NIPBL (Human) Recombinant Protein (P01)

NIPBL (Human) Recombinant Drosophila melanogaster Nipped-B gene product and Protein (P01) fungal Scc2-type sister chromatid cohesion proteins. The Drosophila protein facilitates enhancer-promoter Catalog Number: H00025836-P01 communication of remote enhancers and plays a role in developmental regulation. It is also homologous to a Regulation Status: For research use only (RUO) family of chromosomal adherins with broad roles in sister chromatid cohesion, chromosome condensation, and Product Description: Human NIPBL full-length ORF ( DNA repair. The human protein has a bipartite nuclear AAH33847.1, 1 a.a. - 175 a.a.) recombinant protein with targeting sequence and a putative HEAT repeat. GST-tag at N-terminal. Condensins, cohesins and other complexes with chromosome-related functions also contain HEAT Sequence: repeats. Mutations in this gene result in Cornelia de MKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFS Lange syndrome, a disorder characterized by DSKIQKYSPSESAKVYDKAINRKTGVHFHPKQTLDFLR dysmorphic facial features, growth delay, limb reduction SDMANSKITEEVKRSIVKQYLDFKLLMEHLDPDEEEEE defects, and mental retardation. Two transcript variants GEVSASTNARNKAITSLLGGGSPKNNTAAETEDDESD encoding different isoforms have been found for this GEDRGGGTSGVRRRRSQRISQRIT gene. [provided by RefSeq] Host: Wheat Germ (in vitro) Theoretical MW (kDa): 45.9 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 25836 Gene Symbol: NIPBL Gene Alias: CDLS, CDLS1, DKFZp434L1319, FLJ11203, FLJ12597, FLJ13354, FLJ13648, FLJ44854, IDN3, IDN3-B Gene Summary: This gene encodes the homolog of the Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Topologically Associating Domain Boundaries Are Commonly
bioRxiv preprint doi: https://doi.org/10.1101/2021.05.06.443037; this version posted May 7, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Topologically Associating Domain Boundaries are Commonly Required for Normal Genome Function Sudha Rajderkar1, Iros Barozzi1,2,3, Yiwen Zhu1, Rong Hu4, Yanxiao Zhang4, Bin Li4, Yoko Fukuda- Yuzawa1,5, Guy Kelman1,6, Adyam Akeza1, Matthew J. Blow15, Quan Pham1, Anne N. Harrington1, Janeth Godoy1, Eman M. Meky1, Kianna von Maydell1, Catherine S. Novak1, Ingrid Plajzer-Frick1, Veena Afzal1, Stella Tran1, Michael E. Talkowski7,8,9, K. C. Kent Lloyd10,11, Bing Ren4,12,13,14, Diane E. Dickel1,*, Axel Visel1,15,16,*, Len A. Pennacchio1,15, 17,* 1 Environmental Genomics & System Biology Division, Lawrence Berkeley National Laboratory, 1 Cyclotron Road, Berkeley, CA 94720, USA. 2 Institute of Cancer Research Medical University of Vienna, Borschkegasse 8a 1090, Vienna, Austria. 3 Department of Surgery and Cancer, Imperial College London, London, UK. 4 Ludwig Institute for Cancer Research, La Jolla, CA, USA. 5 Institute of Advanced Biosciences, Keio University, Tsuruoka, Yamagata, Japan. 6 The Jerusalem Center for Personalized Computational Medicine, Hebrew University of Jerusalem, Jerusalem, Israel. 7 Center for Genomic Medicine, Massachusetts General Hospital, Boston, MA 02114, USA. 8 Program in Medical and Population Genetics and Stanley Center for Psychiatric Disorders, Broad Institute of Harvard and Massachusetts Institute of Technology, Cambridge, MA 02142, USA.
