers inquiry, rather than engage constructively.”383 ultimately conclude that there is a serious While Waller said he did not believe this was risk of torture which cannot be adequately done maliciously he said the effects were mitigated, they will not be able to authorise ´VLJQLÀFDQWDQGXQVDWLVIDFWRU\µ384 the contemplated action and maintain compliance with the absolute prohibition on This is especially problematic when the work such conduct.”376 Having something similar of intelligence agencies must remain secret. on the principles governing UK intelligence- This means the bodies overseeing them VKDULQJDVSDUWRIWKH86·FRQWURYHUVLDOGURQH are dependent on them providing all the strike programme would do much to alleviate information; if intelligence agencies are not concerns about the legal implications of the doing this, then the overseeing mechanisms 8.·V¶KDQGLQJORYH·DSSURDFK will not work properly. As noted earlier, Jaffey has expressed concern that a judge giving The role of the Intelligence and Security a “yes” or “no” answer, who is dependent Committee on intelligence from the organisations it oversees and lacks anyone to provide an The ISC is the only parliamentary committee adversarial opinion will struggle to make a to have members who are security cleared, fully thought out judgement.385 and it provides parliamentary oversight (albeit often in closed hearings) of the Waller also stated that, during his intelligence agencies.377 Its establishment LQYHVWLJDWLRQLQWR/HH5LJE\·VPXUGHUWKH in 1994 was an important step forward in 6,6ZDVOHVVZLOOLQJWRHQJDJHZLWKWKH,6&·V intelligence agency accountability in the UK, LQYHVWLJDWLRQLQWRWKHVROGLHU·VGHDWKWKDQ bringing the agencies out of the shadows with his own, he said the SIS: and giving them more of a public platform. “…have a duty to work with persons There have been some attempts to address reporting on them …and adopt a early criticisms that it was too close to constructive and expansive approach to government378DQGODFNHG´VXIÀFLHQW their investigations which answers the knowledge of the operational work of the VSLULWDVZHOODVWKHOHWWHURITXHVWLRQVDQG Agencies”379 to wish to challenge them. which seeks to illuminate the surrounding In 2013 the Justice and Security Act landscape and other possible lines of increased its remit to “the wider Government HQTXLU\,EHOLHYHWKDW6,6WDNHVVXFKDQ intelligence community (beyond the three approach when I carry out my inspections, security and intelligence agencies)” and gave but that it has failed to act in the same way it “retrospective oversight of the operational ZKHQHQJDJLQJZLWKWKH,6&LQTXLU\µ386 activities of the Agencies on matters of VLJQLÀFDQWQDWLRQDOLQWHUHVWµ,QDGGLWLRQLW This adds to continued questions around the gained the ability to demand information ,6&·VDELOLW\WRKROGJRYHUQPHQWWRDFFRXQW “subject only to a veto by the Secretary of even in light of the reforms. The Economist State”;380 and the system was changed for argues that “[u]nlike its counterparts in appointing members so that instead of being $PHULFD·V&RQJUHVVLWKDVDVPDOOVWDII

Remote Control Project | 38 and it has failed to make much impact.”387 When the Snowden documents raised Intelligence expert Anthony Glees also TXHVWLRQVRYHUWKHJRYHUQPHQW·VUROHLQ argues the ISC still needs a bigger research drone strikes in Yemen and Pakistan in staff.388 Sean Kippin concluded that the ISC June 2015, the government simply said: “It “remains an imperfect and very limited body is the longstanding policy of successive UK for the regulation of the large, powerful, governments not to comment on intelligence and secretive intelligence services. Despite operations…We expect all states concerned recent reforms … it is still a body over which to act in accordance with international the government and Prime Minister exercise law and take all feasible precautions to DQHQRUPRXVDPRXQWRILQÁXHQFHµ389 avoid civilian casualties when conducting any form of military or counter-terrorist 7KHUHOHDVHRIWKH,6&·VUHSRUWRQWKH operations.”397 Similarly, in 2016, when faced Reyaad Khan case will be an important test; with revelations about Menwith Hill, GCHQ however, claims by The Times, in February cited a “long standing policy that we do not WKDWWKH,6&ZDV´GLVVDWLVÀHGµZLWK comment on intelligence matters.”398 the information it had been provided on the strike are not promising.390 Whilst giving evidence to the Bundestag, Richard Aldrich, Professor of International There is also reason to believe that the ISC Security at the University of Warwick, has unhelpfully monopolised intelligence recounted an incident when an intelligence issues; in 2003 when the Foreign Affairs agent, worried about the legality of providing Committee was undertaking its investigation intelligence to a country in West Africa, LQWRWKHJRYHUQPHQW·VGHFLVLRQWRJRWRZDU had asked to see the Memorandum of in Iraq, it noted that it had enjoyed better Understanding between the two countries; access to intelligence material and agents however, the agreement could not be 391 in inquiries before the creation of the ISC. found.399 If these cannot be readily found Moreover, it was frequently being denied within the agencies themselves, it is unclear access to information “on the grounds that how easily they can be found when required Parliamentary scrutiny of those agencies is by oversight bodies. carried out by the ISC.”392 1HLWKHUFRQÀUPQRUGHQ\ Conclusions

Finally, it is unclear how oversight bodies are Embedding troops in foreign forces and able review activities that the government sharing intelligence are both important denies it is a part of. For example, in 2012, activities but both can present a number of 5HKPDQ&KULVKWL03DWWHPSWHGWRÀQG GLIÀFXOWLHVLIQRWVXEMHFWWRWKHDSSURSULDWH RXWPRUHDERXWWKHJRYHUQPHQW·VUROHLQ level of transparency and accountability. US strikes in Yemen and said he found “a cloud of secrecy” even for “basic answers The fact that British personnel were able in relations to policy, criteria” and rules WRDFWLYHO\HQJDJHLQDQXPEHURIFRQÁLFWV governing the exchange of intelligence through these methods with minimal with the US.393 In 2014 (when the UK were scrutiny could have a detrimental impact playing a pivotal role in the US drone on the effectiveness, accountability and campaign in Yemen)394 Hugh Robertson legitimacy of UK operations abroad. MP, said “drone strikes against terrorist Clarifying the policies under which exchange targets in Yemen are a matter for the Yemeni of embeds and intelligence happens, as and US governments.”395 The same year, well as clarifying how certain dangers are when Tom Watson MP asked the Foreign mitigated would be welcome steps forward. 6HFUHWDU\LIKHZRXOGUHDVVHVVWKH8.·V The government has already shown intelligence-sharing relationship with the that this can be done by producing the US in light of its “targeted killing…outside Consolidated Guidance on torture, which, Afghanistan” Robertson retorted that “[i]t is though imperfect, lays out its commitment a long-standing policy not to comment on WRLQWHUQDWLRQDOODZDQGSXVKHVRIÀFLDOVWR intelligence matters.”396 identify and mitigate risks.

39 | All quiet on the ISIS front? Conclusion: greater secrecy is not always good strategy

As the Birmingham Policy Commission For example, the claim that the UK has no concluded at the end of its ground-breaking boots on the ground in places like Libya review of the security impact of drones: and Syria even while there is a steady feed of information surfacing in the media “…there is one theme that has recurred in of UK Special Forces conducting combat all our deliberations as a Commission… it operations alongside their local allies. is the need for clearer, more forthcoming Or the fact that the UK is present in the public communication and transparency on operations room for Saudi strikes against the part of the UK government, and the MoD

Remote Control Project | 40 Policy recommendations

Armed drones Special Forces

- In line with best practice from the US - The no comment policy on Special and Israel, the government should Forces should be amended so that the publish its policy surrounding its use of JRYHUQPHQWFDQSURYLGHXQFODVVLÀHG targeted killings, including: EULHÀQJVWKDWZRXOGQRWUHDVRQDEO\ endanger any operation or personnel. - The non-state groups that are considered legitimate targets. - Special Forces should be overseen by a parliamentary committee - The criteria used in the selection of targets and precautions incorporated - Currently, the only committee with in such criteria. both the trust and the security clearances to be briefed on Special - The authority or decision-making Forces is the ISC, which is a logical chain. ÀWIRUVRPHEXWSHUKDSVQRWDOO aspects of Special Forces activity. - Information regarding the legal frameworks (including UK and - However, were the government international laws and policies) that to relax the no comment policy WKHJRYHUQPHQWDSSOLHVWRVSHFLÀF WRDOORZXQFODVVLÀHGEULHÀQJVRQ situations in which an armed drone Special Forces to be released, this may be used for targeted killings. information could form the basis for scrutiny by the Defence and - What, and whether, right of recourse the Foreign Affairs Committees as exists in the case of erroneous appropriate targeting.

- Whether other methods are - In line with practice for the intelligence automatically exhausted before the agencies, Special Forces should be use of lethal force (e.g. capture). DVVLJQHGDSUHVVRIÀFHUDXWKRULVHGWR engage with the media D-Notice system, - Whether there are special measures allowing journalists to verify stories and in place for lethal strikes against UK prevent the publication of information citizens. that may be harmful to operations.

- The government should formalise - The government should clarify the force the automatic post-strike scrutiny of structure of British Special Forces, intelligence by the ISC when the UK including the conditions under which undertakes strikes for targeted killing. SFSG, the Special Reconnaissance Regiment and the new Special Infantry - This should be accompanied by Battalions fall under the command of a clear declaration of the grounds the Director of Special Forces and are for the government to withhold subject to the same no comment policy, information from the ISC that may and whether armed drones operating in be relevant to its investigations, and support of Special Forces would also be whether the ISC has the right to exempt from disclosure. appeal. - The government should clarify what, if - This should also be accompanied any, NSC oversight of Special Forces by a clear commitment to announce activities exists outside of declared such strikes publicly, as was done in operations such as during Operation the case of the lethal strike against Ellamy in Libya in 2011. Reyaad Khan.

41 | All quiet on the ISIS front? Embedded troops Intelligence-sharing

- The government should clarify the terms - 7KHUHVKRXOGEHFODULÀFDWLRQRYHU under which embedded personnel are how Memorandums of Understanding authorised to take part in the active between the UK and other nations are combat operations of allies. We have overseen and how human rights and seen (in the case of Syria) that this is other risks arising from partnerships are possible, but we have also seen (in the mitigated. case of Vietnam) that this is sometimes denied. - As in the case of the Consolidated *XLGDQFHWR,QWHOOLJHQFH2IÀFHUVDQG - In line with other combat Service Personnel on the Detention and deployments of regular personnel, Interviewing of Detainees Overseas, the deployment of embedded military and on the Passing and Receipt of personnel into combat situations, Intelligence Relating to Detainees, or in support of combat operations, the government should release a should be subject to the War Powers Consolidated Guidance on the provision Convention. of intelligence for allied drone strikes.

- ,QOLQHZLWKWKHJRYHUQPHQW·VRZQ - The government should clarify how the commitment, details about the number, Investigatory Powers Commissioner will purpose, and locations of embedded take over the roles and responsibilities military personnel should be published of the Intelligence Commissioner every year and should be made ²VSHFLÀFDOO\ZLWKUHJDUGVWRWKH available on request to parliamentarians. Consolidated Guidance to Intelligence Future updates should include: 2IÀFHUVDQG6HUYLFH3HUVRQQHORQWKH - The role/purpose of the personnel Detention and Interviewing of Detainees deployed Overseas, and on the Passing and Receipt of Intelligence Relating to - Where they have been deployed Detainees. (including the countries of the ¶&RDOLWLRQ+4V·WKH\DUHHPEHGGHG in)

- Aggregate statistics for the year, rather than a snapshot of statistics for one day

Remote Control Project | 42 11 “Authorization for Use of Military Force,” Endnotes Pub. L. No. 115 STATUTE 224, PUBLIC LAW 107-40-SEPT. 18, 2001 (2001), https://www.

1 “Defence in the Media: 17 April 2016 | Defence gpo.gov/fdsys/pkg/PLAW-107publ40/pdf/PLAW- in the Media,” accessed April 20, 2016, https:// 107publ40.pdf. modmedia.blog.gov.uk/2016/04/17/defence- in-the-media-17-april-2016/; “Defence in the 12 Barack Obama “Remarks by the President at Media: 19 April 2016 | Defence in the Media,” the National Defense University,” Whitehouse. accessed April 20, 2016, https://modmedia.blog. gov, May 23, 2013, https://www.whitehouse.gov/ gov.uk/2016/04/19/defence-in-the-media-19- WKHSUHVVRIÀFHUHPDUNVSUHVLGHQW april-2016/. national-defense-university.

2 “House of Commons - Libya: Examination of 13 “The Legal Framework for the United ,QWHUYHQWLRQDQG&ROODSVHDQGWKH8.·V)XWXUH 6WDWHV·8VHRI0LOLWDU\)RUFH6LQFHµ86 Policy Options - Foreign Affairs Committee,” Department of Defense, accessed October 14, para. 122, accessed September 14, 2016, http:// 2016, http://www.defense.gov/News/Speeches/ www.publications.parliament.uk/pa/cm201617/ Speech-View/Article/606662/the-legal-framework- cmselect/cmfaff/119/11902.htm. for-the-united-states-use-of-military-force- since-911. 3 Chris Hughes, “Special Forces Spearheading ¶6HFUHW:DU·DJDLQVW,6,6LQ/LE\Dµ0LUURU 14 Joint Committee on Human Rights, “The February 25, 2016, http://www.mirror.co.uk/news/ *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHVIRU uk-news/special-forces-spearheading-secret- Targeted Killing,” May 10, 2016, 50, http://www. war-7443338. publications.parliament.uk/pa/jt201516/jtselect/ jtrights/574/574.pdf. 4 Randeep Ramesh, “SAS Deployed in Libya since Start of Year, Says Leaked Memo,” The ´7KH/HJDO)UDPHZRUNIRUWKH8QLWHG6WDWHV· Guardian, March 25, 2016, sec. World news, Use of Military Force Since 9/11.” http://www.theguardian.com/world/2016/mar/25/ sas-deployed-libya-start-year-leaked-memo-king- 16 Shiv Malik et al., “Ruhul Amin and Reyaad abdullah. Khan: The Footballer and the Boy Who Wanted to Be First Asian PM,” The Guardian, September 7, New Statesman, May 17, com/world/2015/sep/07/british-isis-militants-killed- 2016, http://www.newstatesman.com/politics/ raf-drone-strike-syria-reyaad-khan-ruhul-amin. staggers/2016/05/enough-britain-s-secret-wars. +DUULHW$OH[DQGHU´-LKDGL-RKQ¶'HDG·0, 6 Crispin Blunt MP, “Letter from the Foreign on Alert amid Fears of Isil Revenge Attack - as It Affairs Committee to the Foreign Secretary,” Happened,” The Telegraph, November 14, 2015, April 12, 2016, https://www.parliament.uk/ sec. World, http://www.telegraph.co.uk/news/ documents/commons-committees/foreign-affairs/ worldnews/islamic-state/11994992/jihadi-john- Correspondence/2015-20-Parliament/160412- mohammed-emwazi-dead-syria-latest-news. Letter-to-Foreign-Secretary-on-Libya.pdf. html; Claire Phipps, Patrick Wintour, and Justin 0F&XUU\´¶+LJK'HJUHHRI&HUWDLQW\·7KDW86 &ODLUH0LOOV´5HVHDUFK%ULHÀQJV3DUOLDPHQWDU\ Strike Killed Mohammed Emwazi,” The Guardian, Approval for Military Action,” December 5, November 13, 2015, sec. UK news, https://www. KWWSUHVHDUFKEULHÀQJVSDUOLDPHQWXN theguardian.com/uk-news/2015/nov/13/us-air- 5HVHDUFK%ULHÀQJ6XPPDU\&%3IXOOUHSRUW strike-targets-mohammed-emwazi-uk-terrorist- 8 Matthew Smith, “Leave Voters Are Less Likely known-as-jihadi-john. to Trust Any Experts,” YouGov: What the World 18 Emma Graham-Harrison, “British and US Thinks, February 17, 2017, //yougov.co.uk/ 0LOLWDU\¶LQ&RPPDQG5RRP·IRU6DXGL6WULNHVRQ news/2017/02/17/leave-voters-are-less-likely- Yemen,” The Guardian, January 15, 2016, http:// trust-any-experts-eve/. www.theguardian.com/world/2016/jan/15/british- 9 Etienne de Durand, “France,” in Understanding us-military-in-command-room-saudi-strikes- Counterinsurgency: Doctrine, Operations, and yemen. Challenges, ed. Thomas Rid and Thomas Keaney 19 “UK Troops Working with US Military at Base (London, New York: Routledge, 2010), 25. for Yemen Drone Operations”, Informazione Dal *HRUJH%XVK´7H[WRI*HRUJH%XVK·V Medio Oriente: Information from Middle East. Speech,” The Guardian, September 21, 2001, accessed May 9, 2016, http://www.uruknet. sec. US news, https://www.theguardian.com/ info/?p=m107003. world/2001/sep/21/september11.usa13.

43 | All quiet on the ISIS front? (PLO\.QRZOHV´%ULWDLQ·V&XOWXUHRI1R 26 HMG, “Securing Britain in an Age of Comment”, Remote Control Project, July 2016, Uncertainty: The Strategic Defence and Security http://remotecontrolproject.org/publications/ Review” (HM Government, 2010), 12, https:// britains-culture-of-no-comment/. www.gov.uk/government/uploads/system/uploads/ DWWDFKPHQWBGDWDÀOHVWUDWHJLFGHIHQFH 21 Patrick Wintour, “Multicultural Britain Rejecting security-review.pdf. )RUHLJQ&RQÁLFW0R'$GPLWVµ7KH*XDUGLDQ January 23, 2014, sec. UK news, https:// 27 HMG, “National Security Strategy and www.theguardian.com/uk-news/2014/jan/22/ Strategic Defence and Security Review 2015: A PXOWLFXOWXUDOEULWDLQIRUHLJQFRQÁLFWPRG3DWULFN Secure and Prosperous United Kingdom” (HM Wintour, “British Foreign Policy Must Emerge Government, November 2015), para. 2.12, https:// from Shadow of Iraq, Argues Hilary Benn,” The www.gov.uk/government/uploads/system/uploads/ Guardian, December 21, 2015, sec. Politics, DWWDFKPHQWBGDWDÀOHB&PBB https://www.theguardian.com/politics/2015/ NSS_SD_Review_web_only.pdf. dec/21/british-foreign-policy-must-emerge- from-shadow-of-iraq-argues-hilary-benn; Milne, 28 HMG, “Securing Britain in an Age of ´$¶3DXVH·LQ&HQWXULHVRI%ULWLVK:DUV,V1RW Uncertainty: The Strategic Defence and Security Enough,” The Guardian, February 12, 2014, Review,” 16. sec. Opinion, https://www.theguardian.com/ 29 Paul Waugh “Chilcot Slams Blair - And commentisfree/2014/feb/12/pause-centuries- +LV&DELQHW2YHU,UDTµ7KH+XIÀQJWRQ british-wars-elite-panicking; Ewen MacAskill and 3RVWKWWSZZZKXIÀQJWRQSRVWFRXNHQWU\ ,DQ&REDLQ´%ULWLVK)RUFHV·&HQWXU\RI8QEURNHQ sir-john-chilcot-tony-blair-iraq-public-trust- Warfare Set to End with Afghanistan Exit,” The beyond-facts-psychological-dominance_ Guardian, February 11, 2014, sec. UK news, uk_581a294ee4b08315783d68c6; “Sir John https://www.theguardian.com/uk-news/2014/ Chilcot Says Tony Blair Damaged Trust in Politics feb/11/british-forces-century-warfare-end; Tara over Iraq,” BBC News, November 2, 2016, sec. McCormack, “The Emerging Parliamentary UK Politics, http://www.bbc.co.uk/news/uk- Convention of British Military Action and Warfare politics-37845634. by Remote Control,” The RUSI Journal 161, no. 2 (2016), http://dx.doi.org/10.1080/03071847.2016. 30 “Defence in the Media”; “Defence in the 1174479; Rory Cormac, “Disruption and Deniable Media.” Interventionism: Explaining the Appeal of Covert Action and Special Forces in Contemporary 31 “British Troops Could Be Sent to Libya without British Policy (Unpublished),” International a Commons Vote,” The Independent, April 19, Relations, 2016, http://eprints.nottingham. 2016, http://www.independent.co.uk/news/uk/ ac.uk/34345/1/AAM%20Disruption%20and%20 politics/british-troops-could-be-sent-to-libya- Deniable%20Interventionism%20International%20 without-a-commons-vote-a6990676.html. Relations%2021%206%202016.pdf. 32 UK MOD, “House of Commons: Written 22 “Syria Crisis: Cameron Loses Commons Vote Statement (HCWS149),” July 20, 2015, http:// on Syria Action,” BBC News, August 30, 2013, www.parliament.uk/documents/commons-vote- sec. UK Politics, http://www.bbc.co.uk/news/uk- RIÀFH-XO\-XO\'HIHQFH politics-23892783. Embedded.pdf.

-HUHP\:ULJKW´$WWRUQH\*HQHUDO·V6SHHFKDW 33 “Syria Air Strikes Conducted by UK Military the International Institute for Strategic Studies,” Pilots,” BBC News, accessed April 20, 2016, GOV.UK, January 11, 2017, https://www.gov.uk/ http://www.bbc.co.uk/news/uk-33562420. government/speeches/attorney-generals-speech- at-the-international-institute-for-strategic-studies. 34 HMG, “Securing Britain in an Age of Uncertainty: The Strategic Defence and Security 24 Ben Quinn, “MoD Study Sets out How to Sell Review,” 16. Wars to the Public,” The Guardian, September 26, 2013, sec. UK news, https://www.theguardian. 35 “Who Will Fight the next War?,” The com/uk-news/2013/sep/26/mod-study-sell-wars- Economist, October 24, 2015, http://www. public. economist.com/news/united-states/21676778- failures-iraq-and-afghanistan-have-widened-gulf- 25 Peter Dominiczak, “David Cameron Promises between-most-americans-and-armed. WR¶%HHI8S·WKH6$6WR7DNHWKH)LJKWWR,VLOµ The Telegraph, October 3, 2015, sec. News, 36 Mike Giglio, “This Is What The U.S. War http://www.telegraph.co.uk/news/politics/david- Against ISIS Really Looks Like,” BuzzFeed, cameron/11909488/David-Cameron-promises-to- accessed August 18, 2016, https://www.buzzfeed. EHHIXSWKH6$6WRWDNHWKHÀJKWWR,VLOKWPO com/mikegiglio/inside-the-real-us-ground-war-on- isis.

Remote Control Project | 44 37 “Blair Wins War Backing amid Revolt,” BBC 50 UK MOD, “House of Commons: Written News March 19, 2003, http://news.bbc.co.uk/1/hi/ Statement (HCWS149),” July 20, 2015, http:// uk_politics/2862325.stm. www.parliament.uk/documents/commons-vote- RIÀFH-XO\-XO\'HIHQFH 38 House of Lords Constitution Committee, Embedded.pdf. “Constitutional Arrangements for the Use of Armed Force,” 2nd Report of Session 2013-14 51 Michael Fallon, “Letter from Secretary of (House of Lords, July 24, 2013), http://www. Defence to Caroline Lucas MP,” October 6, 2016. publications.parliament.uk/pa/ld201314/ldselect/ ldconst/46/46.pdf; Claire Mills, “Parliamentary 52 Philip Alston, “Report of the Special $SSURYDOIRU0LOLWDU\$FWLRQµ%ULHÀQJ3DSHU Rapporteur on Extrajudicial, Summary or Arbitrary (House of Commons, May 12, 2015), http:// Executions” (United Nations, May 28, 2010), UHVHDUFKEULHÀQJVSDUOLDPHQWXN5HVHDUFK%ULHÀQJ http://www2.ohchr.org/english/bodies/hrcouncil/ Summary/CBP-7166; McCormack, “The Emerging docs/14session/A.HRC.14.24.Add6.pdf. Parliamentary Convention of British Military Action 53 Ibid. and Warfare by Remote Control.” 54 Daniel Byman, “Targeted Killing, American- 0LOOV´5HVHDUFK%ULHÀQJV3DUOLDPHQWDU\ Style,” Brookings Institution, January 20, 2006, Approval for Military Action.” https://www.brookings.edu/opinions/targeted- 40 BBC News, “Syria Crisis.” killing-american-style/.