[Show full text]
The Mutational Landscape of Myeloid Leukaemia in Down Syndrome
cancers Review The Mutational Landscape of Myeloid Leukaemia in Down Syndrome Carini Picardi Morais de Castro 1, Maria Cadefau 1,2 and Sergi Cuartero 1,2,* 1 Josep Carreras Leukaemia Research Institute (IJC), Campus Can Ruti, 08916 Badalona, Spain; [email protected] (C.P.M.d.C); [email protected] (M.C.) 2 Germans Trias i Pujol Research Institute (IGTP), Campus Can Ruti, 08916 Badalona, Spain * Correspondence: [email protected] Simple Summary: Leukaemia occurs when specific mutations promote aberrant transcriptional and proliferation programs, which drive uncontrolled cell division and inhibit the cell’s capacity to differentiate. In this review, we summarize the most frequent genetic lesions found in myeloid leukaemia of Down syndrome, a rare paediatric leukaemia specific to individuals with trisomy 21. The evolution of this disease follows a well-defined sequence of events and represents a unique model to understand how the ordered acquisition of mutations drives malignancy. Abstract: Children with Down syndrome (DS) are particularly prone to haematopoietic disorders. Paediatric myeloid malignancies in DS occur at an unusually high frequency and generally follow a well-defined stepwise clinical evolution. First, the acquisition of mutations in the GATA1 transcription factor gives rise to a transient myeloproliferative disorder (TMD) in DS newborns. While this condition spontaneously resolves in most cases, some clones can acquire additional mutations, which trigger myeloid leukaemia of Down syndrome (ML-DS). These secondary mutations are predominantly found in chromatin and epigenetic regulators—such as cohesin, CTCF or EZH2—and Citation: de Castro, C.P.M.; Cadefau, in signalling mediators of the JAK/STAT and RAS pathways.
[Show full text]
Gene Regulation by Cohesin in Cancer: Is the Ring an Unexpected Party to Proliferation?
Published OnlineFirst September 22, 2011; DOI: 10.1158/1541-7786.MCR-11-0382 Molecular Cancer Review Research Gene Regulation by Cohesin in Cancer: Is the Ring an Unexpected Party to Proliferation? Jenny M. Rhodes, Miranda McEwan, and Julia A. Horsfield Abstract Cohesin is a multisubunit protein complex that plays an integral role in sister chromatid cohesion, DNA repair, and meiosis. Of significance, both over- and underexpression of cohesin are associated with cancer. It is generally believed that cohesin dysregulation contributes to cancer by leading to aneuploidy or chromosome instability. For cancers with loss of cohesin function, this idea seems plausible. However, overexpression of cohesin in cancer appears to be more significant for prognosis than its loss. Increased levels of cohesin subunits correlate with poor prognosis and resistance to drug, hormone, and radiation therapies. However, if there is sufficient cohesin for sister chromatid cohesion, overexpression of cohesin subunits should not obligatorily lead to aneuploidy. This raises the possibility that excess cohesin promotes cancer by alternative mechanisms. Over the last decade, it has emerged that cohesin regulates gene transcription. Recent studies have shown that gene regulation by cohesin contributes to stem cell pluripotency and cell differentiation. Of importance, cohesin positively regulates the transcription of genes known to be dysregulated in cancer, such as Runx1, Runx3, and Myc. Furthermore, cohesin binds with estrogen receptor a throughout the genome in breast cancer cells, suggesting that it may be involved in the transcription of estrogen-responsive genes. Here, we will review evidence supporting the idea that the gene regulation func- tion of cohesin represents a previously unrecognized mechanism for the development of cancer.