0LOOV´5HVHDUFK%ULHÀQJV3DUOLDPHQWDU\ 55 Keith Patrick Dear, “Beheading the Hydra? Approval for Military Action.” Does Killing Terrorist or Insurgent Leaders Work?,” Defence Studies 13, no. 3 (September 1, 42 “Will British Combat Troops Be Deployed to 2013): 293–337, doi:10.1080/14702436.2013.84 Libya?,” The Week UK, accessed May 5, 2016, 5383. http://www.theweek.co.uk/71872/will-british- combat-troops-be-deployed-to-libya. 56 Sascha-Dominik Bachmann, “Targeted Killings: Contemporary Challenges, Risks 43 Ewen MacAskill, “Most UK Forces in Libya DQG2SSRUWXQLWLHVµ-RXUQDORI&RQÁLFWDQG ¶:RXOG%H7KHUHIRU3URWHFWLRQ·µ7KH*XDUGLDQ Security Law 18, no. 2 (July 1, 2013): 259–88, May 5, 2016, http://www.theguardian.com/uk- doi:10.1093/jcsl/krt007. news/2016/may/05/uk-forces-libya-protection- training. 57 Jonathan Masters, “Targeted Killings,” Council on Foreign Relations, May 23, 2013, http://www. 44 “Sir John Chilcot Says Tony Blair Damaged cfr.org/counterterrorism/targeted-killings/p9627. Trust in Politics over Iraq.” 58 Ibid. 45 Ben Jaffey, “Hearing of British Experts on (GZDUG6QRZGHQ·V5HYHODWLRQVµ%XQGHVWDJ 59 Dear, “Beheading the Hydra?” (December 2016), http://www.bundestag.de/ 60 Camilla Turner and Steven Swinford, “David 46 Joint Committee on Human Rights, “The &DPHURQ¶.QHZ%ULWLVK3LORWV:HUH%RPELQJ *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHVIRU 6\ULD·DV,W+DSSHQHG-XO\µ-XO\ Targeted Killing,” May 10, 2016. 2015, sec. News, http://www.telegraph.co.uk/ news/uknews/defence/11745689/British-pilots- 47 Emily Knowles, “We Need Greater in-air-strikes-against-Isil-in-Syria-live.html?WT. Transparency on UK Military Operations in mc_id=e_DM32918&WT.tsrc=email&etype=Edi_ Libya”, Remote Control Project, May 2016), Pol_New&utm_source=email&utm_ KWWSUHPRWHFRQWUROSURMHFWRUJEULHÀQJZHQHHG medium=Edi_Pol_New_2015_07_17&utm_ greater-transparency-on-uk-military-operations- campaign=DM32918. in-libya/. 61 “UK Policy on Use of Drones for Targeted 48 “MPs Approve Motion on ISIL in Syria - News Killing Inquiry - News from Parliament,” UK from Parliament,” UK Parliament, accessed June Parliament, accessed April 13, 2016, http://www. 17, 2016, http://www.parliament.uk/business/ parliament.uk/business/committees/committees- news/2015/december/mps-debate-motion-on-isil- a-z/joint-select/human-rights-committee/news- in-syria/. parliament-2015/uk-drone-policy-evidence-15-16/.

49 “Defence in the Media: 26 February 2016 62 “Defence in the Media: 13 September 2015 | | Defence in the Media,” accessed April 20, Defence in the Media,” GOV.UK, September 13, 2016, https://modmedia.blog.gov.uk/2016/02/26/ 2015, https://modmedia.blog.gov.uk/2015/09/13/ defence-in-the-media-26-february-2016/. defence-in-the-media-13-september-2015/.

45 | All quiet on the ISIS front? 63 “UK Policy on Use of Drones for Targeted Guardian, January 12, 2016, sec. Politics, http:// Killing Inquiry - News from Parliament.” www.theguardian.com/politics/2016/jan/12/david- cameron-criticised-harriet-harman-intelligence- 64 “British PM Cameron to Double Drone Fleet to security-committee-access-syria. Fight ISIL,” April 10, 2015, http://www.aljazeera. com/news/2015/10/uk-pm-cameron-doubles- 75 Ibid. GURQHÁHHWÀJKWLVLOKWPO 76 Ibid. 65 Parliament, “House of Commons Debates for 26 Sep 2014,” Hansard Debate, September 77 Richard Kerbaj and Tim Shipman, “Spies Told 26, 2014, https://www.publications.parliament. WR&RPH&OHDQRQ&DPHURQ·V2UGHUWR.LOOµ7KH uk/pa/cm201415/cmhansrd/cm140926/ Times, (February 19, 2017), http://www.thetimes. debtext/140926-0001.htm. co.uk/article/spies-told-to-come-clean-on- camerons-order-to-kill-ppfnlwsdd. 66 Mills, “Parliamentary Approval for Military Action”; “Surveillance Missions over Syria :ULJKW´$WWRUQH\*HQHUDO·V6SHHFKDWWKH &RQÀUPHG1HZV6WRULHV*298.µDFFHVVHG International Institute for Strategic Studies.” August 26, 2016, https://www.gov.uk/government/ 79 Alex Batesmith, “Written Evidence - Mr QHZVVXUYHLOODQFHPLVVLRQVRYHUV\ULDFRQÀUPHG Alex Batesmith,” November 13, 2013, /RXLVD%URRNH+ROODQG´5HVHDUFK%ULHÀQJV http://data.parliament.uk/WrittenEvidence/ - Overview of Military Drones Used by the UK CommitteeEvidence.svc/EvidenceDocument/ Armed Forces” (House of Commons, October Human%20Rights%20Joint%20Committee/  KWWSUHVHDUFKEULHÀQJVSDUOLDPHQWXN The%20UK%20Governments%20policy%20 5HVHDUFK%ULHÀQJ6XPPDU\61IXOOUHSRUW on%20the%20use%20of%20drones%20for%20 targeted%20killing/written/24437.html. 68 Nehal Bhuta, “On Preventive Killing,” EJIL: Talk!, September 17, 2015, http://www.ejiltalk.org/ 2ZHQ%RZFRWW´¶6SHFLÀF·7HUURU(YLGHQFH1RW on-preventive-killing/. Necessary for RAF Drone Strikes,” The Guardian, January 11, 2017, sec. World news, https://www. 69 “House of Commons Hansard Debates for theguardian.com/world/2017/jan/11/raf-drone- 7 Sep 2015,” Hansard Debates, (September strikes-terror-attorney-general. 7, 2015), http://www.publications.parliament. uk/pa/cm201516/cmhansrd/cm150907/ 81 Tom Watson, “Islamic State: Written debtext/150907-0001.htm. Question - 213744,” UK Parliament, November 6, 2014, http://www.parliament.uk/written- 70 “British PM Cameron to Double Drone Fleet to questions-answers-statements/written-question/ Fight ISIL.” commons/2014-11-06/213744.

71 “Government Memorandum to the JCHR,” 82 Angus Robertson, “Islamic State: Written accessed August 5, 2016, http://www.parliament. Question - 209771,” UK Parliament, September uk/documents/joint-committees/human-rights/ 26, 2014, http://www.parliament.uk/written- Government_Memorandum_on_Drones.pdf. questions-answers-statements/written-question/ commons/2014-09-26/209771. 72 Joint Committee on Human Rights, “Second 2UDO(YLGHQFH7KH8.*RYHUQPHQW·V3ROLF\ 83 Catherine West, “Libya: Unmanned Air on the Use of Drones for Targeted Killing,” Vehicles: Written Question - 26773,” UK December 16, 2015, http://data.parliament. Parliament, February 10, 2016, http://www. uk/writtenevidence/committeeevidence.svc/ parliament.uk/business/publications/written- evidencedocument/human-rights-committee/the- questions-answers-statements/written-question/ uk-governments-policy-on-the-use-of-drones-for- Commons/2016-02-10/26773/. targeted-killing/oral/27633.html. 84 Mike Penning, “Middle East: Unmanned 73 Joint Committee on Human Rights, “The Air Vehicles: Written Question - 45011,” UK *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHVIRU Parliament, September 5, 2016, http://www. Targeted Killing: Government Response to the parliament.uk/business/publications/written- &RPPLWWHH·V6HFRQG5HSRUWRI6HVVLRQ²µ questions-answers-statements/written-question/ (House of Commons and House of Lords: House Commons/2016-09-05/45011. of Commons, October 19, 2016), http://www. publications.parliament.uk/pa/jt201617/jtselect/ 85 Joint Committee on Human Rights, “First jtrights/747/747.pdf. 2UDO(YLGHQFH7KH8.*RYHUQPHQW·V3ROLF\ on the Use of Drones for Targeted Killing, HC 74 Nicholas Watt, “Cameron Criticised for Not 574,” December 9, 2015, http://data.parliament. Giving ISC Full Access to Syria Intelligence,” The uk/writtenevidence/committeeevidence.svc/

Remote Control Project | 46 evidencedocument/human-rights-committee/the- +XPDQ5LJKWV/DZLQ$UPHG&RQÁLFW 2[IRUG uk-governments-policy-on-the-use-of-drones-for- New York: Oxford University Press, 2016). targeted-killing/oral/25787.html. 94 Joint Committee on Human Rights, “The 86 Parliament, “House of Commons Debates for *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHVIRU 07 Sep 2015,” accessed April 14, 2016, http:// Targeted Killing,” May 10, 2016, http://www. www.publications.parliament.uk/pa/cm201516/ publications.parliament.uk/pa/jt201516/jtselect/ cmhansrd/cm150907/debtext/150907-0001. jtrights/574/574.pdf. KWP 95 Joint Committee on Human Rights, “Second 87 UK Permanent Representative to UN, “Letter 2UDO(YLGHQFH7KH8.*RYHUQPHQW·V3ROLF\RQ Dated 7 September 2015 from the Permanent the Use of Drones for Targeted Killing.” Representative of the United Kingdom of Great Britain and Northern Ireland to the United 96 Claire Mills, Ben Smith, and Louisa Brooke- Nations Addressed to the President of the Holland, “ISIS/Daesh: The Military Response Security Council,” United Nations, September LQ,UDTDQG6\ULDµ%ULHÀQJ3DSHU +RXVH 8, 2015, http://www.securitycouncilreport.org/ of Commons, May 24, 2016), 40, http:// atf/cf/%7B65BFCF9B-6D27-4E9C-8CD3- UHVHDUFKEULHÀQJVSDUOLDPHQWXN5HVHDUFK%ULHÀQJ CF6E4FF96FF9%7D/s_2015_688.pdf. 6XPPDU\61IXOOUHSRUW

88 “Government Memorandum to the JCHR.” 97 PJHQ J9 FOI Secretariat, “Letter from MOD Regarding FOI,” April 29, 2016, 89 Noelle Quenivet and Aurel Sari, “Written KWWSVGURQHZDUVXNÀOHVZRUGSUHVV Evidence - Dr Noelle Quenivet,” November com/2016/05/20160429-foi2016-03828.pdf. 2015, http://data.parliament.uk/WrittenEvidence/ CommitteeEvidence.svc/EvidenceDocument/ :ULJKW´$WWRUQH\*HQHUDO·V6SHHFKDWWKH Human%20Rights%20Joint%20Committee/ International Institute for Strategic Studies.” The%20UK%20Governments%20policy%20 99 Khalil Dewan, “British Drone Strike Policy: on%20the%20use%20of%20drones%20for%20 ¶&RQIXVHGDQG&RQIXVLQJ·µ0LGGOH(DVW(\H targeted%20killing/written/24475.html. May 11, 2016, http://www.middleeasteye.net/ 90 Joint Committee on Human Rights, “First Oral columns/british-drone-strike-policy-confused- (YLGHQFH7KH8.*RYHUQPHQW·V3ROLF\RQWKH and-confusing-770224237; Verity Adams, Use of Drones for Targeted Killing, HC 574.” Alan Greene, and Adam Rooney, “The Legal Regulation of UAV Strikes Abroad: The Legality 91 Joint Committee on Human Rights, “The of UAV Strikes under International Humanitarian, *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHV International Human Rights and UK Constitutional for Targeted Killing,” May 10, 2016; William Law,” November 2015, http://data.parliament. Boothby, “Written Evidence - Dr William Boothby,” uk/WrittenEvidence/CommitteeEvidence.svc/ November 9, 2015, http://data.parliament.uk/ EvidenceDocument/Human%20Rights%20 WrittenEvidence/CommitteeEvidence.svc/ Joint%20Committee/The%20UK%20 EvidenceDocument/Human%20Rights%20 Governments%20policy%20on%20the%20 Joint%20Committee/The%20UK%20 use%20of%20drones%20for%20targeted%20 Governments%20policy%20on%20the%20 killing/written/24533.html. use%20of%20drones%20for%20targeted%20 killing/written/24286.html. 100 Batesmith, “Written Evidence - Mr Alex Batesmith.” 92 Lynn Davis and Michael Greenberg, “Clarifying the Rules for Targeted Killing: An Analytical 101 “Written Evidence - Caroline Lucas MP,” Framework for Policies Involving Long-Range November 2015, http://data.parliament.uk/ Armed Drones” (RAND Corporation, 2016), http:// WrittenEvidence/CommitteeEvidence.svc/ www.rand.org/pubs/research_reports/RR1610. EvidenceDocument/Human%20Rights%20 html. Joint%20Committee/The%20UK%20 Governments%20policy%20on%20the%20 93 “Written Evidence - Columbia Human use%20of%20drones%20for%20targeted%20 Rights Clinic,” November 26, 2015, http:// killing/written/24620.html. data.parliament.uk/WrittenEvidence/ CommitteeEvidence.svc/EvidenceDocument/ 102 Joseph Savirimuthu, “Written Evidence - Human%20Rights%20Joint%20Committee/ Mr Joseph Savirimuthu,” September 13, 2015, The%20UK%20Governments%20policy%20 http://data.parliament.uk/WrittenEvidence/ on%20the%20use%20of%20drones%20for%20 CommitteeEvidence.svc/EvidenceDocument/ targeted%20killing/written/25102.html; Quenivet Human%20Rights%20Joint%20Committee/ and Sari, “Written Evidence - Dr Noelle Quenivet”; The%20UK%20Governments%20policy%20 'DUDJK0XUUD\HWDO3UDFWLWLRQHUV·*XLGHWR on%20the%20use%20of%20drones%20for%20

47 | All quiet on the ISIS front? targeted%20killing/written/24481.html. 113 Ibid.

103 Reprieve, “Written Evidence - Reprieve,” 114 Gabriella Blum and Philip Heymann, “Law November 2015, http://data.parliament.uk/ and Policy of Targeted Killing,” Harvard Law WrittenEvidence/CommitteeEvidence.svc/ School National Security Journal, June 27, 2010, EvidenceDocument/Human%20Rights%20 http://harvardnsj.org/2010/06/law-and-policy-of- Joint%20Committee/The%20UK%20 targeted-killing-2/. Governments%20policy%20on%20the%20 115 Dear, “Beheading the Hydra?” use%20of%20drones%20for%20targeted%20 killing/written/24555.html. 116 Ibid.

104 Joint Committee on Human Rights, “Second 117 Shlomo Shpiro, “No Place to Hide: 2UDO(YLGHQFH7KH8.*RYHUQPHQW·V3ROLF\RQ Intelligence and Civil Liberties in Israel,” the Use of Drones for Targeted Killing.” Cambridge Review of International Affairs 19, no. 4 (December 1, 2006): 629–48, doi: $UDEHOOD/DQJ´5HVHDUFK%ULHÀQJV8. 10.1080/09557570601003361. Drone Attack in Syria: Legal Questions,” &RPPRQV%ULHÀQJSDSHUV 2FWREHU  118 Nathalie Van Raemdonck, “Vested Interest KWWSUHVHDUFKEULHÀQJVSDUOLDPHQWXN RU0RUDO,QGHFLVLYHQHVV"([SODLQLQJWKH(8·V 5HVHDUFK%ULHÀQJ6XPPDU\&%3 Silence on the US Targeted Killing Policy in Pakistan” (Istituto Affari Internazionali, December 106 The White House, “Report on the Legal and 3, 2012), http://citeseerx.ist.psu.edu/viewdoc/ 3ROLF\)UDPHZRUNV*XLGLQJWKH8QLWHG6WDWHV· Use of Military Force and Related National 119 Joint Committee on Human Rights, “The Security Operations,” December 2016, https:// *RYHUQPHQW·V3ROLF\RQWKH8VHRI'URQHVIRU www.justsecurity.org/wp-content/uploads/2016/12/ Targeted Killing,” May 10, 2016. framework.Report_Final.pdf. 120 Jon Moran, “Assessing SOF Transparency 0DUW\/HGHUPDQ´3UHVLGHQW2EDPD·V5HSRUW and Accountability: The Use of Special Operations on the Legal and Policy Frameworks Guiding and Forces by the UK, US, Australia, and Canada” Limiting the Use of Military Force [UPDATED],” (Remote Control Project, July 2016), http:// Just Security, December 5, 2016, https://www. remotecontrolproject.org/publications-category/ justsecurity.org/35239/president-obamas- reports/. report-legal-policy-frameworks-guiding-united- states-military-force-related-national-security- 121 HMG, “National Security Strategy and operations/. Strategic Defence and Security Review 2015: A Secure and Prosperous United Kingdom”; 108 Secretary of Defense, “Memorandum: HM Treasury, “Spending Review and Autumn Department of Defense Implementation of the Statement 2015” (HM Treasury, November 2015), 3UHVLGHQWLDO3ROLF\*XLGDQFHRQ¶3URFHGXUHVIRU https://www.gov.uk/government/uploads/system/ Approving Drect Action Against Terrorist Targets XSORDGVDWWDFKPHQWBGDWDÀOHB Located Utside the United States and Areas of Blue_Book_PU1865_Web_Accessible.pdf. $FWLYH+RVWLOLWXHV·µ'HFHPEHUKWWSV ZZZDFOXRUJVLWHVGHIDXOWÀOHVÀHOGBGRFXPHQW 122 J. Paul de B. Taillon, The Evolution of dod_implementation_of_presidential_policy_ Special Forces in Counter-Terrorism: The British guidance.pdf. and American Experiences (Westport: Praeger Publishers, 2001), 28. 109 Marty Lederman, “The Presidential Policy Guidance for Targeting and Capture Outside 123 “History of the SAS Regiment,” accessed Afghanistan, Iraq and Syria,” Just Security, August November 1, 2016, http://www.sasregiment.org. 6, 2016, https://www.justsecurity.org/32298/ uk/history-of-the-sas-regiment.html. presidential-policy-guidance-targeting-capture- afghanistan-iraq-syria/. 124 Alastair Finlan, Special Forces, Strategy and the War on Terror (New York: Routledge, 2008), 6. /HGHUPDQ´3UHVLGHQW2EDPD·V5HSRUWRQ the Legal and Policy Frameworks Guiding and 125 “SAS: Who Dares Wins,” Channel 4, Limiting the Use of Military Force [UPDATED].” accessed October 24, 2016, http://www.channel4. com/programmes/sas-who-dares-wins. 111 Ibid. 126 Alexander Powell, “Advice from SOF on the 6WHYHQ'DYLG´,VUDHO·V3ROLF\RI7DUJHWHG Use of SOF for the Next Administration” (CNA, Killing,” Carnegie Council on Ethics and 2FWREHU KWWSVZZZFQDRUJ&1$BÀOHV International Affairs 17, no. 1 (2003): 111–26. PDF/DOP-2016-U-014394-Final.pdf.

Remote Control Project | 48 127 Ibid. 139 HMG, “National Security Strategy and Strategic Defence and Security Review 2015: A 128 Michele L. Malvesti, “To Serve the Nation: Secure and Prosperous United Kingdom.” U.S. Special Operations Forces in an Era of 3HUVLVWHQW&RQÁLFWµ &1$6-XQH  140 HM Treasury, “Spending Review and Autumn https://www.cnas.org/publications/reports/to- Statement 2015,” 26. serve-the-nation-u-s-special-operations-forces-in- DQHUDRISHUVLVWHQWFRQÁLFW 141 FAS, “Statement of General Joseph L. Votel, US Army Commander, US Special Operations 129 Taillon, The Evolution of Special Forces in Command before the House Armed Services Counter-Terrorism: The British and American Committee, Subcommittee on Emerging Threats Experiences, 35. and Capabilities,” March 18, 2015, http://docs. house.gov/meetings/AS/AS26/20150318/103157/ 130 UK Army, “Counter Insurgency Operations HMTG-114-AS26-Wstate-VotelUSAJ-20150318. (Strategic and Operational Guidelines),” March pdf. SDUDKWWSVÀOHZLNLOHDNVRUJÀOHXN coin-operations-2007.pdf. 142 Malvesti, “To Serve the Nation: U.S. Special Operations Forces in an Era of Persistent 131 UK Army, “Countering Insurgency,” British &RQÁLFWµ Army Field Manual, (October 2009), 9–1, http:// news.bbc.co.uk/1/shared/bsp/hi/pdfs/16_11_09_ 143 FAS, “Statement of General Joseph L. Votel, army_manual.pdf. US Army Commander, US Special Operations Command before the House Armed Services 132 NATO, “Allied Joint Doctrine for Special Committee, Subcommittee on Emerging Threats Operations” (North Atlantic Treaty Organization, and Capabilities.” December 2013), 1–2, http://www.nato.int/cps/en/ natohq/topics_69482.htm. 144 “SOF Power,” Foreign Policy, accessed November 2, 2016, https://foreignpolicy. 133 Paul Rogers, “UK Special Forces: com/2012/02/14/sof-power/. Accountability in Shadow War | Oxford Research Group” (Oxford Research Group, March 30, 145 Eric Schmitt Mazzetti Mark and Thom 2016), http://www.oxfordresearchgroup.org.uk/ Shanker, “Expanded Role Proposed for Elite SXEOLFDWLRQVSDXOBURJHUVBPRQWKO\BEULHÀQJXNB Military Forces,” The New York Times, February special_forces_accountability_shadow_war. 12, 2012, http://www.nytimes.com/2012/02/13/us/ admiral-pushes-for-freer-hand-in-special-forces. 134 Ian Gallagher, “British Special Forces in html. /LE\D¶$PEXVKHGE\,6,66XLFLGH%RPEHUV·µ Mail Online, May 1, 2016, http://www.dailymail. 146 HMG, “Securing Britain in an Age of co.uk/news/article-3567590/British-special-forces- Uncertainty: The Strategic Defence and Security ÀJKWLQJ/LE\DDPEXVKHG,6,6VXLFLGHERPEHUV Review,” 12. killed-Italian-troops.html. 147 HMG, “National Security Strategy and 135 Michael Fallon, “Armed Forces: Written Strategic Defence and Security Review 2015: A Question - 65279,” UK Parliament, March 1, 2017, Secure and Prosperous United Kingdom,” para. http://www.parliament.uk/business/publications/ 2.12. written-questions-answers-statements/written- question/Commons/2017-02-23/65279. .QRZOHV´%ULWDLQ·V&XOWXUHRI1R&RPPHQWµ

136 Michael Fallon, “Army: Written Question - 149 Ruth Sherlock, “Special Forces on Secret 65447,” UK Parliament, March 2, 2017, https:// Libya Mission against IS,” Times LIVE, accessed www.parliament.uk/business/publications/written- April 6, 2016, http://www.timeslive.co.za/ questions-answers-statements/written-question/ thetimes/2016/02/29/Special-forces-on-secret- Commons/2017-02-24/65447/. Libya-mission-against-IS.