[Show full text]
Cohesin Mutations in Cancer: Emerging Therapeutic Targets
International Journal of Molecular Sciences Review Cohesin Mutations in Cancer: Emerging Therapeutic Targets Jisha Antony 1,2,*, Chue Vin Chin 1 and Julia A. Horsfield 1,2,3,* 1 Department of Pathology, Otago Medical School, University of Otago, Dunedin 9016, New Zealand; [email protected] 2 Maurice Wilkins Centre for Molecular Biodiscovery, The University of Auckland, Auckland 1010, New Zealand 3 Genetics Otago Research Centre, University of Otago, Dunedin 9016, New Zealand * Correspondence: [email protected] (J.A.); julia.horsfi[email protected] (J.A.H.) Abstract: The cohesin complex is crucial for mediating sister chromatid cohesion and for hierarchal three-dimensional organization of the genome. Mutations in cohesin genes are present in a range of cancers. Extensive research over the last few years has shown that cohesin mutations are key events that contribute to neoplastic transformation. Cohesin is involved in a range of cellular processes; therefore, the impact of cohesin mutations in cancer is complex and can be cell context dependent. Candidate targets with therapeutic potential in cohesin mutant cells are emerging from functional studies. Here, we review emerging targets and pharmacological agents that have therapeutic potential in cohesin mutant cells. Keywords: cohesin; cancer; therapeutics; transcription; synthetic lethal 1. Introduction Citation: Antony, J.; Chin, C.V.; Genome sequencing of cancers has revealed mutations in new causative genes, includ- Horsfield, J.A. Cohesin Mutations in ing those in genes encoding subunits of the cohesin complex. Defects in cohesin function Cancer: Emerging Therapeutic from mutation or amplifications has opened up a new area of cancer research to which Targets.
[Show full text]
NIPBL Mutations and Genetic Heterogeneity in Cornelia De Lange
1of6 J Med Genet: first published as 10.1136/jmg.2004.026666 on 9 December 2004. Downloaded from ONLINE MUTATION REPORT NIPBL mutations and genetic heterogeneity in Cornelia de Lange syndrome G Borck, R Redon, D Sanlaville, M Rio, M Prieur, S Lyonnet, M Vekemans, N P Carter, A Munnich, L Colleaux, V Cormier-Daire ............................................................................................................................... J Med Genet 2004;41:e128 (http://www.jmedgenet.com/cgi/content/full/41/12/e128). doi: 10.1136/jmg.2004.026666 ornelia de Lange syndrome (CdLS, also called Key points Brachmann de Lange syndrome; OMIM 122470) is Ccharacterised by pre- and postnatal growth retardation, microcephaly, severe mental retardation with speech delay, N Cornelia de Lange syndrome (CdLS) is characterised feeding problems, major malformations including limb by facial dysmorphism, microcephaly, growth and defects, and characteristic facial features.1 Facial dysmorph- mental retardation, and congenital anomalies includ- ism includes arched eyebrows, synophrys, short nose with ing limb defects. Mutations in the gene NIPBL, the anteverted nares, long philtrum, thin upper lip, and micro- human homolog of Drosophila Nipped-B, have gnathia. Although few autosomal dominant forms of CdLS recently been found in 20–50% of CdLS cases. 23 have been described, the large majority of cases are N We extensively analysed a series of 14 children with sporadic, and the scarcity of these familial forms has CdLS. The study included a high resolution chromo- hampered the identification of the gene(s) underlying some analysis, a search for small chromosome CdLS.4 Finally, rare cases of CdLS have been associated with 5–7 imbalances using array-CGH at 1 Mb resolution, and balanced chromosomal translocations.
[Show full text]
Principles of Genome Folding Into Topologically Associating Domains Quentin Szabo, Frederic Bantignies, Giacomo Cavalli
Principles of genome folding into topologically associating domains Quentin Szabo, Frederic Bantignies, Giacomo Cavalli To cite this version: Quentin Szabo, Frederic Bantignies, Giacomo Cavalli. Principles of genome folding into topologi- cally associating domains. Science Advances , American Association for the Advancement of Science (AAAS), 2019, 5 (4), pp.eaaw1668. 10.1126/sciadv.aaw1668. hal-02990881 HAL Id: hal-02990881 https://hal.archives-ouvertes.fr/hal-02990881 Submitted on 13 Nov 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution - NonCommercial| 4.0 International License SCIENCE ADVANCES | REVIEW GENETICS Copyright © 2019 The Authors, some rights reserved; Principles of genome folding into topologically exclusive licensee American Association associating domains for the Advancement Quentin Szabo, Frédéric Bantignies*, Giacomo Cavalli* of Science. No claim to original U.S. Government Works. Distributed under a Creative Understanding the mechanisms that underlie chromosome folding within cell nuclei is essential to determine the rela- Commons Attribution tionship between genome structure and function. The recent application of “chromosome conformation capture” NonCommercial techniques has revealed that the genome of many species is organized into domains of preferential internal chro- License 4.0 (CC BY-NC).
[Show full text]
Table of Contents Chapter 1: Introduction
MIAMI UNIVERSITY The Graduate School Certificate for Approving the Dissertation We hereby approve the Dissertation Of Desheng Liu Candidate for the Degree: Doctor of Philosophy _____________________________________ (Dr. Christopher A. Makaroff, Director) _____________________________________ (Carole Dabney-Smith, Committee Chair) _____________________________________ (Dr. Michael A. Kennedy, Reader) _____________________________________ (Dr. David L. Tierney, Reader) _____________________________________ (Dr. Eileen K. Bridge, Graduate School Representative) ABSTRACT OVEREXPRESSION OF NTAP:ATCTF7∆B LEADS TO PLEIOTROPIC DEFECTS IN REPRODUCTION AND VEGETATIVE GROWTH IN ARABIDOPSIS by Desheng Liu Eco1/Ctf7 plays a critical role in the establishment of sister chromatid cohesion, which is required for the faithful segregation of replicated chromosomes. Inactivation of Arabidopsis CTF7 (AtCTF7) results in severe reproductive and vegetative growth defects. To further investigate potential roles of AtCTF7 and to identify AtCTF7 interacting proteins, several AtCTF7 constructs were generated and expressed in Arabidopsis plants. 35S:NTAP:AtCTF7∆B (AtCTF7∆299-345) transgenic plants displayed a wide range of phenotypic alterations in reproduction and vegetative growth. Male meiocytes from 35S:NTAP:AtCTF7∆B plants exhibited defective chromosome segregation and ultimately fragmented chromosomes. Mutant ovules developed asynchronously, experienced prolonged meiotic and megagametophytic stages and produced megaspores/embryo sacs that degenerated at various stages. The transgenic plants also exhibited a broad range of vegetative defects, including meristem disruption and apparent epigenetic alterations. Transcripts for epigenetically regulated transposable elements were elevated in transgenic plants. 35S:AtCTF7∆B transgenic plants also exhibited reduced fertility and vegetative defects, with the 35S:AtCTF7∆B defects appearing more severe than those in 35S:NTAP:AtCTF7∆B plants. Additional phenotypes were also observed in 35S:AtCTF7∆B transgenic plants.
[Show full text]
Cytogenetics
Atlas of Genetics and Cytogenetics in Oncology and Haematology INIST -CNRS OPEN ACCESS JOURNAL Leukaemia Section Short Communication t(5;12)(p13;p1 3) NIPBL/ETV6 Etienne De Braekeleer, Juan Ramón González García, Janet Margarita Soto Padilla, Carlos Cordova Fletes, Frédéric Morel, Nathalie Douet-Guilbert, Marc De Braekeleer Cytogenetics Laboratory, Faculty of Medicine, University of Brest, France (ED, FM, NDG, MD), Division de Genetica. Centro de Investigacion Biomedica de Occidente. IMSS. Guadalajara, Jalisco, Mexico (JRG), Departamento de Hematologia. HUMAE-H. Pediatria. Centro Medico Nacional de Occidente. IMSS. Guadalajara, Jalisco, Mexico (JMS), Unidad de Biologia Molecular, Genomica y Secuenciacion, Centro de Investigacion y Desarrollo en Ciencias de la Salud, Universidad Autonoma de Nuevo Leon, Monterrey, Nuevo Leon, Mexico (CC) Published in Atlas Database: November 2012 Online updated version : http://AtlasGeneticsOncology.org/Anomalies/t0512p13p13ID1616.html DOI: 10.4267/2042/48765 This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 2.0 France Licence. © 2013 Atlas of Genetics and Cytogenetics in Oncology and Haematology Clinics and pathology Evolution The patient relapsed 24 months later, alive 32 months Disease following diagnosis. Acute myeloid leukemia (AML-M7) Epidemiology Genetics This is a rare chromosomal rearrangement, only Note reported twice, without molecular characterization The t(5;12)(p13;p13) involves the ETV6 gene (12p13), (Sessarego et al., 1989; Shimizu et al., 1991).