137 HMG, “National Security Strategy and 150 “Defence in the Media.” Strategic Defence and Security Review 2015” 151 Rt Hon Philip Hammond MP, “Letter from (HM Government, November 2015), 30, https:// the Foreign Secretary to the Foreign Affairs www.gov.uk/government/uploads/system/uploads/ Committee on Libya,” March 27, 2016, https:// DWWDFKPHQWBGDWDÀOHB&PBB www.parliament.uk/documents/commons- NSS_SD_Review_web_only.pdf. committees/foreign-affairs/Correspondence/2015- 138 Moran, “Assessing SOF Transparency and 20-Parliament/160327-Foreign-Secretary-on- Accountability: The Use of Special Operations Libya.pdf. Forces by the UK, US, Australia, and Canada.” 152 Ramesh, “SAS Deployed in Libya since Start

49 | All quiet on the ISIS front? of Year, Says Leaked Memo.” 163 Dominik Lemanski, “SAS Targets Somali Terror Forces,” Dailystar.co.uk, March 11, 153 “Defence in the Media – 26 May 2016 | 2012, http://www.dailystar.co.uk/news/latest- Defence in the Media,” accessed June 8, 2016, news/239939/SAS-targets-Somali-terror-forces. https://modmedia.blog.gov.uk/2016/05/26/ defence-in-the-media-26-may-2016/. 'DYLG%ODLU´¶:HVWHUQ6SHFLDO)RUFHV· Raid Al-Shabaab Stronghold in Somalia,” The 154 Gallagher, “British Special Forces in Libya Telegraph, October 5, 2013, sec. News, http:// ¶$PEXVKHGE\,6,66XLFLGH%RPEHUV·µ www.telegraph.co.uk/news/10357752/Western- special-forces-raid-al-Shabaab-stronghold-in- 155 “REVEALED: Leaked Tapes Expose Western Somalia.html. Support for Renegade Libyan General,” Middle East Eye, accessed July 8, 2016, http://www. 165 Tom Morgan, “Leaked Report: SAS on middleeasteye.net/news/revealed-leaked-tapes- Ground in Libya for Months,” The Telegraph, expose-western-support-renegade-libyan- 19:45, sec. 2016, http://www.telegraph.co.uk/ general-185825787. news/2016/03/25/leaked-report-sas-on-ground-in- libya-for-months/. ´(;&/86,9(%ULWLVK6ROGLHUV¶)LJKWLQJ ,6RQ)URQWOLQHVQHDU/LE\D·V6LUWH·µ0LGGOH 3DWULFN:LOLDPV´6$6¶)LJKWLQJ6HFUHW:DU· East Eye, accessed July 22, 2016, http://www. against Islamic Extremists in Somalia,” Dailystar. middleeasteye.net/news/sirte-libya-british- co.uk, April 24, 2016, http://www.dailystar.co.uk/ commandos-frontline-uk-britain-michael-fallon- QHZVODWHVWQHZV6$6ÀJKWLQJVHFUHW islamic-state-669841059. war-islamic-extremists-Somalia-covert-operation- drone-strikes. 157 “GOT THEM! Three ISIS Jihadis Who Fled to Libya from Britain KILLED in Special Forces Op,” 0DUJRW.LVHU´%LJ*DPH866ROGLHUV· Express.co.uk, July 2, 2016, http://www.express. Secret Hunt for Jihadists in a Kenyan Forest,” co.uk/news/uk/685532/Three-ISIS-jihadis-Libya- The Daily Beast, February 8, 2017, http://www. UK-KILLED-special-forces-op. thedailybeast.com/articles/2017/02/08/big-game- u-s-soldiers-secret-hunt-for-jihadists-in-a-kenyan- 158 “ISIS Jihadis Laid down Arms as British forest.html. Forces Helped Flush Them out,” Mail Online, August 6, 2016, http://www.dailymail.co.uk/news/ *UDKDP+DUULVRQ´%ULWLVKDQG860LOLWDU\¶LQ article-3727370/Dramatic-moment-ISIS-jihadis- &RPPDQG5RRP·IRU6DXGL6WULNHVRQ

Remote Control Project | 50 The Telegraph, 14:21, sec. 2016, http://www. 186 “MPs Approve Motion on ISIL in Syria - News telegraph.co.uk/news/2016/07/22/russia-bombed- from Parliament.” sas-outpost-in-syria/. 187 Knowles, “We Need Greater Transparency on 174 “UK Special Forces Pictured on the Ground UK Military Operations in Libya” in Syria,” BBC News, accessed August 9, 2016, http://www.bbc.co.uk/news/uk-37015915. 188 “House of Commons - Libya: Examination of ,QWHUYHQWLRQDQG&ROODSVHDQGWKH8.·V)XWXUH 175 Sam Webb, “Elite SAS Troops Pictured Policy Options - Foreign Affairs Committee,” para. on Syrian Front Line Fighting ISIS for First 122. Time,” Mirror, August 8, 2016, http://www.mirror. FRXNQHZVXNQHZVHOLWHVDVWURRSVÀJKWLQJ 189 Knowles, “We Need Greater Transparency on isis-8590815. UK Military Operations in Libya”

176 Marco Giannangeli, “Elite British Special 0LOOV´5HVHDUFK%ULHÀQJV3DUOLDPHQWDU\ Forces Catch Top IS Chief,” Express.co.uk, Approval for Military Action.” August 14, 2016, http://www.express.co.uk/news/ 191 Ibid. world/699710/Elite-British-special-forces-catch- top-IS-chief. 192 HMG, “Justice and Security Act 2013” (2013), http://www.legislation.gov.uk/ukpga/2013/18/pdfs/ 177 “Hundreds of Royal Marines to Join the SAS ukpga_20130018_en.pdf. to Train New Syrian Army and Fight ISIS,” RT International, accessed August 18, 2016, https:// 193 “The Intelligence and Security Committee www.rt.com/uk/355369-sas-marines-syria-isis/. of Parliament,” accessed September 19, 2016, http://isc.independent.gov.uk/. 178 Parliament, “House of Commons Debates for 26 Sep 2014.” 194 Anthony Forster, “The Defence Advisory Notice System and the Defence Press and 179 Webb, “Elite SAS Troops Pictured on Syrian Broadcasting Advisory Committee: Report of the Front Line Fighting ISIS for First Time.” Review” (MOD, March 2015), http://www.dnotice. .DWLH0DQVÀHOG´+HUR6$66QLSHU6DYHV RUJXNOLQNHGÀOHVGQRWLFHUHFRUGV Hundreds of Lives by Killing ISIS Suicide GSEDFUHYLHZUHSRUWÀQDORGRF Bomber with Just One Shot,” Express.co.uk, 195 HMG, “Freedom of Information Act August 2, 2016, http://www.express.co.uk/news/ 2000” (2000), http://www.legislation.gov.uk/ world/695569/Hero-SAS-sniper-killsISIS-suicide- ukpga/2000/36/pdfs/ukpga_20000036_en.pdf. bomber-and-accomplices-with-just-one-shot-Iraq. +0*´2IÀFLDO6HFUHWV$FWµ   181 Giannangeli, “British Ground Troops Push Big http://www.legislation.gov.uk/ukpga/1911/28/ Final Offensive against ISIS Stronghold in Iraq.” pdfs/ukpga_19110028_en.pdf; HM Government, ´%ULWLVK6$6LQ,UDT,VVXHGZLWK¶.LOORU ´2IÀFLDO6HFUHWV$FWµ  KWWS &DSWXUH·/LVWRI%ULWLVK-LKDGLVµ7KH6XQ www.legislation.gov.uk/ukpga/1989/6/pdfs/ November 6, 2016, https://www.thesun.co.uk/ ukpga_19890006_en.pdf. news/2125627/british-special-forces-in-iraq- 197 “Special Forces: Finance: Written Question - issued-with-kill-or-capture-list-of-200-british- 41980,” UK Parliament, accessed August 9, 2016, MLKDGLVÀJKWLQJZLWKLV http://www.parliament.uk/business/publications/ 183 Thomas Burrows, “Britons Fighting on written-questions-answers-statements/written- Both Sides in the Battle for Mosul,” Mail Online, question/Commons/2016-07-05/41980/. February 20, 2017, http://www.dailymail.co.uk/~/ 198 Private letter from Rt Hon Mike Penning to article-4241796/index.html. Yasmin Qureshi MP, dated 4th October 2016 184 Parliament, “House of Commons Debates 199 “House of Commons - Operations in Libya for 23 Mar 2016,” Hansard Debate, March 23, - Defence Committee,” accessed January 4, 2016, https://www.publications.parliament. 2017, http://www.publications.parliament.uk/pa/ uk/pa/cm201516/cmhansrd/cm160323/ cm201012/cmselect/cmdfence/950/95007.htm. debtext/160323-0001.htm. 200 “Committee on Armed Services: &ULVSLQ%OXQW03TXRWHGLQ¶8.FRYHUWRSV Subcommittees,” Armed Services Republicans, LQ0LGGOH(DVWFDQ·WVWD\VHFUHWIRUHYHUVD\VWRS accessed January 4, 2017, https://armedservices. 7RU\03·0LGGOH(DVW(\H0D\ KWWS house.gov/subcommittees/emerging-threats- www.middleeasteye.net/news/senior-tory-mp- capabilities%3B%20http%3A/www.armed- urges-oversight-over-uk-mid-east-military- services.senate.gov/about/subcommittees. strategy-1527899929)

51 | All quiet on the ISIS front? 201 FAS, “Posture Statement of Admiral William ´([6$62IÀFHUWR6XH0HWIRU8QODZIXO H. McRaven, USN Commander, United States Arrest,” The Independent, April 28, 2013, http:// Special Operations Command” (Senate Armed www.independent.co.uk/news/uk/crime/ex-sas- Services Committee: Emerging Threats and RIÀFHUWRVXHPHWIRUXQODZIXODUUHVW Capabilities Subcommittee), accessed January html. 4, 2017, https://fas.org/irp/congress/2014_ hr/031114mcraven.pdf. 218 Ibid.

202 Moran, “Assessing SOF Transparency and 219 “SAS - Rescue Of Norman Kember,” Accountability: The Use of Special Operations accessed June 22, 2016, http://www.eliteukforces. Forces by the UK, US, Australia, and Canada.” info/special-air-service/sas-operations/normak- kember-rescue/; “SAS Operation - Basra Rescue,” 203 “Expanding Congressional Oversight of accessed June 22, 2016, http://www.eliteukforces. Kill/Capture Ops Conducted by the Military: info/special-air-service/sas-operations/basra-raid/; Section 1036 of the NDAA,” Lawfare, accessed “SAS - Operation Marlborough,” accessed June January 3, 2017, https://www.lawfareblog.com/ 22, 2016, http://www.eliteukforces.info/special-air- expanding-congressional-oversight-killcapture- service/sas-operations/operation-marlborough/; ops-conducted-military-section-1036-ndaa. “Operation Trent,” accessed June 22, 2016, http:// www.eliteukforces.info/special-air-service/sas- 204 Jeremy Scahill, Dirty Wars (London: operations/operation-trent/. 6HUSHQW·V7DLO ² 220 Richard Norton-Taylor, “Secret and 205 Moran, “Assessing SOF Transparency and Unaccountable: The Double-Edged Sword of Accountability: The Use of Special Operations SAS Mythology,” The Guardian, July 14, 2015, Forces by the UK, US, Australia, and Canada.” sec. UK news, https://www.theguardian.com/uk- news/2015/jul/14/secret-and-unaccountable-the- 206 “Norway Might Deploy Troops & Special double-edged-sword-of-sas-mythology. Operation Forces in Syria,” June 22, 2016, https:// southfront.org/norway-might-deploy-troops- 221 Ibid. special-operation-forces-in-syria/; “Norway Could Send Troops into Syria,” Reuters, June 22, 2016, 222 “Defence and Security Media Advisory http://www.reuters.com/article/us-mideast-crisis- (DSMA) Notice System,” accessed June 21, syria-norway-idUSKCN0Z81O3. 2016, http://www.dsma.uk/.

207 “Norway Could Send Troops into Syria.” 223 Ibid.