[Show full text]
Cornelia De Lange Syndrome with NIPBL Gene Mutation: a Case Report
CASE REPORT Pediatrics DOI: 10.3346/jkms.2010.25.12.1821 • J Korean Med Sci 2010; 25: 1821-1823 Cornelia de Lange Syndrome with NIPBL Gene Mutation: A Case Report Kyung-Hee Park1, Seung-Tae Lee2, Cornelia de Lange Syndrome (CdLS) is a multiple congenital anomaly characterized by Chang-Seok Ki2, and Shin-Yun Byun3 distinctive facial features, upper limb malformations, growth and cognitive retardation. The diagnosis of the syndrome is based on the distinctive clinical features. The etiology is Department of Pediatrics1, Pusan National University Hospital, Busan; Department of still not clear. Mutations in the sister chromatid cohesion factor genes NIPBL, SMC1A (also Laboratory Medicine2, Samsung Medical Center, called SMC1L1) and SMC3 have been suggested as probable cause of this syndrome. We Sungkyunkwan University, Seoul; Department of experienced a case of newborn with CdLS showing bushy eyebrows and synophrys, long Pediatrics3, Pusan National University Yangsan curly eyelashes, long philtrum, downturned angles of the mouth and thin upper lips, cleft Hospital, Yangsan, Korea palate, micrognathia, excessive body hair, micromelia of both hands, flexion contracture Received: 24 March 2010 of elbows and hypertonicity. We detected a NIPBL gene mutation in a present neonate Accepted: 24 May 2010 with CdLS, the first report in Korea. Address for Correspondence: Shin-Yun Byun, M.D. Key Words: De Lange Syndrome; Genes; NIPBL Department of Pediatrics, Pusan National University Yangsan Hospital, Beomeo-ri, Mulgeum-eup, Yangsan 626-770, Korea Tel: +82.55-360-2180, Fax: +82.55-360-2181 E-mail: [email protected] INTRODUCTION ficulty requiring continuous positive airway pressure. No evi- dence of respiratory distress syndrome was noted on a chest ra- Cornelia de Lange Syndrome (CdLS) is a multiple congenital diograph.
[Show full text]
Transcriptional Regulators Are Upregulated in the Substantia Nigra
Journal of Emerging Investigators Transcriptional Regulators are Upregulated in the Substantia Nigra of Parkinson’s Disease Patients Marianne Cowherd1 and Inhan Lee2 1Community High School, Ann Arbor, MI 2miRcore, Ann Arbor, MI Summary neurological conditions is an established practice (3). Parkinson’s disease (PD) affects approximately 10 Significant gene expression dysregulation in the SN and million people worldwide with tremors, bradykinesia, in the striatum has been described, particularly decreased apathy, memory loss, and language issues. Though such expression in PD synapses. Protein degradation has symptoms are due to the loss of the substantia nigra (SN) been found to be upregulated (4). Mutations in SNCA brain region, the ultimate causes and complete pathology are unknown. To understand the global gene expression (5), LRRK2 (6), and GBA (6) have also been identified changes in SN, microarray expression data from the SN as familial markers of PD. SNCA encodes alpha- tissue of 9 controls and 16 PD patients were compared, synuclein, a protein found in presynaptic terminals that and significantly upregulated and downregulated may regulate vesicle presence and dopamine release. genes were identified. Among the upregulated genes, Eighteen SNCA mutations have been associated with a network of 33 interacting genes centered around the PD and, although the exact pathogenic mechanism is cAMP-response element binding protein (CREBBP) was not confirmed, mutated alpha-synuclein is the major found. The downstream effects of increased CREBBP- component of protein aggregates, called Lewy bodies, related transcription and the resulting protein levels that are often found in PD brains and may contribute may result in PD symptoms, making CREBBP a potential therapeutic target due to its central role in the interactive to cell death.