208 “Avsporing Om Afghanistan,” Aftenposten, 224 D-Notice, “Records of the Past DPBAC accessed February 8, 2017, http://www. Meetings: Agenda,” accessed January 5, 2017, aftenposten.no/article/ap-378151b.html. http://www.dnotice.org.uk/records/index.htm.

209 “Defence in the Media.” 225 “Defence and Security Media Advisory (DSMA) Notice System.” 210 Ibid. 226 Ibid. 211 “Defence in the Media: 26 March 2016 | Defence in the Media,” accessed April 20, 2016, 227 Forster, “The Defence Advisory Notice https://modmedia.blog.gov.uk/2016/03/26/ System and the Defence Press and Broadcasting defence-in-the-media-26-march-2016/. Advisory Committee: Report of the Review.”

212 “Defence in the Media – 26 May 2016 | ´+HUR6$66QLSHU¶NLOOV)RXU,6,67KXJVZLWK Defence in the Media.” a SINGLE BULLET as They Prepared to Murder +RVWDJHV8VLQJD)ODPHWKURZHU·µ7KH6XQ 213 Gallagher, “British Special Forces in Libya September 11, 2016, https://www.thesun.co.uk/ ¶$PEXVKHGE\,6,66XLFLGH%RPEHUV·µ news/1763976/hero-sas-sniper-kills-four-isis- thugs-with-a-single-bullet-as-they-prepared-to- 214 “Defence in the Media.” PXUGHUKRVWDJHVXVLQJDÁDPHWKURZHU :DWOLQJDQG6KDELEL´%ULWDLQ·V&RYHUW:DULQ 0DQVÀHOG´+HUR6$66QLSHU6DYHV Yemen.” Hundreds of Lives by Killing ISIS Suicide Bomber 216 “Defence in the Media: 8 April 2016 | with Just One Shot.” Defence in the Media,” accessed February 22, ´%ULWLVK6SHFLDO2SV:DUÀJKWHU.LOOV,6,6 2017, https://modmedia.blog.gov.uk/2016/04/08/ Terrorist with Ax, Frees Sex Slaves,” The defence-in-the-media-8-april-2016/. Washington Times, accessed October 19, 2016, http://www.washingtontimes.com/news/2016/

Remote Control Project | 52 RFWEULWLVKVSHFLDORSVZDUÀJKWHUNLOOVLVLV to-uk-says-mi5-head?utm_source=esp&utm_ terroris/. medium=Email&utm_

.QRZOHV´%ULWDLQ·V&XOWXUHRI1R&RPPHQWµ ´6\ULD$LU6WULNHV:KDW$UH¶(PEHGGHG· Military Personnel?,” BBC News, accessed 232 “Obama to Send Special Forces to Syria,” April 20, 2016, http://www.bbc.co.uk/news/uk- Yahoo News, accessed April 19, 2016, https:// 33568054. www.yahoo.com/news/us-send-fewer-50-special- ops-forces-syria-151524914.html?ref=gs. 243 UK MOD, “House of Commons: Written Statement (HCWS149),” July 20, 2015. ´6\ULD&RQÁLFW2EDPDWR'HSOR\0RUH Special Forces Troops,” BBC News, accessed 244 “Syria Air Strikes.” June 28, 2016, http://www.bbc.co.uk/news/world- middle-east-36126944. 245 “UKUSA Agreement Release 1940-1956,” May 3, 2016, https://www.nsa.gov/news-features/ 234 “Pentagon Sends Hundreds More U.S. GHFODVVLÀHGGRFXPHQWVXNXVD Special Operations Forces into Syria,” The Washington Times, accessed December 0LFKDHO6*RRGPDQ7KH2IÀFLDO+LVWRU\RI 13, 2016, http://www.washingtontimes.com/ the Joint Intelligence Committee: Volume I: From news/2016/dec/10/pentagon-sends-hundreds- the Approach of the Second World War to the more-us-special-operations/. Suez Crisis (Routledge, 2014).

235 “Canadian Commandos May Be on Front 247 Adam Svendsen, “Buffeted Not Busted: Lines Fighting ISIS: James Cudmore,” CBC, 7KH8.86$¶)LYH(\HV·DIWHU6QRZGHQµ(,5 accessed May 23, 2016, http://www.cbc.ca/news/ January 8, 2014, http://www.e-ir.info/2014/01/08/ politics/special-forces-isis-iraq-combat-1.3318451. EXIIHWHGQRWEXVWHGWKHXNXVDÀYHH\HVDIWHU snowden/. 236 Ibid. 248 Richard Aldrich, GCHQ: The Uncensored 237 Daniel Hurst, “Australian Special Forces 6WRU\RI%ULWDLQ·V0RVW6HFUHW,QWHOOLJHQFH$JHQF\ Moving into Iraq, Tony Abbott Says,” The (HarperPress, 2011). Guardian, November 10, 2014, sec. Australia news, http://www.theguardian.com/australia- 249 UK MOD, “House of Commons: Written news/2014/nov/11/australian-special-forces- Statement (HCWS149),” July 20, 2015. moving-into-iraq-tony-abbott-says. 250 MOD News Team, “Defence in the Media: ´(;&/86,9($XVWUDOLD·V(OLWH6SHFLDO)RUFHV UK Personnel Embeds in Syria,” Ministry of Investigated over Disturbing Stories of Conduct,” Defence, July 17, 2015, https://modmedia.blog. The Sydney Morning Herald, accessed June 14, gov.uk/2015/07/17/defence-in-the-media-17- 2016, http://www.smh.com.au/federal-politics/ july-2015/. political-news/australias-elite-special-forces- 251 Cormac, “Disruption and Deniable being-investigated-over-disturbing-stories-of- Interventionism: Explaining the Appeal of Covert conduct-and-culture-20160416-go7wuh.html. Action and Special Forces in Contemporary 239 Chris Stephen, “Three French Special Forces British Policy (Unpublished)”; Namir Shabibi and Soldiers Die in Libya,” The Guardian, July 20, Jack Watling, “Exclusive: How the UK Secretly 2016, sec. World news, https://www.theguardian. Helped Direct Lethal US Drone Strikes in Yemen,” com/world/2016/jul/20/three-french-special-forces- VICE News, April 7, 2016, https://news.vice.com/ soldiers-die-in-libya-helicopter-crash. article/exclusive-how-the-uk-secretly-helped- direct-lethal-us-drone-strikes-in-yemen. 1DWKDOLH*XLEHUW´,UDN3DULVFRQÀUPH TX·XQGURQHSLpJpDEOHVVpGHX[PHPEUHVGHV 252 HMG, “Securing Britain in an Age of forces spéciales françaises à Erbil,” Le Monde.fr, Uncertainty: The Strategic Defence and Security October 11, 2016, sec. International, http://www. Review,” 12. lemonde.fr/proche-orient/article/2016/10/11/irak- 253 HMG, “National Security Strategy and deux-commandos-francais-gravement-blesses-a- Strategic Defence and Security Review 2015: A erbil-par-un-drone-piege_5011751_3218.html. Secure and Prosperous United Kingdom,” para. 241 Ewen MacAskill and Paul Johnson, “MI5 2.12. +HDG¶LQFUHDVLQJO\$JJUHVVLYH·5XVVLDD*URZLQJ %URRNH+ROODQG´5HVHDUFK%ULHÀQJV Threat to UK,” The Guardian, November 1, Overview of Military Drones Used by the UK 2016, sec. UK news, https://www.theguardian. Armed Forces.” com/uk-news/2016/oct/31/andrew-parker- increasingly-aggressive-russia-a-growing-threat- 255 UK MOD, “House of Commons: Written

53 | All quiet on the ISIS front? Statement (HCWS149),” July 20, 2015. 266 Reprieve, “UK Govt Statement on Embedded Personnel Not Real Transparency.” 256 “Syria Air Strikes”; Ministry of Defence, “UK Is Not Currently Conducting Air Strikes 267 Parliament, “House of Commons Debate on in Syria. Embed Programme with Allies Is 20 July 2015.” Long-Standing. Full Statement:pic.twitter.com/ jwiPtQm7I2,” microblog, @DefenceHQ, (July 268 UK MOD, “House of Commons: Written 17, 2015), https://twitter.com/DefenceHQ/ Statement (HCWS149),” July 20, 2015. status/621951937869647872?ref_ 269 UK MOD, “House of Commons: Written src=twsrc%5Etfw. Statement (HCWS149),” July 20, 2015. 257 Martin Faix, “Rules of Engagement: Some 270 Parliament, “House of Commons Debate on Basic Questions and Current Issues” CYIL, no. 1 20 July 2015.” (2010). 271 Camilla Turner and Steven Swinford, “David 258 Alan Cole et al., “Sanremo Handbook on &DPHURQ¶.QHZ%ULWLVK3LORWV:HUH%RPELQJ Rules of Engagement” (International Institute 6\ULD·DV,W+DSSHQHG-XO\µ-XO\ of Humanitarian Law, November 2009), http:// 2015, sec. News, http://www.telegraph.co.uk/ www.iihl.org/wp-content/uploads/2015/12/ROE- news/uknews/defence/11745689/British-pilots- HANDBOOK-ENGLISH.pdf. in-air-strikes-against-Isil-in-Syria-live.html?WT. 259 Ben Emmerson, “Promotion and Protection of mc_id=e_DM32918&WT.tsrc=email&etype=Edi_ Human Rights and Fundamental Freedoms While Pol_New&utm_source=email&utm_ Countering Terrorism” (United Nations, September medium=Edi_Pol_New_2015_07_17&utm_ 18, 2013), http://www.securitycouncilreport. campaign=DM32918. org/atf/cf/%7B65BFCF9B-6D27-4E9C-8CD3- 272 Parliament, “House of Commons Debate on CF6E4FF96FF9%7D/a_68_389.pdf. 20 July 2015.” 260 Birmingham Policy Commission, “The 273 Turner and Swinford, “David Cameron Security Impact of Drones: Challenges ¶.QHZ%ULWLVK3LORWV:HUH%RPELQJ6\ULD·DV,W and Opportunities for the UK” (University Happened, July 17, 2015.” of Birmingham, October 2014), http://www. birmingham.ac.uk/Documents/research/ 274 Ibid. SROLF\FRPPLVVLRQUHPRWHZDUIDUHÀQDOUHSRUW october-2014.pdf; Parliament, “House of %URRNH+ROODQG´5HVHDUFK%ULHÀQJV Commons Debate on 20 July 2015.” Overview of Military Drones Used by the UK Armed Forces.” 261 Birmingham Policy Commission, “The Security Impact of Drones: Challenges and 276 Nick McCarthy and Luke Beardsworth, Opportunities for the UK.” “Updates: ISIS Recruiter Sally Jones Named on SAS Hitlist,” Birmingham Mail, November 7, 2016, 6LU-RKQ6DZHUV´6LU-RKQ6DZHUV·V6SHHFK http://www.birminghammail.co.uk/news/midlands- – Full Text,” The Guardian, October 28, 2010, sec. news/updates-isis-recruiter-sally-jones-12139562. UK news, https://www.theguardian.com/uk/2010/ oct/28/sir-john-sawers-speech-full-text. 277 Alice Ross and Spencer Ackerman, “Former Navy Chief Expresses Concern over UK Role in 263 Sir John Sawers, “Intelligence Agencies Syria Drone Strikes,” The Guardian, September Evidence Session,” § Intelligence and Security 10, 2015, sec. UK news, https://www.theguardian. Committee of Parliament (2013), http://www. com/uk-news/2015/sep/10/former-navy-chief- parliamentlive.tv/Event/Index/7c01863f-0a30- expresses-concern-over-uk-role-in-syria-drone- 4baa-925f-e2fa60bdc86c. strikes.