[Show full text]
Characterization of the NIPBL Protein Associated with Cornelia De Lange Syndrome
Characterization of the NIPBL protein associated with Cornelia de Lange Syndrome A Thesis Submitted to the Faculty of Drexel University by Daniel K. Keter in partial fulfillment of the requirements for the degree of Master of Science June 2008 ii Acknowledgements I would like to thank Dr. Mark S. Lechner for his advice, my committee members, Dr. Mary K. Howett for her time and invaluable assistance, Dr. Aleister Saunders and Dr. Felice Elefant. My regards also to Dr. Ian Krantz and Dr. Matthew Deardorff of the Childrens Hospital of Pennsylvania for their assistance, and my family members for being by my side. iii TABLE OF CONTENTS List of Tables v List of Illustrations vi Abstract vii Introduction 1 Cornelia de Lange syndrome 1 NIPBL and its relation to CDLS 3 NIPBL homologs and its chromosomal and DNA repair roles 7 Chromatin 17 Chromatin and its importance in gene regulation 18 Heterochromatin Protein 1 (HP1) 21 HP1 binds other proteins by its chromoshadow domain 22 HP1 in epigenetic silencing, gene regulation and chromatin remodeling 28 Malfunction/mutation of chromatin in other disease syndromes 29 Rationale, Hypothesis and Experimental Objective 30 Materials and Methods 32 Plasmid construction 32 Cell culture and transfection 32 Immunoflourescence Analysis 33 Doubling time 33 Western blot analysis 34 Antibodies 35 Recombinant proteins 35 Mouse protein heart extracts 35 Metaphase spreads 36 iv Results 37 Characterization and morphological characteristics of CdLS cells 37 Specificity and colocalization of anti-NIPBL and anti-HP1 antibodies
[Show full text]
NIPBL: a New Player in Myeloid Cell Ferrata Storti Foundation Differentiation
ARTICLE Hematopoiesis NIPBL: a new player in myeloid cell Ferrata Storti Foundation differentiation Mara Mazzola,1* Gianluca Deflorian,2* Alex Pezzotta,1 Laura Ferrari,2 Grazia Fazio,3 Erica Bresciani,4 Claudia Saitta,3 Luca Ferrari,1 Monica Fumagalli,5 Matteo Parma,5 Federica Marasca,6 Beatrice Bodega,6 Paola Riva,1 Franco Cotelli,7 Andrea Biondi,3 Anna Marozzi,1 Gianni Cazzaniga3 and Anna Pistocchi1 1Dipartimento di Biotecnologie Mediche e Medicina Traslazionale, Università degli Studi di 2 Haematologica 2019 Milano, LITA, Segrate, Italy; Istituto FIRC di Oncologia Molecolare, IFOM, Milano, Italy; 3Centro Ricerca Tettamanti, Clinica Pediatrica Università di Milano-Bicocca, Centro Maria Volume 104(7):1332-1341 Letizia Verga, Monza, Italy; 4Oncogenesis and Development Section, National Human Genome Research Institute, National Institutes of Health, Bethesda, MD, USA; 5Clinica Ematologica e Centro Trapianti di Midollo Osseo, Ospedale San Gerardo, Università di Milano-Bicocca, Monza, Italy; 6Istituto Nazionale di Genetica Molecolare "Romeo ed Enrica Invernizzi" (INGM), Milano, Italy and 7Dipartimento di Bioscienze, Università degli Studi di Milano, Milano, Italy. * MM and GDF contributed equally to this work ABSTRACT he nucleophosmin 1 gene (NPM1) is the most frequently mutated gene in acute myeloid leukemia. Notably, NPM1 mutations are Talways accompanied by additional mutations such as those in cohesin genes RAD21, SMC1A, SMC3, and STAG2 but not in the cohesin regulator, nipped B-like (NIPBL). In this work, we analyzed a cohort of adult patients with acute myeloid leukemia and NPM1 mutation and observed a specific reduction in the expression of NIPBL but not in other cohesin genes. In our zebrafish model, overexpression of the mutated form of NPM1 also induced downregulation of nipblb, the zebrafish ortholog of Correspondence: human NIPBL.
[Show full text]