6DZHUV´6LU-RKQ6DZHUV·V6SHHFK²)XOO 278 Ibid. Text.” 279 Spencer Ackerman and Alice Ross, “Airstrike 265 Larry Whyte et al., “Ministers Urged to Targeting British Hacker Working for Isis Killed 3XEOLVK6HFUHW0HPRRQ¶6KDG\·'HDOZLWK Three Civilians Instead, US Admits,” The 6DXGL$UDELD7KDW2IÀFLDOV$UH+LGLQJWR3URWHFW Guardian, January 29, 2016, sec. US news, ¶1DWLRQDO6HFXULW\·µ1HZVJULR'HFHPEHU https://www.theguardian.com/us-news/2016/ 2015, http://www.newsgrio.com/articles/174390- jan/29/sis-airstrike-syria-civilians-killed-us-military- ministers-urged-to-publish-secret-memo-on- junaid-hussain. VKDG\GHDOZLWKVDXGLDUDELDWKDWRIÀFLDOVDUH hiding-to-protect-national-security.html. 280 Claire Phipps, Patrick Wintour, and Justin 0F&XUU\´¶+LJK'HJUHHRI&HUWDLQW\·7KDW86

Remote Control Project | 54 Strike Killed Mohammed Emwazi,” The Guardian, Force Britain to Reveal Intelligence Exchanges November 13, 2015, sec. UK news, https://www. ZLWK86·µ7KH7HOHJUDSK0D\VHF theguardian.com/uk-news/2015/nov/13/us-air- News, http://www.telegraph.co.uk/news/uknews/ strike-targets-mohammed-emwazi-uk-terrorist- defence/9289127/Court-case-over-drone- known-as-jihadi-john. strike-could-force-Britain-to-reveal-intelligence- exchanges-with-US.html. 281 Gordon Rayner, “How the US and UK Tracked down and Killed Jihadi John,” The 293 Alice Ross, “UK Government Must Clarify Telegraph, November 13, 2015, sec. World, http:// Position on Drone Intelligence-Sharing, MPs Say,” www.telegraph.co.uk/news/worldnews/islamic- The Bureau of Investigative Journalism, March state/11993569/How-the-US-and-UK-tracked- 25, 2014, https://www.thebureauinvestigates. down-and-killed-Jihadi-John.html. com/2014/03/25/uk-government-must-clarify- position-on-drone-intelligence-sharing-mps-say/; 282 Michael Smith, “Catching a Terrorist: The Bureau Reporter, “UK Government Urged to Top Secret Team Who Hunted Jihadi John,” Publish Intelligence-Sharing Guidance,” The International Business Times UK, January 15, Bureau of Investigative Journalism, November 2017, http://www.ibtimes.co.uk/catching-terrorist- 28, 2014, https://www.thebureauinvestigates. top-secret-team-who-hunted-jihadi-john-1600951. com/2014/11/28/uk-government-urged-to-publish- intelligence-sharing-guidance/. 283 Ross and Ackerman, “Former Navy Chief Expresses Concern over UK Role in Syria Drone 294 Jack Serle, “UK Complicity in US Drone Strikes.” 6WULNHV,V¶,QHYLWDEOH·(PPHUVRQ7HOOV Parliament,” The Bureau of Investigative 284 Alice Ross, “MPs Call for Guidance on Journalism, December 5, 2013, https://www. Prosecuting UK Spies over US Drone Strikes,” thebureauinvestigates.com/2013/12/05/uk- The Guardian, July 7, 2015, sec. Politics, https:// complicity-in-us-drone-strikes-is-inevitable- www.theguardian.com/politics/2015/jul/07/mps- emmerson-tells-parliament/. guidance-prosecuting-uk-spies-us-drone-strikes. 295 Steve Swann, “CIA Drone Strikes: Is the UK 285 J L Mombasa, “A Very British Execution?,” Involved?,” BBC News, December 21, 2012, sec. The Economist, June 25, 2012, http://www. UK, http://www.bbc.co.uk/news/uk-20804072. economist.com/blogs/baobab/2012/01/shabab- somalia. 5\DQ*DOODJKHU´7KH16$·V%ULWLVK%DVH at the Heart of U.S. Targeted Killing,” The 286 Ryan Gallagher, “The Drone Papers,” The Intercept, September 6, 2016, https://theintercept. Intercept, October 15, 2015, https://theintercept. com/2016/09/06/nsa-menwith-hill-targeted-killing- com/drone-papers/. surveillance/. 287 Ibid. 297 Namir Shabibi and Jack Watling, “Cash, 288 Ibid. &DQG\DQG¶&ROODWHUDO'DPDJH·$Q$QDWRP\RI a CIA-MI6 Drone Assassination,” VICE News, 289 Mombasa, “A Very British Execution?” April 13, 2016, https://news.vice.com/article/cash- candy-and-collateral-damage-an-anatomy-of-a- 290 Alice Ross and James Ball, “GCHQ cia-mi6-drone-assassination-1. Documents Raise Fresh Questions over UK Complicity in US Drone Strikes,” The Guardian, 298 Ross and Ball, “GCHQ Documents Raise June 24, 2015, sec. UK news, http://www. Fresh Questions over UK Complicity in US theguardian.com/uk-news/2015/jun/24/gchq- Drone Strikes”; “Defence in the Media: 25 June documents-raise-fresh-questions-over-uk- 2015 | Defence in the Media,” accessed April 14, complicity-in-us-drone-strikes. 2016, https://modmedia.blog.gov.uk/2015/06/25/ defence-in-the-media-25-june-2015/. 291 David Leppard, “GCHQ Finds Al-Qaeda for American Strikes,” The Sunday Times, July 25, 299 Ross and Ball, “GCHQ Documents Raise 2010, http://www.thesundaytimes.co.uk/sto/news/ Fresh Questions over UK Complicity in US Drone uk_news/Defence/article353492.ece; Ross and Strikes.” Ball, “GCHQ Documents Raise Fresh Questions over UK Complicity in US Drone Strikes”; Scott 300 “A Wedding Became a Funeral: US Drone Shane, “Documents on 2012 Drone Strike Attack on Marriage Procession in Yemen,” Human Detail How Terrorists Are Targeted,” The New Rights Watch, 2014, https://www.hrw.org/sites/ York Times, June 24, 2015, http://www.nytimes. GHIDXOWÀOHVUHSRUWV\HPHQB)RU8SORDGB com/2015/06/25/world/middleeast/us-drone-strike- pdf. said-to-kill-doctor-trying-to-implant-bombs.html. :DWOLQJDQG6KDELEL´%ULWDLQ·V&RYHUW:DULQ ´&RXUW&DVHRYHU'URQH6WULNH¶&RXOG Yemen”

55 | All quiet on the ISIS front? 302 Ibid. Helping Saudi Arabia Wage a Devastating Aerial Campaign in Yemen,” Human Rights 303 Shabibi and Watling, “Cash, Candy, and Watch, March 30, 2016, https://www.hrw.org/ ¶&ROODWHUDO'DPDJH·µ news/2016/03/30/us-quietly-helping-saudi- arabia-wage-devastating-aerial-campaign- :DWOLQJDQG6KDELEL´%ULWDLQ·V&RYHUW:DULQ \HPHQ%RZFRWW´8.0LOLWDU\2IÀFHUV*LYH Yemen.” Targeting Training to Saudi Military”; Richard 305 Ibid. Norton-Taylor, “Two Key Defence Questions Facing Britain: Trident and the Middle East,” 2ZHQ%RZFRWW´8.0LOLWDU\2IÀFHUV*LYH The Guardian, January 20, 2016, sec. Targeting Training to Saudi Military,” The News, https://www.theguardian.com/news/ Guardian, April 15, 2016, sec. UK news, https:// defence-and-security-blog/2016/jan/20/two- www.theguardian.com/uk-news/2016/apr/15/ key-defence-questions-facing-britain-trident- XNDUP\RIÀFHUVSURYLGHWDUJHWLQJWUDLQLQJVDXGL and-the-middle-east; Michael Fallon, “Yemen: military. Military Intervention: Written Question - 49029,” UK Parliament, October 20, 2016, http://www. 307 “Defence in the Media: 8 April 2016 | Defence parliament.uk/business/publications/written- in the Media,” GOV.UK, April 8, 2016, https:// questions-answers-statements/written-question/ modmedia.blog.gov.uk/2016/04/08/defence-in- Commons/2016-10-17/49029/. the-media-8-april-2016/. 317 Parliament, “House of Commons Debate 308 Ginny Hill and Baraa Shiban, “Yemen: A for 18 October 2016,” Hansard Debate, October Battle for the Future,” Remote Control Project, 18, 2016, https://hansard.parliament.uk/ November 10, 2016, http://remotecontrolproject. commons/2016-10-18/debates/ABA8E0A3-11FD- org/publications/yemen-battle-future/. 4110-B216-7A55BBE89453/Yemen.

309 Christopher Blanchard, “Saudi Arabia: 318 “US Pulls Back Staff from Saudi Background and U.S. Relations” (Congressional Arabia Devoted to Yemen Arranging” Research Service, September 20, 2016), https:// NewsDog, accessed November 22, www.fas.org/sgp/crs/mideast/RL33533.pdf. 2016, http://www.newsdogshare.com/a/ article/57ba85ff76f3df288dac2c45/. 310 “UN: Suspend Saudi Arabia from Human Rights Council,” Human Rights Watch, June 29, 3HWHU2ERUQHDQG1DZDO$O0DJKDÀ 2016, https://www.hrw.org/news/2016/06/29/un- “EXCLUSIVE: A Calamity Is Unfolding in Yemen suspend-saudi-arabia-human-rights-council. and It Is Time the World Woke up,” Middle East Eye, September 6, 2016, http://www. 311 “Yemen: Children among Civilians Killed and middleeasteye.net/essays/yemen-war-saudi- 0DLPHGLQ&OXVWHU%RPE¶PLQHÀHOGV·µ$PQHVW\ arabia-houthi-sanaa-peter-oborne-820075995. International, May 23, 2016, https://www.amnesty. org/en/latest/news/2016/05/yemen-children- 320 Richard Norton-Taylor, “UK Special Forces among-civilians-killed-and-maimed-in-cluster- and MI6 Involved in Yemen Bombing, Report ERPEPLQHÀHOGV Reveals,” The Guardian, April 11, 2016, sec. News, 6, https://www.theguardian.com/news/ :DWOLQJDQG6KDELEL´%ULWDLQ·V&RYHUW:DULQ defence-and-security-blog/2016/apr/11/uk-special- Yemen.” forces-and-mi6-involved-in-yemen-bombing- report-reveals. 313 Emma Graham-Harrison, “UK in Denial over Saudi Arms Sales Being Used in Yemen, 321 Emily Knowles, “What British War on Terror?,” Claims Oxfam,” The Guardian, August 23, 2016, Remote Control Project, October 26, 2016, http:// sec. World news, https://www.theguardian.com/ remotecontrolproject.org/publications/british-war- world/2016/aug/23/uk-in-denial-over-saudi-arms- terror/. sales-being-used-in-yemen-claims-oxfam. 322 House of Commons, “The Use of UK- 314 Hill and Shiban, “Yemen.” Manufactured Arms in Yemen: First Joint Report of the Business, Innovation and Skills and 315 Nick Hopkins, “MoD Seriously Misled Me International Development Committees of Session on Saudi Arms Sales, Says Vince Cable,” The 2016-17” (House of Commons, September 14, Guardian, November 4, 2016, sec. World news, 2016), 30. https://www.theguardian.com/world/2016/nov/04/ mod-seriously-misled-me-on-saudi-arms-sales- 323 The White House, “Report on the Legal and says-vince-cable?utm_source=esp&utm_ 3ROLF\)UDPHZRUNV*XLGLQJWKH8QLWHG6WDWHV· medium=Email&utm_ Use of Military Force and Related National Security Operations.” 316 Sarah Leah Whitson, “The US Is Quietly

Remote Control Project | 56 324 Blanchard, “Saudi Arabia: Background and 339 Parliament, “House of Commons Debate on U.S. Relations”; Zachary Fryer-Biggs, “US Slows 20 July 2015.” Arms Shipment, Intelligence Sharing to Saudi $UDELDRYHU

328 Turner and Swinford, “David Cameron 343 Parliament, “House of Commons Debate on ¶.QHZ%ULWLVK3LORWV:HUH%RPELQJ6\ULD·DV,W 20 July 2015.” Happened, July 17, 2015.” 344 “Armed Forces Update.” 329 Ibid. 345 Huw Dylan and Michael Goodman, “Guide to 330 “Prime Minister Knew RAF Were Involved the Study of Intelligence: British Intelligence,” The in Syria Air Strikes,” Mail Online, July 17, Intelligencer: Journal of U.S. Intelligence Studies. 2015, http://www.dailymail.co.uk/wires/pa/ 21, no. 2 (2015), https://kclpure.kcl.ac.uk/portal/ article-3164909/British-pilots-involved-allied-air- en/publications/guide-to-the-study-of-intelligence- strikes-Syria.html. british-intelligence(c2747b95-95a4-4c9f-be64- 643412d177a5).html. 331 Parliament, “House of Commons Debate on 20 July 2015.” 346 Hugh Robertson, “House of Commons Hansard Written Answers for 08 July 2014 (Pt 332 Ibid. 0001),” July 8, 2014, http://www.publications. parliament.uk/pa/cm201415/cmhansrd/ 333 “Armed Forces Update: Written Statement FPWH[WZKWPZ - HCWS678,” UK Parliament, accessed htm_wqn10. April 20, 2016, http://www.parliament.uk/ business/publications/written-questions- 347 HMG, “National Intelligence Machinery” (The answers-statements/written-statement/ 6WDWLRQHU\2IÀFH6HSWHPEHU KWWSVZZZ Commons/2016-04-18/HCWS678/. gov.uk/government/uploads/system/uploads/ DWWDFKPHQWBGDWDÀOHSGI 334 Michael Fallon, “UK Embedded Forces: Written Statement - HCWS431,” UK Parliament, 348 Andrew Parker, “Intelligence Agencies December 17, 2015, http://www.parliament. Evidence Session,” § Intelligence and Security uk/business/publications/written-questions- Committee of Parliament (2013), http://www. answers-statements/written-statement/ parliamentlive.tv/Event/Index/7c01863f-0a30- Commons/2015-12-17/HCWS431/. 4baa-925f-e2fa60bdc86c.

335 Reprieve, “UK Govt Statement on Embedded 349 HMG, “Intelligence Service Act” (1994), http:// Personnel Not Real Transparency.” www.legislation.gov.uk/ukpga/1994/13/pdfs/ ukpga_19940013_en.pdf. 336 Fallon, “UK Embedded Forces.” 6DZHUV´6LU-RKQ6DZHUV·V6SHHFK²)XOO 337 Reprieve, “UK Govt Statement on Embedded Text.” Personnel Not Real Transparency.” 351 “National Intelligence Machinery,” MI5 - The 338 Parliament, “Armed Forces Deployment Security Service, accessed January 4, 2017, (Royal Prerogative) Bill [HL],” Hansard Debate, https://www.mi5.gov.uk/national-intelligence- July 8, 2016, https://hansard.parliament.uk/ machinery. lords/2016-07-08/debates/16070837000491/ ArmedForcesDeployment(RoyalPrerogative) 352 HMG, “National Intelligence Machinery.” Bill(HL).

57 | All quiet on the ISIS front? 353 GOV.UK, “Joint Intelligence Committee,” 366 GOV.UK, “Investigatory Powers Bill Receives accessed January 4, 2017, https://www.gov.uk/ Royal Assent,” November 29, 2016, https://www. government/groups/joint-intelligence-committee. gov.uk/government/news/investigatory-powers- bill-receives-royal-assent. 354 MI5 - The Security Service, “National Intelligence Machinery.” 367 Anderson, “Features: Torture and Intelligence Cooperation.” 355 gov.uk, “National Security Council - GOV. UK,” gov.uk, (nd), https://www.gov.uk/government/ 368 David Anderson, “The Independent groups/national-security-council. Reviewer Writes …,” April 11, 2013, https:// terrorismlegislationreviewer.independent.gov.uk/ 356 Dylan and Goodman, “Guide to the Study of message-from-the-independent-reviewer/. Intelligence”; gov.uk, “National Security Council - GOV.UK.” 369 Ibid.

6DZHUV´6LU-RKQ6DZHUV·V6SHHFK²)XOO 370 David Anderson, “A Question of Trust: Report Text.” of the Investigatory Powers Review” (Independent Reviewer of Terrorism, June 2014), https:// 358 Richard Aldrich and Rory Cormac, The Black terrorismlegislationreviewer.independent.gov.uk/ Door: Spies, Secret Intelligence and British Prime wp-content/uploads/2015/06/IPR-Report-Print- Ministers (HarperCollins UK, 2016). Version.pdf.

7KH,QWHOOLJHQFH6HUYLFHV&RPPLVVLRQHU·V 371 Alan Travis, “Leading Terror Trial QC to Be 2IÀFH´6LU-RKQ*ROGULQJ$SSRLQWHGDVWKH Counter-Terror Laws Watchdog,” The Guardian, New Intelligence Services Commissioner,” The February 20, 2017, sec. Politics, https://www. Intelligence Services Commissioner, January 31, theguardian.com/politics/2017/feb/20/max-hill- 2017, http://intelligencecommissioner.com/news. independent-reviewer-terrorism-legislation-david- asp?id=1028. anderson-prevent.

360 Interception of Communications %%&1HZV´8.8UJHGWR5HYHDO¶7RUWXUH· &RPPLVVLRQHU·V2IÀFH´,QWHUFHSWLRQRI File,” BBC News, July 28, 2009, http://news.bbc. &RPPXQLFDWLRQV&RPPLVVLRQHU·V2IÀFHµ co.uk/1/hi/uk/8170594.stm. January 11, 2016, http://www.iocco-uk.info/. 5HSULHYH´%ULWDLQ·V7RUWXUH3ROLF\7KH 7KH,QWHOOLJHQFH6HUYLFHV&RPPLVVLRQHU·V Consolidated Guidance on the Detention and 2IÀFH´7KH&RPPLVVLRQHU·V6WDWXWRU\)XQFWLRQVµ Interviewing of Detainees Overseas.” August 21, 2014, http://intelligencecommissioner. com/content.asp?id=4. 374 Harriet Moynihan, “Aiding and $VVLVWLQJ&KDOOHQJHVLQ$UPHG&RQÁLFWDQG 362 Iain Lobban, “Intelligence Agencies Evidence Counterterrorism,” Chatham House, November Session,” § Intelligence and Security Committee 14, 2016, https://www.chathamhouse.org// of Parliament (2013), http://www.parliamentlive. node/26115. tv/Event/Index/7c01863f-0a30-4baa-925f- e2fa60bdc86c. 375 Anderson, “Features: Torture and Intelligence Cooperation.” 6DZHUV´6LU-RKQ6DZHUV·V6SHHFK²)XOO Text.” 376 Sir Mark Waller, “Report of the Intelligence Services Commissioner: Supplementary to the 364 David Anderson, “Features: Torture Annual Report for 2015” (Intelligence Services and Intelligence Cooperation,” Terrorism Commissioner, September 15, 2016), http:// Legislation Reviewer, January 26, 2017, https:// intelligencecommissioner.com/docs/FPCM1042_ terrorismlegislationreviewer.independent. HC_458_Accessible.pdf. JRYXNFDWHJRU\IHDWXUH5HSULHYH´%ULWDLQ·V Torture Policy: The Consolidated Guidance on 377 Andrew Defty, “It Is Time to Adopt a Different the Detention and Interviewing of Detainees Approach to Appointing Members of the Overseas,” December 2016, http://www.reprieve. Intelligence and Security Committee,” Democratic org.uk/wp-content/uploads/2017/01/2016_12_15_ Audit UK, March 24, 2015, http://eprints.lse. PUB-note-on-Consolidated-Guidance.pdf. ac.uk/63151/1/democraticaudit.com-It%20is%20 time%20to%20adopt%20a%20different%20 365 Anderson, “Features: Torture and Intelligence approach%20to%20appointing%20members%20 Cooperation”; Ben Wallace, “Detainees: Written of%20the%20Intelligence%20and%20 Question - 65278,” UK Parliament, March 2, 2017, Security%20Commi.pdf; Joanna Dawson, “The http://www.parliament.uk/business/publications/ Intelligence and Security Committee,” February written-questions-answers-statements/written- KWWSUHVHDUFKEULHÀQJVSDUOLDPHQWXN question/Commons/2017-02-23/65278.

Remote Control Project | 58 5HVHDUFK%ULHÀQJ6XPPDU\61IXOOUHSRUW 393 Swann, “CIA Drone Strikes.”

378 Defty, “It Is Time to Adopt a Different :DWOLQJDQG6KDELEL´%ULWDLQ·V&RYHUW:DULQ Approach to Appointing Members of the Yemen.” Intelligence and Security Committee.” 395 Hugh Robertson, “Yemen: Military 379 Dawson, “The Intelligence and Security Intervention: Written Question - 204032,” Committee.” UK Parliament, July 10, 2014, http://www. parliament.uk/business/publications/written- &DELQHW2IÀFHDQG+RPH2IÀFH´([SODQDWRU\ questions-answers-statements/written-question/ Notes to Justice and Security Act 2013,” 2013, Commons/2014-07-03/204032. http://www.legislation.gov.uk/ukpga/2013/18/ notes. 396 Robertson, “House of Commons Hansard Written Answers for 08 July 2014 (Pt 0001).” 381 Defty, “It Is Time to Adopt a Different Approach to Appointing Members of the 397 Alice Ross, “UK Faces Calls for Intelligence- Intelligence and Security Committee.” Sharing Guidance over Drone Attacks,” The Guardian, June 26, 2015, sec. UK news, https:// 382 Nick Hopkins, “From Turing to Snowden: www.theguardian.com/uk-news/2015/jun/26/uk- How US-UK Pact Forged Modern Surveillance,” intelligence-sharing-guidance-drone-war-zone. The Guardian, December 2, 2013, sec. US news, https://www.theguardian.com/world/2013/ *DOODJKHU´7KH16$·V%ULWLVK%DVHDWWKH dec/02/turing-snowden-transatlantic-pact-modern- Heart of U.S. Targeted Killing.” surveillance. 399 Richard Aldrich, “Hearing of British Experts 383 Waller, “Report of the Intelligence Services RQ(GZDUG6QRZGHQ·V5HYHODWLRQVµ%XQGHVWDJ Commissioner: Supplementary to the Annual Bundestag, (December 2016), http://www. Report for 2015.” bundestag.de/

384 Ibid. 400 Birmingham Policy Commission, “The Security Impact of Drones: Challenges and 385 Jaffey, “Hearing of British Experts on Edward Opportunities for the UK.” 6QRZGHQ·V5HYHODWLRQVµ%XQGHVWDJ

386 Waller, “Report of the Intelligence Services Commissioner: Supplementary to the Annual Report for 2015.”

387 “Snoopers Scolded,” The Economist, February 13, 2016, http://www.economist.com/ news/britain/21692918-parliamentary-committee- blasts-government-surveillance-plans-snoopers- scolded.

388 Anthony Glees, October 25, 2016 (interview).

389 Sean Kippin, “How Democratically $FFRXQWDEOH$UHWKH8.·V6HFXULW\DQG Intelligence Services?,” Democratic Audit UK, March 9, 2016, http://www.democraticaudit. com/2016/03/09/how-democratically-accountable- are-the-uks-security-and-intelligence-services/.

390 Kerbaj and Shipman, “Spies Told to Come &OHDQRQ&DPHURQ·V2UGHUWR.LOOµ

391 Hugh Bochel, Andrew Defty, and Jane .LUNSDWULFN´¶1HZ0HFKDQLVPVRI,QGHSHQGHQW $FFRXQWDELOLW\·6HOHFW&RPPLWWHHVDQG Parliamentary Scrutiny of the Intelligence Services,” Parliamentary Affairs 68, no. 2 (April 1, 2015): 314–31.

392 Ibid.

59 | All quiet on the ISIS front? Remote Control Project Oxford Research Group Development House 56-64 Leonard Street London EC2A 4LT United Kingdom

+44 (0)207 549 0298 [email protected] www.remotecontrolproject.org

Remote Control Project | 60